Citrus Sinensis ID: 047797


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------
MSCKLFLLLEYLALSSVILFQLEPRLGASNNITRCIDEEREALLTFKQSLVDEYGVLSSWGSEDGKRDCCKWRGVRCSNTTGHVKVLNLQTSDHEFARRKFLKGKISPALLKLRGLRHLDLSKNDFGGSPVPEFIGSLSKLRYLNLSCGTPSSKIPHPFRDLSGFEYFNVENSNLFSVGSLERLSHLSSLRHLDLSCINLTKSSDWFQVVSQLHSLKTLVLRSCYLPPINPSFIWLFNLSTSIETLDLSDNHLPSSSVYPWLFNLSRNILHLDLGFNHLQGSIPEAFQHMVSLRLLSLASNELEGGIPKFFGNMCSLNQLYLPRNKLSGQLSELIQNLSSGCTVNSLEGLCLYANDITGPIPDLGRFLSLKVLKLGENHLNGTINKSLSHLFKLETLSLDGNSFTGVISETFFSNMSNLQMLFLADNSLTLKLSHDWVPAFQLKWLSLASCKMGPHFPNWLQTQNQLISLDISNIGISDTIPDWFWDLSIELFFLNLSNNHISGKLPDLSVLKSDDIVIDISSNNFDGPIPPLPSNSTFLNLSKNKFSGLPDCWLNFNSLSILNLANNRFSGKIPDSMGFLHNIQTLSLRNNRLNGELPSSLKNCSKLRVLDLRKNALFGEVPTCVGGSLQNLIILRLKSNNFHGNIPFQLCHLAFIQVLDLSLNNISGKIPKCFSNFSMMIQEKSSNPIIGLANEILVVPGYIYYFRYLDNVLLTWKGSEHEYKSTLGFVKYLDLSSNKLCEAIPEEITDLVGLTALNLSRNNLTGLIPPKIGQLKSLDFLDLSRNHFSGNIPSSLSLLSGLSVLDLSYNSLSGKIPLGTQLQSFNASVYAGNLELCGLPLPNKCADEESTPSPGRDDDANTVEDEDNQFITLGFYVSLTLGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLYAAAAMNKSNL
cccEEHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccEEEccccccEEEEEcccccccccccccccEEEcccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEccccccccccccHHHHcccccccEEEccccccccccccHHHHccccccccEEEcccccccccccccHHHcccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHHccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEEccccccccccccEEEccccEEEEEEcccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEccccccccccccccccccEEEccccccccccccccccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHHcccccEEEcccccccccccHHHHHccccccEEEccccEEEEEccccccccccccEEEcccccccccccHHHHHHHHcccccccccccccccccccccccEEEEEEEEEEEEEEcccccEEcccccccEEEEccccccccccHHHHHccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccEEEEEEEEEEccc
cHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEcccccEEEEEEcccccccccccccccccccHHHHccHcccEEEccccccccccccHHHcccccccEEEcccccccccccccHccccccEEEEcccccccccccHHHHHccccccEEEccccccccccccHHHHccccccEEEEcccccccccccccccccccccccEEEEcccccccccccccHHHHccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHcccHccccccccEEEccccccccccccccccccccEEEcccccccccccHHHHcHHcccEEEcccccccccccHHHHHHHHcccEEEEccccEEEEccccccccccEEEEEEccccccccccHHHHccccccEEEcccccccccccHHHHHHHHcccEEEccccccccccccccccccccEEEEcccccccccccccccccEEEEccccccccccHHHcccccEEEEEcccccccccccHcHcccccccEEEEccccccccccHHHHccccEEEEEcccccccccccHHHHHcccccEEEEEccccccccccHHHHccccccEEEcccccccccccHHHHHHHHHHHHHccccccccccccccccccccccEHHHHHEEEcccccHHHHccccEEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEHccc
MSCKLFLLLEYLALSSVILFqleprlgasnnitRCIDEEREALLTFKQSLVDEYGvlsswgsedgkrdcckwrgvrcsnttghVKVLNLQTSDHEFARRKFlkgkispallklrglrhldlskndfggspvpefIGSLSKLRYLNlscgtpsskiphpfrdlsgfeyfnvensnlfsvGSLErlshlsslrHLDLScinltkssdwFQVVSQLHSLKTLVLrscylppinpsfIWLFNLSTSietldlsdnhlpsssvypwlfNLSRNILHLDlgfnhlqgsiPEAFQHMVSLRLLSLAsneleggipkffgnmcslnqlylprnklsGQLSELIQNLssgctvnsleglclyanditgpipdlgrfLSLKVLKLGENHLNGTINKSLSHLFKletlsldgnsftgVISETFFSNMSNLQMLFLADNSltlklshdwvpaFQLKWLSLAsckmgphfpnwlQTQNQLISLdisnigisdtipdwFWDLSIELFFLNLSnnhisgklpdlsvlksddividissnnfdgpipplpsnstflnlsknkfsglpdcwlnfnSLSILNLAnnrfsgkipdsmgflHNIQTLSlrnnrlngelpsslkncsklrvldlrknalfgevptcvggslQNLIILRLksnnfhgnipfQLCHLAFIQVLDLSlnnisgkipkcfsnfsmmiqekssnpiiglaneilvVPGYIYYFRYLDNVLLTWKGSEHEYKSTLGFVKYLDLSSNKLCEAIPEEITDLVGltalnlsrnnltglippkigqlksldfldlsrnhfsgnipsslsllsglsvldlsynslsgkiplgtqlqsfnasvyagnlelcglplpnkcadeestpspgrdddantvedednqfITLGFYVSLTLGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLYAAAAMNKSNL
MSCKLFLLLEYLALSSVILFQLEPRLGASNNITRCIDEEREALLTFKQSLVDEYGvlsswgsedgkrdCCKWRgvrcsnttghvkvlnlqtsdhEFARRKflkgkispallKLRGLRHLDlskndfggspVPEFIGSLSKLRYLNLSCGTPSSKIPHPFRDLSGFEYFNVENSNLFSVGSLERLSHLSSLRHLDLSCINLTKSSDWFQVVSQLHSLKTLVLRSCYLPPINPSFIWLFNLSTSIETLDLSDNHLPSSSVYPWLFNLSRNILHLDLGFNHLQGSIPEAFQHMVSLRLLSLASNELEGGIPKFFGNMCSLNQLYLPRNKLSGQLSELIQNLSSGCTVNSLEGLCLYANDITGPIPDLGRFLSLKVLKLGENHLNGTINKSLSHLFKLETLSLDGNSFTGVISETFFSNMSNLQMLFLADNSLTLKLSHDWVPAFQLKWLSLASCKMGPHFPNWLQTQNQLISLDISNIGISDTIPDWFWDLSIELFFLNLSNNHISGKLPDLSVLKSDDIVIDISSNNFDGPIPPLPSNSTFLNLSKNKFSGLPDCWLNFNSLSILNLANNRFSGKIPDSMGFLHNIQTLSLRNNRLNGELPSSLKNCSKLRVLDLRKNALFgevptcvggSLQNLIILRLKSNNFHGNIPFQLCHLAFIQVLDLSLNNISGKIPKCFSNFSMMIQEKSSNPIIGLANEILVVPGYIYYFRYLDNVLLTWKGSEHEYKSTLGFVKYLDLSSNKLCEAIPEEITDLVGLTALNLSRNNLTGLIPPKIGQLKSLDFLDLSRNHFSGNIPSSLSLLSGLSVLDLSYNSLSGKIPLGTQLQSFNASVYAGNLELCGLPLPNKCADEESTpspgrdddantvEDEDNQFITLGFYVSLTLGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLYAAAAMNKSNL
MSCKlfllleylalssvilFQLEPRLGASNNITRCIDEEREALLTFKQSLVDEYGVLSSWGSEDGKRDCCKWRGVRCSNTTGHVKVLNLQTSDHEFARRKFLKGKISPAllklrglrhldlSKNDFGGSPVPEFIGSLSKLRYLNLSCGTPSSKIPHPFRDLSGFEYFNVENSNLFSVGslerlshlsslrhldlsCINLTKSSDWFQVVSQLHSLKTLVLRSCYLPPINPSFIWLFNLSTSIETLDLSDNHLPSSSVYPWLFNLSRNILHLDLGFNHLQGSIPEAFQHMVSLRLLSLASNELEGGIPKFFGNMCSLNQLYLPRNKLSGQLSELIQNLSSGCTVNSLEGLCLYANDITGPIPDLGRFLSLKVLKLGENHLNGTINKSLSHLFKLETLSLDGNSFTGVISETFFSNMSNLQMLFLADNSLTLKLSHDWVPAFQLKWLSLASCKMGPHFPNWLQTQNQLISLDISNIGISDTIPDWFWDLSIELFFLNLSNNHISGKLPDLSVLKSDDIVIDISSNNFDGPIPPLPSNSTFLNLSKNKFSGLPDCWLNFNSLSILNLANNRFSGKIPDSMGFLHNIQTLSLRNNRLNGELPSSLKNCSKLRVLDLRKNALFGEVPTCVGGSLQNLIILRLKSNNFHGNIPFQLCHLAFIQVLDLSLNNISGKIPKCFSNFSMMIQEKSSNPIIGLANEILVVPGYIYYFRYLDNVLLTWKGSEHEYKSTLGFVKYLDLSSNKLCEAIPEEITDLVGLTALNLSRNNLTGLIPPKIGQLKSLDFLDLSRNHFSGNIPsslsllsglsvldlsYNSLSGKIPLGTQLQSFNASVYAGNLELCGLPLPNKCADEESTPSPGRDDDANTVEDEDNQFITLGFYVSLTLGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLYAAAAMNKSNL
**CKLFLLLEYLALSSVILFQLEPRLGASNNITRCIDEEREALLTFKQSLVDEYGVLSSWGSEDGKRDCCKWRGVRCSNTTGHVKVLNLQTSDHEFARRKFLKGKISPALLKLRGLRHLDLSKNDFGGSPVPEFIGSLSKLRYLNLSCGTPSSKIPHPFRDLSGFEYFNVENSNLFSVGSLERLSHLSSLRHLDLSCINLTKSSDWFQVVSQLHSLKTLVLRSCYLPPINPSFIWLFNLSTSIETLDLSDNHLPSSSVYPWLFNLSRNILHLDLGFNHLQGSIPEAFQHMVSLRLLSLASNELEGGIPKFFGNMCSLNQLYLPRNKLSGQLSELIQNLSSGCTVNSLEGLCLYANDITGPIPDLGRFLSLKVLKLGENHLNGTINKSLSHLFKLETLSLDGNSFTGVISETFFSNMSNLQMLFLADNSLTLKLSHDWVPAFQLKWLSLASCKMGPHFPNWLQTQNQLISLDISNIGISDTIPDWFWDLSIELFFLNLSNNHISGKLPDLSVLKSDDIVIDISSNNFDGPI******STFLNLSKNKFSGLPDCWLNFNSLSILNLANNRFSGKIPDSMGFLHNIQTLSLRNNRLNGELPSSLKNCSKLRVLDLRKNALFGEVPTCVGGSLQNLIILRLKSNNFHGNIPFQLCHLAFIQVLDLSLNNISGKIPKCFSNFSMMIQEKSSNPIIGLANEILVVPGYIYYFRYLDNVLLTWKGSEHEYKSTLGFVKYLDLSSNKLCEAIPEEITDLVGLTALNLSRNNLTGLIPPKIGQLKSLDFLDLSRNHFSGNIPSSLSLLSGLSVLDLSYNSLSGKIPLGTQLQSFNASVYAGNLELCGLPLP**************************QFITLGFYVSLTLGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLYAAA*******
**CKLFLLLEYLALSSVILFQLEPRLGA******CIDEEREALLTFKQSLVDEYGVLSSWGSEDGKRDCCKWRGVRCSNTTGHVKVLNLQTSDHEFARRKFLKGKISPALLKLRGLRHLDLSKNDFGGSPVPEFIGSLSKLRYLNLSCGTPSSKIPHPFRDLSGFEYFNVENSNLFSVGSLERLSHLSSLRHLDLSCINLTKSSDWFQVVSQLHSLKTLVLRSCYLPPINPSFIWLFNLSTSIETLDLSDNHLPSSSVYPWLFNLSRNILHLDLGFNHLQGSIPEAFQHMVSLRLLSLASNELEGGIPKFFGNMCSLNQLYLPRNKLSGQLSELIQNLSSGCTVNSLEGLCLYANDITGPIPDLGRFLSLKVLKLGENHLNGTINKSLSHLFKLETLSLDGNSFTGVISETFFSNMSNLQMLFLADNSLTLKLSHDWVPAFQLKWLSLASCKMGPHFPNWLQTQNQLISLDISNIGISDTIPDWFWDLSIELFFLNLSNNHISGKLPDLSVLKSDDIVIDISSNNFDGPIPPLPSNSTFLNLSKNKFSGLPDCWLNFNSLSILNLANNRFSGKIPDSMGFLHNIQTLSLRNNRLNGELPSSLKNCSKLRVLDLRKNALFGEVPTCVGGSLQNLIILRLKSNNFHGNIPFQLCHLAFIQVLDLSLNNISGKIPKCFSNFSMMIQE******IGLANEILVVPGYIYYFRYLDNVLLTWKGSEHEYKSTLGFVKYLDLSSNKLCEAIPEEITDLVGLTALNLSRNNLTGLIPPKIGQLKSLDFLDLSRNHFSGNIPSSLSLLSGLSVLDLSYNSLSGKIPLGTQLQSFNASVYAGNLELCGLPL***************************QFITLGFYVSLTLGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLYAAAAMNKSNL
MSCKLFLLLEYLALSSVILFQLEPRLGASNNITRCIDEEREALLTFKQSLVDEYGVLSSWGSEDGKRDCCKWRGVRCSNTTGHVKVLNLQTSDHEFARRKFLKGKISPALLKLRGLRHLDLSKNDFGGSPVPEFIGSLSKLRYLNLSCGTPSSKIPHPFRDLSGFEYFNVENSNLFSVGSLERLSHLSSLRHLDLSCINLTKSSDWFQVVSQLHSLKTLVLRSCYLPPINPSFIWLFNLSTSIETLDLSDNHLPSSSVYPWLFNLSRNILHLDLGFNHLQGSIPEAFQHMVSLRLLSLASNELEGGIPKFFGNMCSLNQLYLPRNKLSGQLSELIQNLSSGCTVNSLEGLCLYANDITGPIPDLGRFLSLKVLKLGENHLNGTINKSLSHLFKLETLSLDGNSFTGVISETFFSNMSNLQMLFLADNSLTLKLSHDWVPAFQLKWLSLASCKMGPHFPNWLQTQNQLISLDISNIGISDTIPDWFWDLSIELFFLNLSNNHISGKLPDLSVLKSDDIVIDISSNNFDGPIPPLPSNSTFLNLSKNKFSGLPDCWLNFNSLSILNLANNRFSGKIPDSMGFLHNIQTLSLRNNRLNGELPSSLKNCSKLRVLDLRKNALFGEVPTCVGGSLQNLIILRLKSNNFHGNIPFQLCHLAFIQVLDLSLNNISGKIPKCFSNFSMMIQEKSSNPIIGLANEILVVPGYIYYFRYLDNVLLTWKGSEHEYKSTLGFVKYLDLSSNKLCEAIPEEITDLVGLTALNLSRNNLTGLIPPKIGQLKSLDFLDLSRNHFSGNIPSSLSLLSGLSVLDLSYNSLSGKIPLGTQLQSFNASVYAGNLELCGLPLPNKC************DDANTVEDEDNQFITLGFYVSLTLGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLYAAAAMNKSNL
*SCKLFLLLEYLALSSVILFQLEPRLGASNNITRCIDEEREALLTFKQSLVDEYGVLSSWGSEDGKRDCCKWRGVRCSNTTGHVKVLNLQTSDHEFARRKFLKGKISPALLKLRGLRHLDLSKNDFGGSPVPEFIGSLSKLRYLNLSCGTPSSKIPHPFRDLSGFEYFNVENSNLFSVGSLERLSHLSSLRHLDLSCINLTKSSDWFQVVSQLHSLKTLVLRSCYLPPINPSFIWLFNLSTSIETLDLSDNHLPSSSVYPWLFNLSRNILHLDLGFNHLQGSIPEAFQHMVSLRLLSLASNELEGGIPKFFGNMCSLNQLYLPRNKLSGQLSELIQNLSSGCTVNSLEGLCLYANDITGPIPDLGRFLSLKVLKLGENHLNGTINKSLSHLFKLETLSLDGNSFTGVISETFFSNMSNLQMLFLADNSLTLKLSHDWVPAFQLKWLSLASCKMGPHFPNWLQTQNQLISLDISNIGISDTIPDWFWDLSIELFFLNLSNNHISGKLPDLSVLKSDDIVIDISSNNFDGPIPPLPSNSTFLNLSKNKFSGLPDCWLNFNSLSILNLANNRFSGKIPDSMGFLHNIQTLSLRNNRLNGELPSSLKNCSKLRVLDLRKNALFGEVPTCVGGSLQNLIILRLKSNNFHGNIPFQLCHLAFIQVLDLSLNNISGKIPKCFSNFSMMIQEKSSNPIIGLANEILVVPGYIYYFRYLDNVLLTWKGSEHEYKSTLGFVKYLDLSSNKLCEAIPEEITDLVGLTALNLSRNNLTGLIPPKIGQLKSLDFLDLSRNHFSGNIPSSLSLLSGLSVLDLSYNSLSGKIPLGTQLQSFNASVYAGNLELCGLPLPNKC*********************DNQFITLGFYVSLTLGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLYAAAAMNKSNL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSCKLFLLLEYLALSSVILFQLEPRLGASNNITRCIDEEREALLTFKQSLVDEYGVLSSWGSEDGKRDCCKWRGVRCSNTTGHVKVLNLQTSDHEFARRKFLKGKISPALLKLRGLRHLDLSKNDFGGSPVPEFIGSLSKLRYLNLSCGTPSSKIPHPFRDLSGFEYFNVENSNLFSVGSLERLSHLSSLRHLDLSCINLTKSSDWFQVVSQLHSLKTLVLRSCYLPPINPSFIWLFNLSTSIETLDLSDNHLPSSSVYPWLFNLSRNILHLDLGFNHLQGSIPEAFQHMVSLRLLSLASNELEGGIPKFFGNMCSLNQLYLPRNKLSGQLSELIQNLSSGCTVNSLEGLCLYANDITGPIPDLGRFLSLKVLKLGENHLNGTINKSLSHLFKLETLSLDGNSFTGVISETFFSNMSNLQMLFLADNSLTLKLSHDWVPAFQLKWLSLASCKMGPHFPNWLQTQNQLISLDISNIGISDTIPDWFWDLSIELFFLNLSNNHISGKLPDLSVLKSDDIVIDISSNNFDGPIPPLPSNSTFLNLSKNKFSGLPDCWLNFNSLSILNLANNRFSGKIPDSMGFLHNIQTLSLRNNRLNGELPSSLKNCSKLRVLDLRKNALFGEVPTCVGGSLQNLIILRLKSNNFHGNIPFQLCHLAFIQVLDLSLNNISGKIPKCFSNFSMMIQEKSSNPIIGLANEILVVPGYIYYFRYLDNVLLTWKGSEHEYKSTLGFVKYLDLSSNKLCEAIPEEITDLVGLTALNLSRNNLTGLIPPKIGQLKSLDFLDLSRNHFSGNIPSSLSLLSGLSVLDLSYNSLSGKIPLGTQLQSFNASVYAGNLELCGLPLPNKCADEESTPSPGRDDDANTVEDEDNQFITLGFYVSLTLGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLYAAAAMNKSNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query927 2.2.26 [Sep-21-2011]
Q9FL28 1173 LRR receptor-like serine/ no no 0.813 0.642 0.315 5e-74
Q9LVP0 1102 Probable leucine-rich rep no no 0.747 0.628 0.312 7e-68
C0LGQ5 1249 LRR receptor-like serine/ no no 0.813 0.603 0.313 3e-64
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.802 0.594 0.296 6e-62
Q9C9H7847 Receptor-like protein 12 no no 0.810 0.886 0.294 2e-61
Q9SHI2 1101 Leucine-rich repeat recep no no 0.792 0.667 0.296 2e-59
O49318 1124 Probable leucine-rich rep no no 0.742 0.612 0.289 3e-58
Q9LP24 1120 Probable leucine-rich rep no no 0.752 0.623 0.294 9e-58
C0LGS2 1136 Probable LRR receptor-lik no no 0.674 0.550 0.314 5e-54
C0LGV1 1135 LRR receptor-like serine/ no no 0.624 0.510 0.322 9e-53
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function desciption
 Score =  280 bits (715), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 260/824 (31%), Positives = 391/824 (47%), Gaps = 70/824 (8%)

