Citrus Sinensis ID: 047708


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------
QEDYNIPIEVLARYGWGLRCLQNVDSVEKARGRARSAVSTLIFSYLLIDGGKEGYVKMHDVVRYVAQQIASKNKFMIKAGVELKDWPSINKFEDLTGISLMFNDIHEVPDELECPKLQALLLQENSLLVIPDRFFQGMKDLKVLDMGGIRGFSLPSSLSFLINLRTLSLHDCRRFGDLPLIGELSLLEILDLSKSDVSEIPISFGRLSHLRLLDLTDCDDLELIPRGVLSRLRKLEELYMSRSFHHWQFEGEEDSSSNAKFIELGSLSRLTSLHIHIPNGKIMSSDMSFQNLTSFSITIGDLAAGFISAAIEVFSRKFKKRCSRAMGLSQDMRISGVHSWIKNLLLRSEILALVDVNDLENIVSDLANDGFNELMFLGIFGCNEMKCLLNSLERTRR
cccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccccccccEEcccHHHHHHHHHHccccEEEEccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEcccccccccccccccccccccHHHHcccccccEEEEEEccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccEEEEccccccccccccccccccccccEEEEEccccccccccccccccc
cccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEHHHHHHHHHHHHHHcccEEEEccccccccccHHHHccEEEEEEccccccccccccccccccEEEccccccccccccccHHccccEEEEcccccccccccHHHHHHHHHEEEcccccccccHHHHHHHHHHEEEEcccccHHHcHHHHHHHHHccEEcccccccccEccccHHHHHHHccEEEEccccccEEEEccccccccccHHHHHHHHcccEEEEEEcccccccccccHHcccEEEEEEcccccccccccHHHHHHHHEHEcccHHHHHHHHHHccccccHHHHHHHHHEEEHcccccccHcccccccccccccEEEEEcccHHHHHHHccHHHccc
QEDYNIPIEVLARYGWGLRCLQNVDSVEKARGRARSAVSTLIFSYLLIdggkegyvKMHDVVRYVAQQIASKNKFMIKAGvelkdwpsinkfedltgislmfndihevpdelecPKLQALLLQensllvipdrffqgmkdlkvldmggirgfslpsSLSFLINLRtlslhdcrrfgdlpligeLSLLEILdlsksdvseipisfgrlshlrlldltdcddleliprGVLSRLRKLEELYMSRsfhhwqfegeedsssnakfielgslSRLTSLhihipngkimssdmsfqnltSFSITIGDLAAGFISAAIEVFSRKFKKRCSRamglsqdmRISGVHSWIKNLLLRSEILALVDVNDLENIVSDLANDGFNELMFLGIFGCNEMKCLLNSLERTRR
QEDYNIPIEVlarygwglrCLQNVDSVEKARGRARSAVSTLIFSYLLIDGGKEGYVKMHDVVRYVAQQIASKNKFMIKAGVELKDWPSINKFEDLTGISLMFNDIHEVPDELECPKLQALLLQENSLLVIPDRFFQGMKDLKVLDMGGIRGFSLPSSLSFLINLRTLSLHDCRRFGDLPLIGELSLLEILDLSKSDVSEIPISFGRLSHLRLLDLtdcddleliprgVLSRLRKLEELYMSRSFHHWQFEGEEDSSSNAKFIELGSLSRLTSLHIHIPNGKIMSSDMSFQNLTSFSITIGDLAAGFISAAIEVFSRKFKKRCSRAmglsqdmriSGVHSWIKNLLLRSEILALVDVNDLENIVSDLANDGFNELMFLGIFGCNEMKCLLnslertrr
QEDYNIPIEVLARYGWGLRCLQNVDSVEKARGRARSAVSTLIFSYLLIDGGKEGYVKMHDVVRYVAQQIASKNKFMIKAGVELKDWPSINKFEDLTGISLMFNDIHEVPDELECPKlqalllqensllVIPDRFFQGMKDLKVLDMGGIRGFSLPSSLSFLINLRTLSLHDCRRFGDLPLIGELSLLEILDLSKSDVSEIPISFGRLSHlrlldltdcddlelIPRGVLSRLRKLEELYMSRSFHHWQFEGEEDSSSNAKFIELGSLSRLTSLHIHIPNGKIMSSDMSFQNLTSFSITIGDLAAGFISAAIEVFSRKFKKRCSRAMGLSQDMRISGVHSWIKNLLLRSEILALVDVNDLENIVSDLANDGFNELMFLGIFGCNEMKCLLNSLERTRR
***YNIPIEVLARYGWGLRCLQNVDSVEKARGRARSAVSTLIFSYLLIDGGKEGYVKMHDVVRYVAQQIASKNKFMIKAGVELKDWPSINKFEDLTGISLMFNDIHEVPDELECPKLQALLLQENSLLVIPDRFFQGMKDLKVLDMGGIRGFSLPSSLSFLINLRTLSLHDCRRFGDLPLIGELSLLEILDLSKSDVSEIPISFGRLSHLRLLDLTDCDDLELIPRGVLSRLRKLEELYMSRSFHHWQFE*********KFIELGSLSRLTSLHIHIPNGKIMSSDMSFQNLTSFSITIGDLAAGFISAAIEVFSRKFKKRCSRAMGLSQDMRISGVHSWIKNLLLRSEILALVDVNDLENIVSDLANDGFNELMFLGIFGCNEMKCLLN*******
QEDYNIPIEVLARYGWGLRCLQNVDSVEKARGRARSAVSTLIFSYLLIDGGKEGYVKMHDVVRYVAQQIASKNKFMIKAGVELKDWPSINKFEDLTGISLMFNDIHEVPDELECPKLQALLLQENSLLVIPDRFFQGMKDLKVLDMGGIRGFSLPSSLSFLINLRTLSLHDCRRFGDLPLIGELSLLEILDLSKSDVSEIPISFGRLSHLRLLDLTDCDDLELIPRGVLSRLRKLEELYMSRSFHHWQFEGEEDSSSNAKFIELGSLSRLTSLHIHIPNGKIMSSDMSFQNLTSFSITIGDLAAGFISAAIEVFSRKFKKRCSRAMGLSQDMRISGVHSWIKNLLLRSEILALVDVNDLENIVSDLANDGFNELMFLGIFGCNEMKCLLNS******
QEDYNIPIEVLARYGWGLRCLQNVDSV********SAVSTLIFSYLLIDGGKEGYVKMHDVVRYVAQQIASKNKFMIKAGVELKDWPSINKFEDLTGISLMFNDIHEVPDELECPKLQALLLQENSLLVIPDRFFQGMKDLKVLDMGGIRGFSLPSSLSFLINLRTLSLHDCRRFGDLPLIGELSLLEILDLSKSDVSEIPISFGRLSHLRLLDLTDCDDLELIPRGVLSRLRKLEELYMSRSFHHWQFEGEEDSSSNAKFIELGSLSRLTSLHIHIPNGKIMSSDMSFQNLTSFSITIGDLAAGFISAAIEVFSRKFKKRCSRAMGLSQDMRISGVHSWIKNLLLRSEILALVDVNDLENIVSDLANDGFNELMFLGIFGCNEMKCLLNSLERTRR
**DYNIPIEVLARYGWGLRCLQNVDSVEKARGRARSAVSTLIFSYLLIDGGKEGYVKMHDVVRYVAQQIASKNKFMIKAGVELKDWPSINKFEDLTGISLMFNDIHEVPDELECPKLQALLLQENSLLVIPDRFFQGMKDLKVLDMGGIRGFSLPSSLSFLINLRTLSLHDCRRFGDLPLIGELSLLEILDLSKSDVSEIPISFGRLSHLRLLDLTDCDDLELIPRGVLSRLRKLEELYMSRSFHHWQFEGEEDSSSNAKFIELGSLSRLTSLHIHIPNGKIMSSDMSFQNLTSFSITIGDLAAGFISAAIEVFSRKFKKRCSRAMGLSQDMRISGVHSWIKNLLLRSEILALVDVNDLENIVSDLANDGFNELMFLGIFGCNEMKCLLNSL*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QEDYNIPIEVLARYGWGLRCLQNVDSVEKARGRARSAVSTLIFSYLLIDGGKEGYVKMHDVVRYVAQQIASKNKFMIKAGVELKDWPSINKFEDLTGISLMFNDIHEVPDELECPKLQALLLQENSLLVIPDRFFQGMKDLKVLDMGGIRGFSLPSSLSFLINLRTLSLHDCRRFGDLPLIGELSLLEILDLSKSDVSEIPISFGRLSHLRLLDLTDCDDLELIPRGVLSRLRKLEELYMSRSFHHWQFEGEEDSSSNAKFIELGSLSRLTSLHIHIPNGKIMSSDMSFQNLTSFSITIGDLAAGFISAAIEVFSRKFKKRCSRAMGLSQDMRISGVHSWIKNLLLRSEILALVDVNDLENIVSDLANDGFNELMFLGIFGCNEMKCLLNSLERTRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query397 2.2.26 [Sep-21-2011]
Q9T048 985 Disease resistance protei yes no 0.750 0.302 0.339 1e-30
O81825 919 Probable disease resistan no no 0.727 0.314 0.325 1e-26
Q42484 909 Disease resistance protei no no 0.627 0.273 0.304 8e-21
Q940K0889 Probable disease resistan no no 0.430 0.192 0.338 3e-18
P60839884 Probable disease resistan no no 0.352 0.158 0.4 2e-17
O64973889 Disease resistance protei no no 0.536 0.239 0.296 6e-17
Q8RXS5888 Probable disease resistan no no 0.465 0.208 0.360 8e-16
Q9LVT4843 Probable disease resistan no no 0.523 0.246 0.288 1e-14
P60838894 Probable disease resistan no no 0.481 0.213 0.310 3e-14
O82484892 Putative disease resistan no no 0.428 0.190 0.333 7e-14
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function desciption
 Score =  134 bits (338), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 105/309 (33%), Positives = 151/309 (48%), Gaps = 11/309 (3%)