Query: 34  RCIDEEREALLTFKQSLV-DEYGVLSSWGSEDGKRDCCKWRGVRCSNTTGHVKVLNLQTS 92
           +  + E EAL +FK  +  D  GVLS W +  G    C W G+ C ++TGHV  ++L   
Sbjct: 25  QSFEPEIEALKSFKNGISNDPLGVLSDW-TIIGSLRHCNWTGITC-DSTGHVVSVSL--- 79

Query: 93  DHEFARRKFLKGKISPALLKLRGLRHLDLSKNDFGGSPVPEFIGSLSKLRYLNLSCGTPS 152
                  K L+G +SPA+  L  L+ LDL+ N F G  +P  IG L++L  L L     S
Sbjct: 80  -----LEKQLEGVLSPAIANLTYLQVLDLTSNSFTGK-IPAEIGKLTELNQLILYLNYFS 133

Query: 153 SKIPHPFRDLSGFEYFNVENSNLFSVGSLERLSHLSSLRHLDLSCINLTKSSDWFQVVSQ 212
             IP    +L    Y ++ N NL S    E +   SSL  +     NLT      + +  
Sbjct: 134 GSIPSGIWELKNIFYLDLRN-NLLSGDVPEEICKTSSLVLIGFDYNNLT--GKIPECLGD 190

Query: 213 LHSLKTLVLRSCYLPPINPSFIWLFNLSTSIETLDLSDNHLPSSSVYPWLFNLSRNILHL 272
           L  L+  V                            + NHL  S   P       N+  L
Sbjct: 191 LVHLQMFVA---------------------------AGNHLTGS--IPVSIGTLANLTDL 221

Query: 273 DLGFNHLQGSIPEAFQHMVSLRLLSLASNELEGGIPKFFGNMCSLNQLYLPRNKLSGQLS 332
           DL  N L G IP  F ++++L+ L L  N LEG IP   GN  SL QL L  N+L+G++ 
Sbjct: 222 DLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIP 281

Query: 333 ELIQNLSSGCTVNSLEGLCLYANDITGPIPD-LGRFLSLKVLKLGENHLNGTINKSLSHL 391
             + NL        L+ L +Y N +T  IP  L R   L  L L ENHL G I++ +  L
Sbjct: 282 AELGNLVQ------LQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHLVGPISEEIGFL 335

Query: 392 FKLETLSLDGNSFTGVISETFFSNMSNLQMLFLADNSLTLKLSHDWVPAFQLKWLSLASC 451
             LE L+L  N+FTG   ++  +N+ NL +L +  N+++ +L  D      L+ LS    
Sbjct: 336 ESLEVLTLHSNNFTGEFPQSI-TNLRNLTVLTVGFNNISGELPADLGLLTNLRNLSAHDN 394

Query: 452 KMGPHFPNWLQTQNQLISLDISNIGISDTIPDWFWDLSIELFFLNLSNNHISGKLPDLSV 511
            +    P+ +     L  LD+S+  ++  IP  F  ++  L F+++  NH +G++PD   
Sbjct: 395 LLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGFGRMN--LTFISIGRNHFTGEIPDDIF 452

Query: 512 LKSDDIVIDISSNNFDGPIPPLPSNST---FLNLSKNKFSG-LPDCWLNFNSLSILNLAN 567
             S+   + ++ NN  G + PL         L +S N  +G +P    N   L+IL L +
Sbjct: 453 NCSNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHS 512

Query: 568 NRFSGKIPDSMGFLHNIQTLSLRNNRLNGELPSSLKNCSKLRVLDLRKNALFGEVPTCVG 627
           N F+G+IP  M  L  +Q L + +N L G +P  + +   L VLDL  N   G++P    
Sbjct: 513 NGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFS 572

Query: 628 GSLQNLIILRLKSNNFHGNIPFQLCHLAFIQVLDLSLNNISGKIPKCFSNFSMMIQEKSS 687
             L++L  L L+ N F+G+IP  L  L+ +   D+S N ++G IP       ++   K+ 
Sbjct: 573 -KLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGTIPG-----ELLASLKNM 626

Query: 688 NPIIGLANEILV--VPGYIYYFRYLDNVLLT---WKGSEHEYKSTLGFVKYLDLSSNKLC 742
              +  +N +L   +P  +     +  + L+   + GS          V  LD S N L 
Sbjct: 627 QLYLNFSNNLLTGTIPKELGKLEMVQEIDLSNNLFSGSIPRSLQACKNVFTLDFSQNNLS 686

Query: 743 EAIPEEI-TDLVGLTALNLSRNNLTGLIPPKIGQLKSLDFLDLSRNHFSGNIPSSLSLLS 801
             IP+E+   +  + +LNLSRN+ +G IP   G +  L  LDLS N+ +G IP SL+ LS
Sbjct: 687 GHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLS 746

Query: 802 GLSVLDLSYNSLSGKIPLGTQLQSFNASVYAGNLELCGLPLPNK 845
            L  L L+ N+L G +P     ++ NAS   GN +LCG   P K
Sbjct: 747 TLKHLKLASNNLKGHVPESGVFKNINASDLMGNTDLCGSKKPLK 790




Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs). Flagellin-binding to the receptor is the first step to initiate the innate immune MAP kinase signaling cascade (MEKK1, MKK4/MKK5 and MPK3/MPK6), resulting in enhanced resistance against pathogens. Binding to the effector AvrPto1 from Pseudomonas syringae blocks the downstream plant immune response.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query927
2254647121021 PREDICTED: receptor-like protein 12-like 0.960 0.871 0.472 0.0
359490572975 PREDICTED: probable LRR receptor-like se 0.943 0.897 0.471 0.0
2254661471024 PREDICTED: LRR receptor-like serine/thre 0.954 0.864 0.463 0.0
224105895963 predicted protein [Populus trichocarpa] 0.956 0.921 0.475 0.0
147807651971 hypothetical protein VITISV_018647 [Viti 0.937 0.894 0.452 0.0
359490576972 PREDICTED: LRR receptor-like serine/thre 0.911 0.869 0.448 0.0
225462661 1485 PREDICTED: LRR receptor-like serine/thre 0.915 0.571 0.459 0.0
3594905601010 PREDICTED: LRR receptor-like serine/thre 0.962 0.883 0.429 0.0
224116866994 predicted protein [Populus trichocarpa] 0.944 0.881 0.457 0.0
224125666938 predicted protein [Populus trichocarpa] 0.918 0.907 0.458 0.0
>gi|225464712|ref|XP_002276171.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/996 (47%), Positives = 607/996 (60%), Gaps = 106/996 (10%)

Query: 16   SVILFQLEPRLGASNNITRCIDEEREALLTFKQSLVDEYGVLSSWGSEDGKRDCCKWRGV 75
            +++L   +P LG+      C+++ER+ALL FKQ LVD++G+LSSWG+E+ +RDCCKWRGV
Sbjct: 38   TLLLLCSKPGLGSG-----CVEKERQALLDFKQGLVDDFGILSSWGNEEDRRDCCKWRGV 92

Query: 76   RCSNTTGHVKVLNLQTSDHEFARR-KFLKGKISPALLKLRGLRHLDLSKNDFGGSPVPEF 134
            +CSN T HV +L+L     +   + + L+G+IS +LL+L+ L HLDLS NDF GS VPEF
Sbjct: 93   QCSNRTSHVIMLDLHALPTDTVHKYQSLRGRISSSLLELQHLNHLDLSLNDFQGSYVPEF 152

Query: 135  IGSLSKLRYLNLSCGTPSSKIPHPFRDLSGFEYFNVENSNLFSVGSLERLSHLSSLRHLD 194
            IG  SKLRYLNLS    +  IP    +LS   + ++  +   S  +LE LS LSSLRHLD
Sbjct: 153  IGLFSKLRYLNLSEARLAGMIPSHLGNLSNLHFLDLSRNYGMSSETLEWLSRLSSLRHLD 212