Query: 2   EDYNIPIEVLARYGWGLRCLQNVDSVEKARGRARSAVSTLIFSYLLIDGGKEGYVKMHDV 61
           EDY+I +  + RY      ++ + S E +     + V +L    LL DG +   VKMHDV
Sbjct: 406 EDYSIEVTEVVRYWMAEGFMEELGSQEDSMNEGITTVESLKDYCLLEDGDRRDTVKMHDV 465

Query: 62  VRYVAQQIASKNK----FMIKAGVELKDWPSINKFEDLTGISLMFNDIHEVPDELE--CP 115
           VR  A  I S ++     ++ +G  L+D         L  +SLM N +  +PD +E  C 
Sbjct: 466 VRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVEEFCV 525

Query: 116 KLQALLLQENSLLV-IPDRFFQGMKDLKVLDMGGIRGFSLPS-SLSFLINLRTLSLHDCR 173
           K   LLLQ N LL  +P  F Q    L++L++ G R  S PS SL  L +L +L L DC 
Sbjct: 526 KTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCF 585

Query: 174 RFGDLPLIGELSLLEILDLSKSDVSEIPISFGRLSHLRLLDLTDCDDLELIPRGVLSRLR 233
           +   LP +  L+ LE+LDL  + + E P     L   R LDL+    LE IP  V+SRL 
Sbjct: 586 KLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLS 645

Query: 234 KLEELYMSRSFHHWQFEGEEDSSSNAKFIELGSLSRLTSLHIHIPNGKIM--SSDMSFQN 291
            LE L M+ S + W  +G E     A   E+G L RL  L I + +   +    +   + 
Sbjct: 646 SLETLDMTSSHYRWSVQG-ETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKR 704

Query: 292 LTSFSITIG 300
           L  F + +G
Sbjct: 705 LKKFQLVVG 713




Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|P60839|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query397
225445915 1063 PREDICTED: disease resistance protein At 0.969 0.362 0.385 1e-60
297735460 1042 unnamed protein product [Vitis vinifera] 0.969 0.369 0.385 1e-60
147832986 975 hypothetical protein VITISV_010740 [Viti 0.969 0.394 0.385 1e-60
297735461 1063 unnamed protein product [Vitis vinifera] 0.969 0.362 0.395 3e-60
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.957 0.288 0.378 3e-60
359487924 1731 PREDICTED: uncharacterized protein LOC10 0.924 0.212 0.390 5e-60
298204946 723 unnamed protein product [Vitis vinifera] 0.924 0.507 0.390 8e-60
147865073 1694 hypothetical protein VITISV_021876 [Viti 0.939 0.220 0.383 1e-59
359494129 1144 PREDICTED: disease resistance protein At 0.969 0.336 0.406 2e-59
449515209 1612 PREDICTED: LOW QUALITY PROTEIN: disease 0.944 0.232 0.389 5e-59
>gi|225445915|ref|XP_002263288.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  240 bits (612), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 154/399 (38%), Positives = 227/399 (56%), Gaps = 14/399 (3%)

Query: 2   EDYNIPIEVLARYGWGLRCLQNVDSVEKARGRARSAVSTLIFSYLLIDGGKEGYVKMHDV 61
           ED +I IE L +YG G    Q  +++E+ARGRARS V  L    LL+D  +EG VKMHDV
Sbjct: 415 EDTDISIEDLVKYGLGQGLFQEANTIEEARGRARSVVKYLKACSLLLDSTEEGGVKMHDV 474

Query: 62  VRYVAQQIASK---NKFMIKAGVELKDWPSINKFEDLTGISLMFNDIHEVPDELECPKLQ 118
           VR +A  +AS    N FM+++G  LK+WP+ + +E  T ISLM N+I E+PD L CPKLQ
Sbjct: 475 VRDMAILLASSEEDNAFMVQSGSALKEWPTKDSYEAYTAISLMSNEIEELPDGLVCPKLQ 534

Query: 119 ALLLQENS-LLVIPDRFFQGMKDLKVLDMGGIRGFSLPSSLSFLINLRTLSLHDCRRFGD 177
            LLLQ N+ +  IPD FF     L+VLD+ G    SLP SL  L +LRTL L  C+   D
Sbjct: 535 TLLLQNNNDIQEIPDDFFGSFHSLRVLDLNGADIPSLPPSLGLLRSLRTLCLDCCQSITD 594

Query: 178 LPLIGELSLLEILDLSKSDVSEIPISFGRLSHLRLLDLTDCDDLELIPRGVLSRLRKLEE 237
           + ++G+L  LEIL L +S + ++P    +L++LR+LD T  ++++ IP  V+S L +LEE
Sbjct: 595 ISILGKLEKLEILSLRESYIEDLPEELAQLANLRMLDFTMSNNIKSIPPKVISSLSRLEE 654

Query: 238 LYMSRSFHHWQFEGEEDSS-SNAKFIELGSLSRLTSLHIHIPNGKIMSSDMSFQ-NLTSF 295
           +YM  SF  W    E  SS +NA F EL  L RL  L + I + + M   + F  N  +F
Sbjct: 655 MYMQGSFADWGLLLEGTSSGANAGFDELTCLHRLNILKVDISDAECMPKTVRFDPNWVNF 714

Query: 296 SITIG-DLAAGFISAAIEVFSRKFKKRCSRAMGLSQDMRISGVHSWIKNLLL-RSEILAL 353
            I I   L   F++  +   +       +R+  L  D+ I+ +  W   +   R+E L  
Sbjct: 715 DICINRKLFNRFMNVHLSRVT------AARSRSLILDVTINTLPDWFNKVATERTEKLYY 768

Query: 354 VDVNDLENIVSDLANDGFNELMFLGIFGCNEMKCLLNSL 392
           +    L+NI+ +      N L  L +  C+++  L++++
Sbjct: 769 IKCRGLDNILMEYDQGSLNGLKILLVQSCHQIVHLMDAV 807




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297735460|emb|CBI17900.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147832986|emb|CAN77367.1| hypothetical protein VITISV_010740 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297735461|emb|CBI17901.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359487924|ref|XP_003633676.1| PREDICTED: uncharacterized protein LOC100246921 [Vitis vinifera] Back     alignment and taxonomy information
>gi|298204946|emb|CBI34253.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359494129|ref|XP_002278428.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449515209|ref|XP_004164642.1| PREDICTED: LOW QUALITY PROTEIN: disease resistance protein At4g27190-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query397
TAIR|locus:2136447 985 AT4G27190 [Arabidopsis thalian 0.909 0.366 0.289 3.9e-27
TAIR|locus:2131689 919 AT4G27220 [Arabidopsis thalian 0.725 0.313 0.301 8.9e-25
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.476 0.213 0.339 8.2e-14
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.483 0.213 0.330 1.5e-12
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.488 0.218 0.326 1.5e-11
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.493 0.220 0.299 2.5e-11
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.476 0.248 0.315 1.6e-09
TAIR|locus:2171579843 AT5G47250 [Arabidopsis thalian 0.488 0.230 0.285 1.8e-09
TAIR|locus:2008510 967 AT1G61190 "AT1G61190" [Arabido 0.415 0.170 0.308 4.7e-09
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.473 0.210 0.311 4.8e-09
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 300 (110.7 bits), Expect = 3.9e-27, Sum P(2) = 3.9e-27
 Identities = 113/391 (28%), Positives = 173/391 (44%)

Query:     2 EDYNIPIEVLARYGWGLRCLQNVDSVEKARGRARSAVSTLIFSYLLIDGGKEGYVKMHDV 61
             EDY+I +  + RY      ++ + S E +     + V +L    LL DG +   VKMHDV
Sbjct:   406 EDYSIEVTEVVRYWMAEGFMEELGSQEDSMNEGITTVESLKDYCLLEDGDRRDTVKMHDV 465

Query:    62 VRYVAQQIASKNK----FMIKAGVELKDWPSINKFEDLTGISLMFNDIHEVPDELE--CP 115
             VR  A  I S ++     ++ +G  L+D         L  +SLM N +  +PD +E  C 
Sbjct:   466 VRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVEEFCV 525

Query:   116 KXXXXXXXXXXXXV-IPDRFFQGMKDLKVLDMGGIRGFSLPS-SLSFLINLRTLSLHDCR 173
             K              +P  F Q    L++L++ G R  S PS SL  L +L +L L DC 
Sbjct:   526 KTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCF 585

Query:   174 RFGDLPLIGELSLLEILDLSKSDVSEIPISFGRLSHXXXXXXXXXXXXXXIPRGVLSRLR 233
             +   LP +  L+ LE+LDL  + + E P     L                IP  V+SRL 
Sbjct:   586 KLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLS 645

Query:   234 KLEELYMSRSFHHWQFEGEEDSSSNAKFIELGSLSRLTSLHIHIPNGKIMSSDMS--FQN 291
              LE L M+ S + W  +GE      A   E+G L RL  L I + +   + +  +   + 
Sbjct:   646 SLETLDMTSSHYRWSVQGETQKGQ-ATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKR 704

Query:   292 LTSFSITIGDLAAGFISAAIEVFSRKFKKRCSRAMGLSQDMRISGVH-SWIKNLLLRSEI 350
             L  F + +G   + +I     + +R  K+R +    +S  + +S V   W   LL  +  
Sbjct:   705 LKKFQLVVG---SRYI-----LRTRHDKRRLT----ISH-LNVSQVSIGW---LLAYTTS 748

Query:   351 LALVDVNDLENIVSDLAND--GFNELMFLGI 379
             LAL     +E ++  L +D  GF  L  L I
Sbjct:   749 LALNHCQGIEAMMKKLVSDNKGFKNLKSLTI 779


GO:0000166 "nucleotide binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-05
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.004
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
 Score = 50.6 bits (121), Expect = 1e-06
 Identities = 29/76 (38%), Positives = 50/76 (65%), Gaps = 3/76 (3%)

Query: 144 LDMGGIRGFSLPSSLSFLINLRTLSLHDCRRFGDLPL-IGELSLLEILDLSKSDVS-EIP 201
           LD  G+RGF +P+ +S L +L++++L      G++P  +G ++ LE+LDLS +  +  IP
Sbjct: 425 LDNQGLRGF-IPNDISKLRHLQSINLSGNSIRGNIPPSLGSITSLEVLDLSYNSFNGSIP 483