Query: 195  LSCINLTKSSDWFQVVSQLHSLKTLVLRSCYLPPI-NPSFIWLFNLSTSIETLDLSDNHL 253
            LS +NL K+  W  V+++L SL  L+L    LP I  PS +   N S S+  LDLS N L
Sbjct: 213  LSGLNLDKAIYWEHVINRLPSLTDLLLHDSALPQIITPSALSYTNSSKSLVVLDLSWNFL 272

Query: 254  PSSSVYPWLFNLSRNILHLDLGFN------------------------------------ 277
             SSSVYPWLFNLS +++HLDL  N                                    
Sbjct: 273  -SSSVYPWLFNLSSSLVHLDLSINQIQGLIPDTFGEMVSLEYLDLFFNQLEGEIPQSLTS 331

Query: 278  -----------HLQGSIPEAFQHMVSLRLLSLASNELEGGIPKFFGNMCSLNQLYLPRNK 326
                       HL GSIP+ F HM SL  L L+ N+LEGGIPK F N+CSL  + L  N 
Sbjct: 332  TSLVHLDLSVNHLHGSIPDTFGHMTSLSYLDLSLNQLEGGIPKSFKNLCSLQMVMLLSNS 391

Query: 327  LSGQLSELIQNLSSGCTVNSLEGLCLYANDITGPIPDLGRFLSLKVLKLGENHLNGTINK 386
            L+ QL E +QN S  C+ ++LE L L  N  TG  P+   F  L  L +  N LNGT  +
Sbjct: 392  LTAQLPEFVQN-SLSCSKDTLEVLVLSWNQFTGSFPNFTGFSVLGHLYIDHNRLNGTFPE 450

Query: 387  SLSHLFKLETLSLDGNSFTGVISETFFSNMSNLQMLFLADNSLTLKLSHDWVPAFQLKWL 446
             +  L +LE L + GNS  G I+E   S++S L  L L+ NSL L+LS +W P FQ+ +L
Sbjct: 451  HIGQLSQLEVLEISGNSLHGNITEAHLSSLSKLYWLDLSSNSLALELSPEWTPPFQVGYL 510

Query: 447  SLASCKMGPHFPNWLQTQNQLISLDISNIGISDTIPDWFWDLSIELFFLNLSNNHISGKL 506
             L SCKMGP+FP WLQTQ  L SLDISN  ISD IP WFW+L+ +L  L ++NN I G++
Sbjct: 511  GLLSCKMGPNFPGWLQTQKDLFSLDISNSSISDVIPSWFWNLTSKLIKLRIANNQIRGRV 570

Query: 507  PDLSVLKSDDIVIDISSNNFDGPIPPLPSNSTFLNLSKNKFSG----------------- 549
            P L +  +   VID+S N F+GPIP LPS    L+LSKN FSG                 
Sbjct: 571  PSLRMETA--AVIDLSLNRFEGPIPSLPSGVRVLSLSKNLFSGSISLLCTIVDGALSYLD 628

Query: 550  ---------LPDCWLNF-NSLSILNLANNRFSGKIPDSMGFLHNIQTLSLRNNRLNGELP 599
                     LPDCW  + + L ILNLANN FSGK+P S+G L  +QTL L NN   GELP
Sbjct: 629  LSDNLLSGALPDCWQQWRDQLQILNLANNNFSGKLPYSLGSLAALQTLHLYNNGFLGELP 688

Query: 600  SSLKNCSKLRVLDLRKNALFGEVPTCVGGSLQNLIILRLKSNNFHGNIPFQLCHLAFIQV 659
            SSL NC+KLR++D+ KN   GE+PT +G  L +L++L L+SN FHG+I   +C L  +Q+
Sbjct: 689  SSLMNCTKLRLVDMGKNRFSGEIPTWIGERLSDLVVLSLRSNEFHGSISSDICLLKELQI 748

Query: 660  LDLSLNNISGKIPKCFSNFSMMIQEKSSNPI----IGLA------NEILVVPGYIY---- 705
            LD S NNISG IP+C +NF+ M Q+   + I    + L+      N + + P + Y    
Sbjct: 749  LDFSRNNISGTIPRCLNNFTAMAQKMIYSVIAHDYLALSIVPRGRNNLGITPRWAYSSGS 808

Query: 706  ---YFRYLDNVLLTWKGSEHEYKSTLGFVKYLDLSSNKLCEAIPEEITDLVGLTALNLSR 762
                 RY+D+ L+ WKG E EYK+ LG V+ +DLSSNKL   IP+EIT L+ L +LNLSR
Sbjct: 809  FDTIARYVDSALIPWKGGEFEYKNILGLVRSIDLSSNKLSGEIPKEITKLMELISLNLSR 868

Query: 763  NNLTGLIPPKIGQLKSLDFLDLSRNHFSGNIPSSLSLLSGLSVLDLSYNSLSGKIPLGTQ 822
            N+L G IP  IGQLKSLD LDLS+N   G IPSSLS +  LSVLDLS N+LSG+IP GTQ
Sbjct: 869  NHLNGQIPSMIGQLKSLDVLDLSKNQLDGKIPSSLSQIDRLSVLDLSSNNLSGQIPSGTQ 928

Query: 823  LQSFNASVYAGNLELCGLPLPNKCA-DEESTPSPGRDDDANTVEDEDNQFITLGFYVSLT 881
            LQ F AS Y GN ELCG PL  KC  DE +  SP  D + + ++D++       FYVS+ 
Sbjct: 929  LQGFEASSYMGNPELCGSPLKTKCQEDETAQTSPTSDGNEDDLQDDE---FDPWFYVSIA 985

Query: 882  LGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLY 917
            LGF VGFWGV GTL+L  SW   Y+ FL  +KDW +
Sbjct: 986  LGFLVGFWGVWGTLVLKSSWSEAYFRFLNKIKDWFF 1021




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359490572|ref|XP_003634116.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225466147|ref|XP_002270042.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224105895|ref|XP_002333753.1| predicted protein [Populus trichocarpa] gi|222838401|gb|EEE76766.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147807651|emb|CAN64389.1| hypothetical protein VITISV_018647 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490576|ref|XP_003634117.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225462661|ref|XP_002266475.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490560|ref|XP_002266431.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224116866|ref|XP_002331833.1| predicted protein [Populus trichocarpa] gi|222875071|gb|EEF12202.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224125666|ref|XP_002329688.1| predicted protein [Populus trichocarpa] gi|222870596|gb|EEF07727.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query927
TAIR|locus:2129246891 RLP50 "receptor like protein 5 0.843 0.877 0.315 2.7e-75
TAIR|locus:2044767905 AT2G34930 "AT2G34930" [Arabido 0.823 0.843 0.294 7.5e-73
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.861 0.847 0.309 4.9e-69
TAIR|locus:2119535725 RLP48 "receptor like protein 4 0.645 0.824 0.332 5.1e-67
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.670 0.710 0.327 3.6e-66
TAIR|locus:2055772983 RLP19 "receptor like protein 1 0.816 0.770 0.298 4.5e-66
TAIR|locus:2085537894 RLP34 "AT3G11010" [Arabidopsis 0.814 0.844 0.301 5.2e-65
TAIR|locus:2078112868 RLP32 "receptor like protein 3 0.673 0.718 0.312 3.7e-64
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.628 0.497 0.313 5.7e-64
TAIR|locus:2144392957 RLP53 "receptor like protein 5 0.846 0.820 0.298 7.7e-64
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 759 (272.2 bits), Expect = 2.7e-75, P = 2.7e-75
 Identities = 272/863 (31%), Positives = 398/863 (46%)

Query:    35 CIDEEREALLTFKQSLV------DEYGVLSSWGSEDGKRDCCKWRGVRCSNTTGHVKVLN 88
             C+ ++R+ALL FK          D   +L +        DCC W G+ C   TG V  L+
Sbjct:    26 CLPDQRDALLEFKNEFSIPSPDSDLMLILQTTAKWRNNTDCCSWGGISCDPKTGVVVELD 85

Query:    89 LQTSDHEFARRKFLKGKI--SPAXXXXXXXXXXXXSKNDFGGSPVPEFIGSLSKLRYLNL 146
             L  SD        L G++  + +            S ND   + +P+  G+   LR LNL
Sbjct:    86 LGNSD--------LNGRLRSNSSLFRLQHLQSLDLSYNDLSCT-LPDSSGNFKYLRVLNL 136

Query:   147 -SCGTPSSKIPHPFRDLSGFEYFNVE-NSNLFSVGXXXXXXXXXXXXXXXXXCINLTKSS 204
               C     +IP   R LS     ++  N +L                      ++LT   
Sbjct:   137 LGCNL-FGEIPTSLRSLSYLTDLDLSYNDDL------TGEILDSMGNLKHLRVLSLTSCK 189

Query:   205 DWFQVVSQLHSLKTLV---LRSCYLPPINPSFIWLFNLSTSIETLDLSDNHLPSSSVYPW 261
                ++ S L +L  L    L   Y     P  +   NL  S+  L+L   +     +   
Sbjct:   190 FTGKIPSSLGNLTYLTDLDLSWNYFTGELPDSMG--NLK-SLRVLNLHRCNF-FGKIPTS 245

Query:   262 LFNLSRNILHLDLGFNHLQGSIPEA---------FQHMV----SLRLLSLASNELEGGIP 308
             L +LS N+  LD+  N      P++         FQ M+    SL  + L+SN+ +  +P
Sbjct:   246 LGSLS-NLTDLDISKNEFTSEGPDSMSSLNRLTDFQLMLLNLSSLTNVDLSSNQFKAMLP 304