Query: 202 ISFGRLSHLRLLDLTD 217
            S G+L+ LR+L+L  
Sbjct: 484 ESLGQLTSLRILNLNG 499


Length = 623

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 397
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.9
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.85
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.85
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.81
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.79
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.78
KOG0617264 consensus Ras suppressor protein (contains leucine 99.73
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.71
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.69
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.66
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.64
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.57
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.53
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.44
KOG4237498 consensus Extracellular matrix protein slit, conta 99.43
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.4
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.39
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.39
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.27
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.24
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.18
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.05
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.04
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.03
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.0
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.91
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.9
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.74
KOG4341483 consensus F-box protein containing LRR [General fu 98.66
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.64
PLN03150623 hypothetical protein; Provisional 98.62
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.6
PLN03150623 hypothetical protein; Provisional 98.58
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.53
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.47
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.41
KOG4341483 consensus F-box protein containing LRR [General fu 98.41
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.38
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.37
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.25
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.09
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.04
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.04
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.98
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.97
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.97
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.9
PRK15386 426 type III secretion protein GogB; Provisional 97.89
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.88
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.83
PRK15386426 type III secretion protein GogB; Provisional 97.79
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.75
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.74
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.59
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.11
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.07
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.06
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.02
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.93
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.89
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.56
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.3
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.89
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.28
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.93
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.09
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.39
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.34
smart0037026 LRR Leucine-rich repeats, outliers. 90.06
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.06
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.36
smart0037026 LRR Leucine-rich repeats, outliers. 88.36
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.16
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 86.88
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.57
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=2e-34  Score=286.67  Aligned_cols=242  Identities=34%  Similarity=0.444  Sum_probs=204.0

Q ss_pred             CCCccccHHHHHHHHHhhccccccccHHHHHHHHHHHHHHHhhcceeeecC---CcCeEEechHHHHHHHHHhc-----c
Q 047708            1 QEDYNIPIEVLARYGWGLRCLQNVDSVEKARGRARSAVSTLIFSYLLIDGG---KEGYVKMHDVVRYVAQQIAS-----K   72 (397)
Q Consensus         1 P~~~~~~~~~Li~~Wia~g~i~~~~~~~~~~~~~~~~~~~L~~~~l~~~~~---~~~~~~~hd~~~~~~~~~~~-----~   72 (397)
                      ||||+|++++||.+||||||+++....+.+++.|.+|+.+|+++++++..+   ....|+|||++||+|.++++     +
T Consensus       423 PED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~  502 (889)
T KOG4658|consen  423 PEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQE  502 (889)
T ss_pred             CcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccc
Confidence            999999999999999999999886666779999999999999999999885   44689999999999999999     5


Q ss_pred             cceEEecCCccCCCCCccccccCceEEccCCCcccCCCcCCCCCccEEEccCCC--CcccChhhhcCCCcccEEEcCCCC
Q 047708           73 NKFMIKAGVELKDWPSINKFEDLTGISLMFNDIHEVPDELECPKLQALLLQENS--LLVIPDRFFQGMKDLKVLDMGGIR  150 (397)
Q Consensus        73 ~~~~~~~~~~~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~L~~L~l~~~~--~~~~~~~~~~~l~~L~~L~l~~~~  150 (397)
                      +...+.++......+....+...|++++.++.+..++....+++|++|.+.+|.  +..++..+|..++.|++||+++|.
T Consensus       503 e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~  582 (889)
T KOG4658|consen  503 ENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNS  582 (889)
T ss_pred             cceEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCC
Confidence            556666555556678888889999999999999999888888899999999997  788888899999999999999876


Q ss_pred             C-CCCChhhcCcccCcEEEccCccCcCCCccccCCCCCCEEEccCCCC-CccchhhhCCCCCCeeecCCCC-CCCCCchh
Q 047708          151 G-FSLPSSLSFLINLRTLSLHDCRRFGDLPLIGELSLLEILDLSKSDV-SEIPISFGRLSHLRLLDLTDCD-DLELIPRG  227 (397)
Q Consensus       151 ~-~~l~~~~~~l~~L~~L~l~~~~~~~~~~~~~~l~~L~~L~l~~~~~-~~lp~~i~~l~~L~~L~l~~~~-~~~~~~~~  227 (397)
                      - ..+|..++.+.+||||+++++.+...|..++++.+|.+|++..+.. ..+|.....+.+|++|.+.... ..+..-.+
T Consensus       583 ~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~~~~~~~~l~  662 (889)
T KOG4658|consen  583 SLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSALSNDKLLLK  662 (889)
T ss_pred             ccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheeccccccccccccchhhhcccccEEEeeccccccchhhHH
Confidence            5 8999999999999999999999987888999999999999998854 4566777779999999998743 11222222


Q ss_pred             hhcCCCCCCEEEeec
Q 047708          228 VLSRLRKLEELYMSR  242 (397)
Q Consensus       228 ~~~~l~~L~~L~l~~  242 (397)
                      .+.++.+|+.+....
T Consensus       663 el~~Le~L~~ls~~~  677 (889)
T KOG4658|consen  663 ELENLEHLENLSITI  677 (889)
T ss_pred             hhhcccchhhheeec
Confidence            245566666666543



>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 88.8 bits (221), Expect = 5e-20
 Identities = 40/205 (19%), Positives = 70/205 (34%), Gaps = 30/205 (14%)

Query: 86  WPSINKFEDLTGISLMFNDIHEVPDEL-ECPKLQALLLQENSLLVIPDRFFQGMKDLKVL 144
                +   L  +++    + E+PD + +   L+ L L  N L  +P      +  L+ L
Sbjct: 97  PDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRALPASIAS-LNRLREL 155

Query: 145 DMGG----------IRGFSLPSSLSFLINLRTLSLHDCRRFGDLPL-IGELSLLEILDLS 193
            +            +           L+NL++L L        LP  I  L  L+ L + 
Sbjct: 156 SIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTG-IRSLPASIANLQNLKSLKIR 214

Query: 194 KSDVSEIPISFGRLSHLRLLDLTDCDDLELIPRGVLSRLRKLEELYMSRSFHHWQFEGEE 253
            S +S +  +   L  L  LDL  C  L   P         L+ L +             
Sbjct: 215 NSPLSALGPAIHHLPKLEELDLRGCTALRNYPPI-FGGRAPLKRLILK------------ 261

Query: 254 DSSSNAKFI--ELGSLSRLTSLHIH 276
              SN   +  ++  L++L  L + 
Sbjct: 262 -DCSNLLTLPLDIHRLTQLEKLDLR 285


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query397
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.92
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.92
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.91
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.91
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.91
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.9
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.9
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.9
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.89
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.89
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.89
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.89
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.88
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.88
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.88
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.86
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.86
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.86
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.86
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.85
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.85
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.84
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.83
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.83
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.83
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.82
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.82
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.81
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.81
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.8
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.79
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.79
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.75
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.74
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.74
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.74
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.73
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.73
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.73
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.73
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.71
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.69
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.68
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.68
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.67
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.66
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.65
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.63
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.63
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.62
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.61
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.61
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.6
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.5
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.48
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.48
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.47
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.43
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.42
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.42
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.37
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.34
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.25
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.25
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.25
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.23
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.21
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.2
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.08
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.96
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.89
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.84
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.8
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.61
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.6
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.44
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 98.41
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.32
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.27
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.15
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.1
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.06
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.03
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.95
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.82
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.82
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.77
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 96.96
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 96.84
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.76
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.15
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.83
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 94.97
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.95
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.9
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=99.94  E-value=4.4e-25  Score=202.80  Aligned_cols=268  Identities=20%  Similarity=0.227  Sum_probs=177.4

Q ss_pred             CCccCCCCCccccccCceEEccCCCcccCCCcCCCCCccEEEccCCCCcccChhhhcCCCcccEEEcCCCCCCCCChhhc
Q 047708           80 GVELKDWPSINKFEDLTGISLMFNDIHEVPDELECPKLQALLLQENSLLVIPDRFFQGMKDLKVLDMGGIRGFSLPSSLS  159 (397)
Q Consensus        80 ~~~~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~l~~~~~  159 (397)
                      +..+..++....++++++|++++|.+..++....+++|++|++++|.+..++.  +..+++|++|++++|.+..++. +.
T Consensus        53 ~~~i~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~l~~L~~L~L~~n~i~~~~~--~~~l~~L~~L~l~~n~i~~~~~-~~  129 (347)
T 4fmz_A           53 GEKVASIQGIEYLTNLEYLNLNGNQITDISPLSNLVKLTNLYIGTNKITDISA--LQNLTNLRELYLNEDNISDISP-LA  129 (347)
T ss_dssp             SSCCCCCTTGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGG--GTTCTTCSEEECTTSCCCCCGG-GT
T ss_pred             CCccccchhhhhcCCccEEEccCCccccchhhhcCCcCCEEEccCCcccCchH--HcCCCcCCEEECcCCcccCchh-hc
Confidence            45556667777888999999999988887775588899999999988777653  6889999999999988877766 78


Q ss_pred             CcccCcEEEccCccCcCCCccccCCCCCCEEEccCCCCCccchhhhCCCCCCeeecCCCCCCCCCchhhhcCCCCCCEEE
Q 047708          160 FLINLRTLSLHDCRRFGDLPLIGELSLLEILDLSKSDVSEIPISFGRLSHLRLLDLTDCDDLELIPRGVLSRLRKLEELY  239 (397)
Q Consensus       160 ~l~~L~~L~l~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~lp~~i~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~  239 (397)
                      .+++|++|++++|.....++.+..+++|++|++++|.+..++. +..+++|++|++++ +.+..++.  +..+++|+.|+
T Consensus       130 ~l~~L~~L~l~~n~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~-~~~l~~L~~L~l~~-n~l~~~~~--~~~l~~L~~L~  205 (347)
T 4fmz_A          130 NLTKMYSLNLGANHNLSDLSPLSNMTGLNYLTVTESKVKDVTP-IANLTDLYSLSLNY-NQIEDISP--LASLTSLHYFT  205 (347)
T ss_dssp             TCTTCCEEECTTCTTCCCCGGGTTCTTCCEEECCSSCCCCCGG-GGGCTTCSEEECTT-SCCCCCGG--GGGCTTCCEEE
T ss_pred             cCCceeEEECCCCCCcccccchhhCCCCcEEEecCCCcCCchh-hccCCCCCEEEccC-Cccccccc--ccCCCccceee
Confidence            8888999999888776777778888888888888888877665 77888888888888 45566665  66777777777