Query:   309 KFFGNMCSLNQLYLPRNKLSGQLSELIQNLSSGCTVNSLEGLCLYANDITGPIPDLGRFL 368
                 ++  L    +  N  SG +       SS   + SL  L L  ND +GP+  +G   
Sbjct:   305 SNMSSLSKLEAFDISGNSFSGTIP------SSLFMLPSLIKLDLGTNDFSGPLK-IGNIS 357

Query:   369 S---LKVLKLGENHLNGTINKSLSHLFKLETLSLDGNSFTGVISETFFSNMSNLQMLFLA 425
             S   L+ L +GEN++NG I +S+  L  L  LSL      G++  + F  + +L+ L L+
Sbjct:   358 SPSNLQELYIGENNINGPIPRSILKLVGLSALSLSFWDTGGIVDFSIFLQLKSLRSLDLS 417

Query:   426 DNSLTLKLSHDWVPAFQLKWLSLASCKMGPHFPNWLQTQNQLISLDISNIGISDTIPDWF 485
               +L +  SH  +P+  +  L L+SC +   FP +L+ Q  L  LDIS   I   +P+W 
Sbjct:   418 GINLNISSSHH-LPSHMMH-LILSSCNIS-QFPKFLENQTSLYHLDISANQIEGQVPEWL 474

Query:   486 WDLSIELFFLNLSNNHISGKLPDLSVLKSDDIVIDISSNNFDGPIPPLPSNSTFLNLSKN 545
             W L   L ++N++ N  SG   +L++L +       S N F G IP        L LS N
Sbjct:   475 WRLPT-LRYVNIAQNAFSG---ELTMLPNPIYSFIASDNKFSGEIPRAVCEIGTLVLSNN 530

Query:   546 KFSG-LPDCW-LNFNSLSILNLANNRFSGKIPDSMGFLHN-IQTLSLRNNRLNGELPSSL 602
              FSG +P C+ ++  +LSIL+L NN  SG IP+    LH  +++L + +NRL+G+ P SL
Sbjct:   531 NFSGSIPPCFEISNKTLSILHLRNNSLSGVIPEES--LHGYLRSLDVGSNRLSGQFPKSL 588

Query:   603 KNCSKLRVLDLRKNALFGEVPTCVGGSLQNLIILRLKSNNFHGNI--PFQLCHLAFIQVL 660
              NCS L+ L++ +N +    P+ +  SL NL +L L+SN FHG I  P      + ++  
Sbjct:   589 INCSYLQFLNVEENRINDTFPSWLK-SLPNLQLLVLRSNEFHGPIFSPGDSLSFSKLRFF 647

Query:   661 DLSLNNISGKIPK-CFSNFSMMIQEKSSNPIIGLANEILVVPGYIYYFRYLDNVLLTWKG 719
             D+S N  SG +P   F  +S+M    S   II       VV      F    +V+LT KG
Sbjct:   648 DISENRFSGVLPSDYFVGWSVM---SSFVDIIDNTPGFTVVGDDQESFH--KSVVLTIKG 702

Query:   720 SEHEYKSTLGFVKY--LDLSSNKLCEAIPEEITDLVGLTALNLSRNNLTGLIPPKIGQLK 777
                E   + GF  Y  +D+S N+L   IPE I  L  L  LN+S N  TG IPP +  L 
Sbjct:   703 LNMELVGS-GFEIYKTIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLS 761

Query:   778 SLDFLDLSRNHFSGNIPXXXXXXXXXXXXXXXYNSLSGKIPLGTQLQSFNASVYAGNLEL 837
             +L  LDLS+N  SG+IP               YN L G IP GTQ+QS N+S +A N  L
Sbjct:   762 NLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNMLEGPIPQGTQIQSQNSSSFAENPGL 821

Query:   838 CGLPLPNKCADEESTPSPGRDDD 860
             CG PL  KC  EE       + D
Sbjct:   822 CGAPLQKKCGGEEEEDKEKEEKD 844


GO:0005886 "plasma membrane" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119535 RLP48 "receptor like protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00037814001
SubName- Full=Chromosome undetermined scaffold_91, whole genome shotgun sequence; (996 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query927
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-66
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-62
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-48
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-29
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-19
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 8e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  240 bits (613), Expect = 2e-66
 Identities = 211/660 (31%), Positives = 301/660 (45%), Gaps = 117/660 (17%)

Query: 38  EEREALLTFKQSLVDEYGVLSSWGSEDGKRDCCKWRGVRCSNTTGHVKVLNLQTSDHEFA 97
           EE E LL+FK S+ D    LS+W S     D C W+G+ C+N++  V  ++L        
Sbjct: 29  EELELLLSFKSSINDPLKYLSNWNSSA---DVCLWQGITCNNSS-RVVSIDLSG------ 78

Query: 98  RRKFLKGKISPALLKLRGLRHLDLSKNDFGGSPVPEFIGSLSKLRYLNLSCGTPSSKIPH 157
             K + GKIS A+ +L  ++ ++LS N   G P+P+ I + S                  
Sbjct: 79  --KNISGKISSAIFRLPYIQTINLSNNQLSG-PIPDDIFTTS------------------ 117

Query: 158 PFRDLSGFEYFNVENSNLFSVGSLERLSHLSSLRHLDLSCINLTKSSDWFQVVSQLHSLK 217
                                         SSLR+L+LS  N T                
Sbjct: 118 ------------------------------SSLRYLNLSNNNFTG--------------- 132

Query: 218 TLVLRSCYLPPINPSFIWLFNLSTSIETLDLSDNHLPSSSVYPWLFNLSRNILHLDLGFN 277
                      I    I        +ETLDLS+N L  S   P       ++  LDLG N
Sbjct: 133 ----------SIPRGSIPN------LETLDLSNNML--SGEIPNDIGSFSSLKVLDLGGN 174

Query: 278 HLQGSIPEAFQHMVSLRLLSLASNELEGGIPKFFGNMCSLNQLYLPRNKLSGQLSELIQN 337
            L G IP +  ++ SL  L+LASN+L G IP+  G M SL  +YL  N LSG++   I  
Sbjct: 175 VLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGG 234

Query: 338 LSSGCTVNSLEGLCLYANDITGPIP-DLGRFLSLKVLKLGENHLNGTINKSLSHLFKLET 396
           L+      SL  L L  N++TGPIP  LG   +L+ L L +N L+G I  S+  L KL +
Sbjct: 235 LT------SLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLIS 288

Query: 397 LSLDGNSFTGVISETFFSNMSNLQMLFLADNSLTLKLSHDWVPAFQLKWLSLASCKMGPH 456
           L L  NS +G I E     + NL++L L  N+ T K+        +L+ L L S K    
Sbjct: 289 LDLSDNSLSGEIPE-LVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGE 347

Query: 457 FPNWLQTQNQLISLDISNIGISDTIPDWFWDLSIELFFLNLSNNHISGKLP-DLSVLKSD 515
            P  L   N L  LD+S   ++  IP+     S  LF L L +N + G++P  L   +S 
Sbjct: 348 IPKNLGKHNNLTVLDLSTNNLTGEIPEGLCS-SGNLFKLILFSNSLEGEIPKSLGACRSL 406

Query: 516 DIVIDISSNNFDGPIPPLPSNST------FLNLSKNKFSG-LPDCWLNFNSLSILNLANN 568
             V  +  N+F G    LPS  T      FL++S N   G +     +  SL +L+LA N
Sbjct: 407 RRV-RLQDNSFSG---ELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARN 462

Query: 569 RFSGKIPDSMGFLHNIQTLSLRNNRLNGELPSSLKNCSKLRVLDLRKNALFGEVPTCVGG 628
           +F G +PDS G    ++ L L  N+ +G +P  L + S+L  L L +N L GE+P  +  
Sbjct: 463 KFFGGLPDSFG-SKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDEL-S 520

Query: 629 SLQNLIILRLKSNNFHGNIPFQLCHLAFIQVLDLSLNNISGKIPKCFSNFSMMIQEKSSN 688
           S + L+ L L  N   G IP     +  +  LDLS N +SG+IPK   N   ++Q   S+
Sbjct: 521 SCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISH 580


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 927
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG4237498 consensus Extracellular matrix protein slit, conta 99.9
PLN032101153 Resistant to P. syringae 6; Provisional 99.89
PLN032101153 Resistant to P. syringae 6; Provisional 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
PLN03150623 hypothetical protein; Provisional 99.54
PLN03150623 hypothetical protein; Provisional 99.46
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.18
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.18
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.16
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.16
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.14
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.06
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.05
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.03
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.96
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.9
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.82
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.8
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.8
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.76
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.75
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.73
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.73
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.71
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.68
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.64
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.63
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.38
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.31
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.29
KOG4341483 consensus F-box protein containing LRR [General fu 98.23
KOG4341483 consensus F-box protein containing LRR [General fu 98.17
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.05
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.97
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.96
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.78
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.73
PRK15386426 type III secretion protein GogB; Provisional 97.72
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.69
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.64
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.59
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.59
PRK15386426 type III secretion protein GogB; Provisional 97.51
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.45
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.06
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.89
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.85
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.38
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.31
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.22
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.22
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.01
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.88
KOG4308478 consensus LRR-containing protein [Function unknown 92.45
KOG4308478 consensus LRR-containing protein [Function unknown 92.08
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.2
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 88.3
smart0037026 LRR Leucine-rich repeats, outliers. 86.52
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.52
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.16
smart0037026 LRR Leucine-rich repeats, outliers. 86.16
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 82.23
KOG0473326 consensus Leucine-rich repeat protein [Function un 81.15
KOG3864221 consensus Uncharacterized conserved protein [Funct 80.38
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=4e-71  Score=692.54  Aligned_cols=583  Identities=35%  Similarity=0.538  Sum_probs=403.9

Q ss_pred             CHHHHHHHHHhhhcCcCCCCCcCCCCCCCCCCCCccccceeecCCCCCEEEEECCCCchhhhhccccccccCccccCCCC
Q 047797           36 IDEEREALLTFKQSLVDEYGVLSSWGSEDGKRDCCKWRGVRCSNTTGHVKVLNLQTSDHEFARRKFLKGKISPALLKLRG  115 (927)
Q Consensus        36 ~~~~~~~ll~~k~~~~~~~~~~~~W~~~~~~~~~c~w~gv~c~~~~~~v~~L~L~~~~~~~~~~~~l~g~~~~~l~~l~~  115 (927)
                      .++|++||++||+++.+|.+.+.+|+   .+++||.|.||+|+. .++|+.|+|++        +.++|.+++++..+++
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~---~~~~~c~w~gv~c~~-~~~v~~L~L~~--------~~i~~~~~~~~~~l~~   94 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWN---SSADVCLWQGITCNN-SSRVVSIDLSG--------KNISGKISSAIFRLPY   94 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCC---CCCCCCcCcceecCC-CCcEEEEEecC--------CCccccCChHHhCCCC
Confidence            45899999999999988888899997   467999999999974 57999999998        7889999999999999


Q ss_pred             CCeeeCCCCCCCCCCCCcccc-CCCCCCEEECCCCCCCCCCCccCCCCCCCcEEecCCCCccCCCCcccccCCCCCcEEE
Q 047797          116 LRHLDLSKNDFGGSPVPEFIG-SLSKLRYLNLSCGTPSSKIPHPFRDLSGFEYFNVENSNLFSVGSLERLSHLSSLRHLD  194 (927)
Q Consensus       116 L~~L~Ls~n~~~~~~lp~~l~-~l~~L~~L~Ls~n~~~~~~p~~l~~l~~L~~L~Ls~~~~~~~~~~~~l~~l~~L~~L~  194 (927)
                      |++|+|++|.+.+. +|..+. .+++|++|+|++|.+++.+|.  +.+++|++|++                        
T Consensus        95 L~~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~L------------------------  147 (968)
T PLN00113         95 IQTINLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDL------------------------  147 (968)
T ss_pred             CCEEECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEEC------------------------
Confidence            99999999999875 776654 888899999988888777663  12222222222                        


Q ss_pred             CCCccCCCCCchHHhhcCCCCCCEEEcCCCCCCCCCCchhhccccccCccEEEcCCCCCCCCCcchhHhhcccCccEEEc
Q 047797          195 LSCINLTKSSDWFQVVSQLHSLKTLVLRSCYLPPINPSFIWLFNLSTSIETLDLSDNHLPSSSVYPWLFNLSRNILHLDL  274 (927)
Q Consensus       195 Ls~n~l~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~l~~~~~~L~~L~Ls~n~l~~~~~~~~l~~~~~~L~~L~L  274 (927)
                       +                          +|.+++..|  ..+.++ ++|++|++++|.+.+ .+|..+.++. +|++|++
T Consensus       148 -s--------------------------~n~~~~~~p--~~~~~l-~~L~~L~L~~n~l~~-~~p~~~~~l~-~L~~L~L  195 (968)
T PLN00113        148 -S--------------------------NNMLSGEIP--NDIGSF-SSLKVLDLGGNVLVG-KIPNSLTNLT-SLEFLTL  195 (968)
T ss_pred             -c--------------------------CCcccccCC--hHHhcC-CCCCEEECccCcccc-cCChhhhhCc-CCCeeec
Confidence             2                          222222222  223333 445555555555444 4444444444 4455555


Q ss_pred             cCCcCcCCcchhhhcCCCCCEEEccCCcCCCcCcccccCCCCCcEEeCCCCCCCCchhHHHhhccCCCcCCCccEEEccC
Q 047797          275 GFNHLQGSIPEAFQHMVSLRLLSLASNELEGGIPKFFGNMCSLNQLYLPRNKLSGQLSELIQNLSSGCTVNSLEGLCLYA  354 (927)
Q Consensus       275 s~n~i~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~~~~~~~L~~L~L~~  354 (927)
                      ++|.+.+.+|..++++++|++|++++|++.+.+|..++++++|++|++++|.+++..|..                    
T Consensus       196 ~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~--------------------  255 (968)
T PLN00113        196 ASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSS--------------------  255 (968)
T ss_pred             cCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChh--------------------
Confidence            544444444444444444444444444444444444444444444444444444444444                    


Q ss_pred             CCCcccCCCCCCCCCCCEEEccCCcCCCcchhhhhccCCCCEEecCCcccccccChhhhhcCCCCCEEEccCCcceeccc
Q 047797          355 NDITGPIPDLGRFLSLKVLKLGENHLNGTINKSLSHLFKLETLSLDGNSFTGVISETFFSNMSNLQMLFLADNSLTLKLS  434 (927)
Q Consensus       355 n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~  434 (927)
                               ++++++|++|++++|.+.+.+|..+.++++|++|++++|.+.+.+|. .+.++++|+.|++++|.+.+   
T Consensus       256 ---------l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~-~~~~l~~L~~L~l~~n~~~~---  322 (968)
T PLN00113        256 ---------LGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPE-LVIQLQNLEILHLFSNNFTG---  322 (968)
T ss_pred             ---------HhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCCh-hHcCCCCCcEEECCCCccCC---
Confidence                     44444555555555555555555555555555555555555544444 34445555555554444433   


Q ss_pred             CCcccccccceeecccccCCCCCChhhhcCccccEEEccCCccCCCccchHHhhccccceeecccccccCCCCCccccCC
Q 047797          435 HDWVPAFQLKWLSLASCKMGPHFPNWLQTQNQLISLDISNIGISDTIPDWFWDLSIELFFLNLSNNHISGKLPDLSVLKS  514 (927)
Q Consensus       435 ~~~~~~~~L~~L~L~~~~~~~~~~~~l~~~~~L~~L~Ls~n~l~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~~~  514 (927)
                                           ..|.++..+++|+.|++++|.+.+.+|..+...                          
T Consensus       323 ---------------------~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~--------------------------  355 (968)
T PLN00113        323 ---------------------KIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKH--------------------------  355 (968)
T ss_pred             ---------------------cCChhHhcCCCCCEEECcCCCCcCcCChHHhCC--------------------------
Confidence                                 233334444444445544444444444333211                          


Q ss_pred             CCcEEeccCCccCCCCCCCCCCCceEeCcCCCCCC-CCcccccCCCCCEEEccCccccccCCCcccccCcccEEEccccc
Q 047797          515 DDIVIDISSNNFDGPIPPLPSNSTFLNLSKNKFSG-LPDCWLNFNSLSILNLANNRFSGKIPDSMGFLHNIQTLSLRNNR  593 (927)
Q Consensus       515 ~l~~l~l~~n~~~~~~~~~~~~L~~L~L~~n~l~~-lp~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~N~  593 (927)
                                          .+|+.|++++|++++ +|..+..+++|+.|++++|.+.+.+|..+..+++|+.|++++|+
T Consensus       356 --------------------~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~  415 (968)
T PLN00113        356 --------------------NNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNS  415 (968)
T ss_pred             --------------------CCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCE
Confidence                                122333333333333 44455556677777777777777777777777788888888888


Q ss_pred             ccccCCccccCCCCCCEEecCCCcCCCCCChhhhhcCccCcEEEccCcccceecCccccCCCCCCEEEccccccccccch
Q 047797          594 LNGELPSSLKNCSKLRVLDLRKNALFGEVPTCVGGSLQNLIILRLKSNNFHGNIPFQLCHLAFIQVLDLSLNNISGKIPK  673 (927)
Q Consensus       594 l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~  673 (927)
                      +++.+|..|..+++|+.|++++|.+++.+|..+. .+++|+.|++++|++.+.+|..+ ..++|+.|++++|++++.+|.
T Consensus       416 l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~-~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~  493 (968)
T PLN00113        416 FSGELPSEFTKLPLVYFLDISNNNLQGRINSRKW-DMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPR  493 (968)
T ss_pred             eeeECChhHhcCCCCCEEECcCCcccCccChhhc-cCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccCh
Confidence            8777777777888888888888888777777665 57888888888888887777655 457899999999999988888


Q ss_pred             hhccccccccccCCCCccccccccccccccceeeeecceeEEeeecccccccccccceeEEEccCCcccccCcccccccc
Q 047797          674 CFSNFSMMIQEKSSNPIIGLANEILVVPGYIYYFRYLDNVLLTWKGSEHEYKSTLGFVKYLDLSSNKLCEAIPEEITDLV  753 (927)
Q Consensus       674 ~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~LdLs~N~l~~~~p~~~~~l~  753 (927)
                      .+.+++.|                                                  +.|+|++|++++.+|..+.+++
T Consensus       494 ~~~~l~~L--------------------------------------------------~~L~Ls~N~l~~~~p~~~~~l~  523 (968)
T PLN00113        494 KLGSLSEL--------------------------------------------------MQLKLSENKLSGEIPDELSSCK  523 (968)
T ss_pred             hhhhhhcc--------------------------------------------------CEEECcCCcceeeCChHHcCcc
Confidence            77765554                                                  8999999999999999999999