Q ss_pred             eecccccccccCCCccCccccccccCCCCCCCEEEEeccCCCCCCCccc-CCCccEEEEEecCcccchhhhHHHHhhhhc
Q 047708          240 MSRSFHHWQFEGEEDSSSNAKFIELGSLSRLTSLHIHIPNGKIMSSDMS-FQNLTSFSITIGDLAAGFISAAIEVFSRKF  318 (397)
Q Consensus       240 l~~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~-~~~L~~L~l~~~~~~~~~~~~~~~~l~~~~  318 (397)
                      +++|.+.+.             ..+..+++|++|++++|....++. +. +++|+.|+++.|.....      ..+..  
T Consensus       206 l~~n~l~~~-------------~~~~~~~~L~~L~l~~n~l~~~~~-~~~l~~L~~L~l~~n~l~~~------~~~~~--  263 (347)
T 4fmz_A          206 AYVNQITDI-------------TPVANMTRLNSLKIGNNKITDLSP-LANLSQLTWLEIGTNQISDI------NAVKD--  263 (347)
T ss_dssp             CCSSCCCCC-------------GGGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSSCCCCC------GGGTT--
T ss_pred             cccCCCCCC-------------chhhcCCcCCEEEccCCccCCCcc-hhcCCCCCEEECCCCccCCC------hhHhc--
Confidence            777766541             114555666666666666555554 33 56666666655543211      12222  


Q ss_pred             ccccccccceec-ccccccchHHHHHHHhhccceecccCCChhhhhhccccCCCCCccEEEEeccC
Q 047708          319 KKRCSRAMGLSQ-DMRISGVHSWIKNLLLRSEILALVDVNDLENIVSDLANDGFNELMFLGIFGCN  383 (397)
Q Consensus       319 ~~~~~~L~~L~l-~~~~~~lp~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~~~~L~~L~i~~c~  383 (397)
                         +++|+.|++ ++.++.+| .+..+ ++|++|++++|. +...... ..+.+++|++|++++|+
T Consensus       264 ---l~~L~~L~l~~n~l~~~~-~~~~l-~~L~~L~L~~n~-l~~~~~~-~l~~l~~L~~L~L~~n~  322 (347)
T 4fmz_A          264 ---LTKLKMLNVGSNQISDIS-VLNNL-SQLNSLFLNNNQ-LGNEDME-VIGGLTNLTTLFLSQNH  322 (347)
T ss_dssp             ---CTTCCEEECCSSCCCCCG-GGGGC-TTCSEEECCSSC-CCGGGHH-HHHTCTTCSEEECCSSS
T ss_pred             ---CCCcCEEEccCCccCCCh-hhcCC-CCCCEEECcCCc-CCCcChh-HhhccccCCEEEccCCc
Confidence               455555555 44444443 22222 455555555542 2222111 11245555555555553



>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 397
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-07
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 63.1 bits (152), Expect = 1e-11
 Identities = 32/181 (17%), Positives = 67/181 (37%), Gaps = 28/181 (15%)

Query: 82  ELKDWPSINKFEDLTGISLMFNDIHEVPDELECPKLQALLLQENSLLVIPDRFFQGMKDL 141
           ++ D   +    +L  +SL  N + ++        L  L L  N +  +      G+  L
Sbjct: 208 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAP--LSGLTKL 265

Query: 142 KVLDMGGIRGFSLPSSLSF---------------------LINLRTLSLHDCRRFGDLPL 180
             L +G  +  ++                           L NL  L+L+      D+  
Sbjct: 266 TELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNN-ISDISP 324

Query: 181 IGELSLLEILDLSKSDVSEIPISFGRLSHLRLLDLTDCDDLELIPRGVLSRLRKLEELYM 240
           +  L+ L+ L  + + VS++  S   L+++  L        +L P   L+ L ++ +L +
Sbjct: 325 VSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLTP---LANLTRITQLGL 380

Query: 241 S 241
           +
Sbjct: 381 N 381


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query397
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.86
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.81
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.79
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.79
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.79
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.77
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.76
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.53
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.5
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.46
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.46
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.45
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.39
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.03
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.02
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.99
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.99
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.96
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.82
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.78
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.64
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.15
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.04
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.58
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.81
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.86  E-value=2.4e-20  Score=171.16  Aligned_cols=266  Identities=20%  Similarity=0.258  Sum_probs=140.6

Q ss_pred             CCccCCCCCccccccCceEEccCCCcccCCCcCCCCCccEEEccCCCCcccChhhhcCCCcccEEEcCCCCCCCCCh---
Q 047708           80 GVELKDWPSINKFEDLTGISLMFNDIHEVPDELECPKLQALLLQENSLLVIPDRFFQGMKDLKVLDMGGIRGFSLPS---  156 (397)
Q Consensus        80 ~~~~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~l~~---  156 (397)
                      +..+..+..+..+++|++|++++|.++++++..++++|+.|++++|.+..+++  +.++++|+.|+++++.+..++.   
T Consensus        53 ~~~I~~l~gl~~L~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i~~--l~~l~~L~~L~~~~~~~~~~~~~~~  130 (384)
T d2omza2          53 RLGIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITP--LANLTNLTGLTLFNNQITDIDPLKN  130 (384)
T ss_dssp             SSCCCCCTTGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGG--GTTCTTCCEEECCSSCCCCCGGGTT
T ss_pred             CCCCCCccccccCCCCCEEeCcCCcCCCCccccCCcccccccccccccccccc--ccccccccccccccccccccccccc
Confidence            44455556666778888888888888777765577888888888888766654  5778888888877665432211   