Q ss_pred             CCCEEecccccccccCCccccCCCCCCeEeCCCCcCcccCCccccCCCCCCeEeCcCCcCcccCCCCCcCCCCcccccCC
Q 047797          754 GLTALNLSRNNLTGLIPPKIGQLKSLDFLDLSRNHFSGNIPSSLSLLSGLSVLDLSYNSLSGKIPLGTQLQSFNASVYAG  833 (927)
Q Consensus       754 ~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~~~~~~~~~~  833 (927)
                      +|++|+|++|.+++.+|..++++++|+.|||++|++++.+|..+..+++|++|++++|+++|.+|..+++.++...++.|
T Consensus       524 ~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~  603 (968)
T PLN00113        524 KLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAG  603 (968)
T ss_pred             CCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCC
Q 047797          834 NLELCGLP  841 (927)
Q Consensus       834 n~~lc~~~  841 (927)
                      |+.+||.+
T Consensus       604 n~~lc~~~  611 (968)
T PLN00113        604 NIDLCGGD  611 (968)
T ss_pred             CccccCCc
Confidence            99999854



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query927
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-45
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-45
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 8e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-11
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 6e-05
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 6e-05
3cig_A697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 2e-04
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 3e-04
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 3e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 180 bits (457), Expect = 3e-45, Method: Compositional matrix adjust. Identities = 207/675 (30%), Positives = 300/675 (44%), Gaps = 125/675 (18%) Query: 278 HLQGSIPEAFQHMVSLRLLSLASNELEGGIPKF--FGNMCSLNQLYLPRNKLSGQLSELI 335 H+ GS+ F+ SL L L+ N L G + G+ L L + N L + Sbjct: 88 HINGSV-SGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTL-----DFP 141 Query: 336 QNLSSGCTVNSLEGLCLYANDITGPIPDLGRFLS-----LKVLKLGENHLNGTINKSLSH 390 +S G +NSLE L L AN I+G +G LS LK L + N ++G ++ +S Sbjct: 142 GKVSGGLKLNSLEVLDLSANSISG-ANVVGWVLSDGCGELKHLAISGNKISGDVD--VSR 198 Query: 391 LFKLETLSLDGNSFTGVISETFFSNMSNLQMLFLADNSLT------------LKL----S 434 LE L + N+F+ I F + S LQ L ++ N L+ LKL S Sbjct: 199 CVNLEFLDVSSNNFSTGI--PFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISS 256 Query: 435 HDWV------PAFQLKWLSLASCKMGPHFPNWLQTQ-NQLISLDISNIGISDTIPDWF-- 485 + +V P L++LSLA K P++L + L LD+S +P +F Sbjct: 257 NQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGS 316 Query: 486 ---------------WDLSIE-------LFFLNLSNNHISGKLPD-LSVLKSDDIVIDIS 522 +L ++ L L+LS N SG+LP+ L+ L + + +D+S Sbjct: 317 CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLS 376 Query: 523 SNNFDGPIPP----LPSNS-TFLNLSKNKFSG-LPDCWLNFNSLSILNLANNRFSGKIPD 576 SNNF GPI P P N+ L L N F+G +P N + L L+L+ N SG IP Sbjct: 377 SNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPS 436 Query: 577 SMG------------------------FLHNIQTLSLRNNRLNGELPSSLKNCSKLRVLD 612 S+G ++ ++TL L N L GE+PS L NC+ L + Sbjct: 437 SLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWIS 496 Query: 613 LRKNALFGEVPTCVGGSLQNLIILRLKSNNFHGNIPFQLCHLAFIQVLDLSLNNISGKIP 672 L N L GE+P + G L+NL IL+L +N+F GNIP +L + LDL+ N +G IP Sbjct: 497 LSNNRLTGEIPKWI-GRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIP 555 Query: 673 KCFSNFSMMIQEKSSNPIIGLANEILVVPGYIYYFRYLDNVLLTWKGSEHEYKSTL---- 728 S I ++N I G + G N LL ++G E + L Sbjct: 556 AAMFKQSGKI---AANFIAGKRYVYIKNDGMKKECHGAGN-LLEFQGIRSEQLNRLSTRN 611 Query: 729 --------------------GFVKYLDLSSNKLCEAIPEEITDLVGLTALNLSRNNLTGL 768 G + +LD+S N L IP+EI + L LNL N+++G Sbjct: 612 PCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGS 671 Query: 769 IPPKIGQLKSLDFLDLSRNHFSGNIPXXXXXXXXXXXXXXXYNSLSGKIPLGTQLQSFNA 828 IP ++G L+ L+ LDLS N G IP N+LSG IP Q ++F Sbjct: 672 IPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPP 731 Query: 829 SVYAGNLELCGLPLP 843 + + N LCG PLP Sbjct: 732 AKFLNNPGLCGYPLP 746
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query927
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 0.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-79
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-77
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-72
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-65
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-37
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-70
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-68
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-65
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-45
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-35
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-31
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-68
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-42
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-42
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-36
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-31
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-65
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-61
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-55
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-50
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-40
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-33
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-32
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-65
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-64
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-46
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-38
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-60
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-55
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-54
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-39
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-60
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-55
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-53
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-08
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-47
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-44
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-33
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-28
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-44
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-42
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-28
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-41
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-39
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-23
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-32
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-16
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-13
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-29
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-28
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-19
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-18
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-23
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-14
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-10
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-19
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-18
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 9e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 9e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  558 bits (1441), Expect = 0.0
 Identities = 213/833 (25%), Positives = 338/833 (40%), Gaps = 87/833 (10%)

Query: 33  TRCIDEEREALLTFKQSLVDEYGVLSSWGSEDGKRDCCKWRGVRCSNTTGHVKVLNLQTS 92
           ++ +  E   L++FK  L D+  +L  W S     + C + GV C +    V  ++L + 
Sbjct: 7   SQSLYREIHQLISFKDVLPDK-NLLPDWSSNK---NPCTFDGVTCRD--DKVTSIDLSSK 60

Query: 93  DHEFARRKFLKGKISPALLKLRGLRHLDLSKNDFGGSPVPEFIGSLSKLRYLNLSCGTPS 152
                        +S +LL L GL  L LS +   GS V  F    + L  L+LS  + S
Sbjct: 61  PLNVGF-----SAVSSSLLSLTGLESLFLSNSHINGS-VSGF-KCSASLTSLDLSRNSLS 113

Query: 153 SKIPHPFRDLSGFEYFNVENSNLFSVGSLERLSHLSSLRHLDLSCINLTKSSDWFQVVSQ 212
             +                        +L  L   S L+ L++S   L           +
Sbjct: 114 GPVT-----------------------TLTSLGSCSGLKFLNVSSNTLDFPGK-VSGGLK 149

Query: 213 LHSLKTLVLRSCYLPPINPSFIWLFNLSTSIETLDLSDNHLPSSSVYPWLFNLSRNILHL 272
           L+SL+ L L +  +   N     L +    ++ L +S N +        +     N+  L
Sbjct: 150 LNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGD---VDVSRCV-NLEFL 205

Query: 273 DLGFNHLQGSIPEAFQHMVSLRLLSLASNELEGGIPKFFGNMCSLNQLYLPRNKLSGQLS 332
           D+  N+    IP       +L+ L ++ N+L G   +       L  L +  N+  G + 
Sbjct: 206 DVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIP 264

Query: 333 ELIQNLSSGCTVNSLEGLCLYANDITGPIPD--LGRFLSLKVLKLGENHLNGTINKSLSH 390
                L S      L+ L L  N  TG IPD   G   +L  L L  NH  G +      
Sbjct: 265 P--LPLKS------LQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGS 316

Query: 391 LFKLETLSLDGNSFTGVISETFFSNMSNLQMLFLADNSLTLKLSHDWVPAFQLKWLSLAS 450
              LE+L+L  N+F+G +       M  L++L L+ N  +                    
Sbjct: 317 CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFS-------------------- 356

Query: 451 CKMGPHFPNWL-QTQNQLISLDISNIGISDTIPDWFWDLSIE-LFFLNLSNNHISGKLPD 508
              G   P  L      L++LD+S+   S  I           L  L L NN  +GK+P 
Sbjct: 357 ---GE-LPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPP 412

Query: 509 LSVLKSDDIVIDISSNNFDGPIPPLPSNST---FLNLSKNKFSG-LPDCWLNFNSLSILN 564
                S+ + + +S N   G IP    + +    L L  N   G +P   +   +L  L 
Sbjct: 413 TLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI 472

Query: 565 LANNRFSGKIPDSMGFLHNIQTLSLRNNRLNGELPSSLKNCSKLRVLDLRKNALFGEVPT 624
           L  N  +G+IP  +    N+  +SL NNRL GE+P  +     L +L L  N+  G +P 
Sbjct: 473 LDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPA 532

Query: 625 CVGGSLQNLIILRLKSNNFHGNIPFQLCHLAFIQVLDLSLNNISGKIPKCFSNFSMMIQE 684
            +G   ++LI L L +N F+G IP  +   +      ++ N I+GK      N  M  + 
Sbjct: 533 ELG-DCRSLIWLDLNTNLFNGTIPAAMFKQS----GKIAANFIAGKRYVYIKNDGMKKEC 587

Query: 685 KSSNPIIGLANEILVVPGYIYYFRYLDNVLLTWKGSEHEYKSTLGFVKYLDLSSNKLCEA 744
             +  ++            +      +     + G         G + +LD+S N L   
Sbjct: 588 HGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGY 647

Query: 745 IPEEITDLVGLTALNLSRNNLTGLIPPKIGQLKSLDFLDLSRNHFSGNIPSSLSLLSGLS 804
           IP+EI  +  L  LNL  N+++G IP ++G L+ L+ LDLS N   G IP ++S L+ L+
Sbjct: 648 IPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLT 707

Query: 805 VLDLSYNSLSGKIPLGTQLQSFNASVYAGNLELCGLPLPNKCADEESTPSPGR 857
            +DLS N+LSG IP   Q ++F  + +  N  LCG PLP          +  +
Sbjct: 708 EIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQ 760


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query927
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.82
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.53
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.53
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.49
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.45
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.43
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.42
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.41
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.4
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.35
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.28
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.23
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.21
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.14
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.11
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.81
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.81
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.81
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.61
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.28
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.27
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.21
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.18
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.9
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.67
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.58
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.77
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.64
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.51
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=5.9e-91  Score=848.50  Aligned_cols=707  Identities=30%  Similarity=0.444  Sum_probs=493.4

Q ss_pred             CCCHHHHHHHHHhhhcCcCCCCCcCCCCCCCCCCCCccccceeecCCCCCEEEEECCCCchhhhhccccccc---cCccc
Q 047797           34 RCIDEEREALLTFKQSLVDEYGVLSSWGSEDGKRDCCKWRGVRCSNTTGHVKVLNLQTSDHEFARRKFLKGK---ISPAL  110 (927)
Q Consensus        34 ~~~~~~~~~ll~~k~~~~~~~~~~~~W~~~~~~~~~c~w~gv~c~~~~~~v~~L~L~~~~~~~~~~~~l~g~---~~~~l  110 (927)
                      .+.++|++||++||+++.||. .+++|+   .+++||+|+||+|+  .++|++|+|++        ..+.|.   +|+++
T Consensus         8 ~~~~~~~~all~~k~~~~~~~-~l~~W~---~~~~~C~w~gv~C~--~~~v~~L~L~~--------~~l~g~~~~l~~~l   73 (768)
T 3rgz_A            8 QSLYREIHQLISFKDVLPDKN-LLPDWS---SNKNPCTFDGVTCR--DDKVTSIDLSS--------KPLNVGFSAVSSSL   73 (768)
T ss_dssp             CCHHHHHHHHHHHHTTCSCTT-SSTTCC---TTSCGGGSTTEEEE--TTEEEEEECTT--------SCCCEEHHHHHHHT
T ss_pred             cCCHHHHHHHHHHHhhCCCcc-cccCCC---CCCCCcCCcceEEC--CCcEEEEECCC--------CCcCCccCccChhH
Confidence            446889999999999999998 999997   47899999999997  68999999999        789998   99999


Q ss_pred             cCCCCCCeeeCCCCCCCCCCCCccccCCCCCCEEECCCCCCCCCCCc--cCCCCCCCcEEecCCCCccCCCCcccccCCC
Q 047797          111 LKLRGLRHLDLSKNDFGGSPVPEFIGSLSKLRYLNLSCGTPSSKIPH--PFRDLSGFEYFNVENSNLFSVGSLERLSHLS  188 (927)
Q Consensus       111 ~~l~~L~~L~Ls~n~~~~~~lp~~l~~l~~L~~L~Ls~n~~~~~~p~--~l~~l~~L~~L~Ls~~~~~~~~~~~~l~~l~  188 (927)
                      .++++|+.++++.+.+..  +|..++.+++|++|+|++|.+.+.+|.  .++++++|++|++++|.+........+.+++
T Consensus        74 ~~L~~L~~l~~~~~~~~~--l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~  151 (768)
T 3rgz_A           74 LSLTGLESLFLSNSHING--SVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLN  151 (768)
T ss_dssp             TTCTTCCEEECTTSCEEE--CCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCT
T ss_pred             hccCcccccCCcCCCcCC--CchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCC
Confidence            999999999999998754  678999999999999999999999998  9999999999999998875444334457889


Q ss_pred             CCcEEECCCccCCCCCchHHh---hcCCCCCCEEEcCCCCCCCCCCchhhccccccCccEEEcCCCCCCCCCcchhHhhc
Q 047797          189 SLRHLDLSCINLTKSSDWFQV---VSQLHSLKTLVLRSCYLPPINPSFIWLFNLSTSIETLDLSDNHLPSSSVYPWLFNL  265 (927)
Q Consensus       189 ~L~~L~Ls~n~l~~~~~~~~~---l~~l~~L~~L~L~~n~l~~~~~~~~~l~~~~~~L~~L~Ls~n~l~~~~~~~~l~~~  265 (927)
                      +|++|++++|.+++.  .+..   +.++++|++|++++|.+++..+    ...+ ++|++|++++|.+++ .+|. +.++
T Consensus       152 ~L~~L~Ls~n~l~~~--~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~----~~~l-~~L~~L~Ls~n~l~~-~~~~-l~~l  222 (768)
T 3rgz_A          152 SLEVLDLSANSISGA--NVVGWVLSDGCGELKHLAISGNKISGDVD----VSRC-VNLEFLDVSSNNFST-GIPF-LGDC  222 (768)
T ss_dssp             TCSEEECCSSCCEEE--THHHHHHTTCCTTCCEEECCSSEEESCCB----CTTC-TTCCEEECCSSCCCS-CCCB-CTTC
T ss_pred             CCCEEECCCCccCCc--CChhhhhhccCCCCCEEECCCCcccccCC----cccC-CcCCEEECcCCcCCC-CCcc-cccC
Confidence            999999999988763  2233   6778888888888887776554    2444 667777777776655 4444 4444


Q ss_pred             ccCccEEEccCCcCcCCcchhhhcCCCCCEEEccCCcCCCcCcccccCCCCCcEEeCCCCCCCCchhHHHhhccCCCcCC
Q 047797          266 SRNILHLDLGFNHLQGSIPEAFQHMVSLRLLSLASNELEGGIPKFFGNMCSLNQLYLPRNKLSGQLSELIQNLSSGCTVN  345 (927)
Q Consensus       266 ~~~L~~L~Ls~n~i~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~~~~~~  345 (927)
                      . +|++|++++|.+++.+|..++.+++|++|++++|++++.+|..  .+++|++|++++|.+++.+|..+...       
T Consensus       223 ~-~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~-------  292 (768)
T 3rgz_A          223 S-ALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGA-------  292 (768)
T ss_dssp             C-SCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTT-------
T ss_pred             C-CCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhh-------
Confidence            4 6666666666666666666666666666666666666555543  45555555555555554444433322       


Q ss_pred             CccEEEccCCCCcccCCCCCCCCCCCEEEccCCcCCCcchhhhhccCCCCEEecCCcccccccChhhhhcCCCCCEEEcc
Q 047797          346 SLEGLCLYANDITGPIPDLGRFLSLKVLKLGENHLNGTINKSLSHLFKLETLSLDGNSFTGVISETFFSNMSNLQMLFLA  425 (927)
Q Consensus       346 ~L~~L~L~~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~  425 (927)
                                           +++|++|++++|.+++.+|..++++++|++|++++|++++.+|...+..+++|++|+++
T Consensus       293 ---------------------~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls  351 (768)
T 3rgz_A          293 ---------------------CDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLS  351 (768)
T ss_dssp             ---------------------CTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECC
T ss_pred             ---------------------cCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCc
Confidence                                 24455555555555444444455555555555555555444444444455555555555


Q ss_pred             CCcceecccCCccccc-ccceeecccccCCCCCChhhhc--CccccEEEccCCccCCCccchHHhhccccceeecccccc
Q 047797          426 DNSLTLKLSHDWVPAF-QLKWLSLASCKMGPHFPNWLQT--QNQLISLDISNIGISDTIPDWFWDLSIELFFLNLSNNHI  502 (927)
Q Consensus       426 ~n~l~~~~~~~~~~~~-~L~~L~L~~~~~~~~~~~~l~~--~~~L~~L~Ls~n~l~~~~~~~~~~~~~~L~~L~Ls~n~l  502 (927)
                      +|++++..+..+..+. +|++|++++|.+.+..|..+..  +++|++|++++|.+++.+|..+... ++|++|++++|++
T Consensus       352 ~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l-~~L~~L~Ls~N~l  430 (768)
T 3rgz_A          352 FNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC-SELVSLHLSFNYL  430 (768)
T ss_dssp             SSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGC-TTCCEEECCSSEE
T ss_pred             CCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcC-CCCCEEECcCCcc
Confidence            5555444444444443 4555555555544444444443  4555555555555555555544332 3555555555555


Q ss_pred             cCCCCCccccCCCCcEEeccCCccCCCCCCC---CCCCceEeCcCCCCCC-CCcccccCCCCCEEEccCccccccCCCcc
Q 047797          503 SGKLPDLSVLKSDDIVIDISSNNFDGPIPPL---PSNSTFLNLSKNKFSG-LPDCWLNFNSLSILNLANNRFSGKIPDSM  578 (927)
Q Consensus       503 ~~~~~~~~~~~~~l~~l~l~~n~~~~~~~~~---~~~L~~L~L~~n~l~~-lp~~~~~l~~L~~L~Ls~n~l~~~~~~~~  578 (927)
                      ++.+|..+..+++|+.+++++|.+.+.+|..   +++|++|++++|++++ +|..+.++++|++|++++|++++.+|..+
T Consensus       431 ~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~  510 (768)
T 3rgz_A          431 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWI  510 (768)
T ss_dssp             ESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGG
T ss_pred             cCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHH
Confidence            5555555555555555555555554444432   3456666666666665 66666677777777777777777777777


Q ss_pred             cccCcccEEEcccccccccCCccccCCCCCCEEecCCCcCCCCCChhhhhcCccCcEEEccCc-----------------
Q 047797          579 GFLHNIQTLSLRNNRLNGELPSSLKNCSKLRVLDLRKNALFGEVPTCVGGSLQNLIILRLKSN-----------------  641 (927)
Q Consensus       579 ~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~~l~~L~~L~L~~n-----------------  641 (927)
                      +.+++|++|++++|++++.+|..+..+++|++|++++|+++|.+|..++ ....+..+++..+                 
T Consensus       511 ~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  589 (768)
T 3