Q ss_pred             -------------------------------------------------------------hhcCcccCcEEEccCccCc
Q 047708          157 -------------------------------------------------------------SLSFLINLRTLSLHDCRRF  175 (397)
Q Consensus       157 -------------------------------------------------------------~~~~l~~L~~L~l~~~~~~  175 (397)
                                                                                   ....+++++.++++++.+.
T Consensus       131 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~l~~n~i~  210 (384)
T d2omza2         131 LTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQIS  210 (384)
T ss_dssp             CTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCGGGGGCTTCSEEECCSSCCC
T ss_pred             cccccccccccccccccccccccccccccccccccchhhhhccccccccccccccccccccccccccccceeeccCCccC
Confidence                                                                         1222233444444444332


Q ss_pred             CCCccccCCCCCCEEEccCCCCCccchhhhCCCCCCeeecCCCCCCCCCchhhhcCCCCCCEEEeecccccccccCCCcc
Q 047708          176 GDLPLIGELSLLEILDLSKSDVSEIPISFGRLSHLRLLDLTDCDDLELIPRGVLSRLRKLEELYMSRSFHHWQFEGEEDS  255 (397)
Q Consensus       176 ~~~~~~~~l~~L~~L~l~~~~~~~lp~~i~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~  255 (397)
                      ... ....+++|++|++++|.++.+| .+..+++|+.|++++ +.++.++.  ++.+++|++|+++++.+.+        
T Consensus       211 ~~~-~~~~~~~L~~L~l~~n~l~~~~-~l~~l~~L~~L~l~~-n~l~~~~~--~~~~~~L~~L~l~~~~l~~--------  277 (384)
T d2omza2         211 DIT-PLGILTNLDELSLNGNQLKDIG-TLASLTNLTDLDLAN-NQISNLAP--LSGLTKLTELKLGANQISN--------  277 (384)
T ss_dssp             CCG-GGGGCTTCCEEECCSSCCCCCG-GGGGCTTCSEEECCS-SCCCCCGG--GTTCTTCSEEECCSSCCCC--------
T ss_pred             CCC-cccccCCCCEEECCCCCCCCcc-hhhcccccchhcccc-CccCCCCc--ccccccCCEeeccCcccCC--------
Confidence            221 2233444444444444444433 344444455555544 22333332  4444455555554444432        


Q ss_pred             CccccccccCCCCCCCEEEEeccCCCCCCCcccCCCccEEEEEecCcccchhhhHHHHhhhhcccccccccceec-cccc
Q 047708          256 SSNAKFIELGSLSRLTSLHIHIPNGKIMSSDMSFQNLTSFSITIGDLAAGFISAAIEVFSRKFKKRCSRAMGLSQ-DMRI  334 (397)
Q Consensus       256 ~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~~~~~~~~~L~~L~l-~~~~  334 (397)
                           ...+..++.++.+.+..+....++....+++++.|+++.+....-      ..+..     +++|++|++ ++.+
T Consensus       278 -----~~~~~~~~~l~~l~~~~n~l~~~~~~~~~~~l~~L~ls~n~l~~l------~~l~~-----l~~L~~L~L~~n~l  341 (384)
T d2omza2         278 -----ISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDI------SPVSS-----LTKLQRLFFANNKV  341 (384)
T ss_dssp             -----CGGGTTCTTCSEEECCSSCCSCCGGGGGCTTCSEEECCSSCCSCC------GGGGG-----CTTCCEEECCSSCC
T ss_pred             -----CCccccccccccccccccccccccccchhcccCeEECCCCCCCCC------ccccc-----CCCCCEEECCCCCC
Confidence                 122344455555555555544433222256666666655543211      11222     556666666 5555


Q ss_pred             ccchHHHHHHHhhccceecccCCChhhhhhccccCCCCCccEEEEecc
Q 047708          335 SGVHSWIKNLLLRSEILALVDVNDLENIVSDLANDGFNELMFLGIFGC  382 (397)
Q Consensus       335 ~~lp~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~~~~L~~L~i~~c  382 (397)
                      +.+| .+..+ ++|++|++++ +.+++++   ...++++|+.|+|+++
T Consensus       342 ~~l~-~l~~l-~~L~~L~l~~-N~l~~l~---~l~~l~~L~~L~L~~N  383 (384)
T d2omza2         342 SDVS-SLANL-TNINWLSAGH-NQISDLT---PLANLTRITQLGLNDQ  383 (384)
T ss_dssp             CCCG-GGGGC-TTCCEEECCS-SCCCBCG---GGTTCTTCSEEECCCE
T ss_pred             CCCh-hHcCC-CCCCEEECCC-CcCCCCh---hhccCCCCCEeeCCCC
Confidence            5555 34444 4666666665 3555554   2346666666666553



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure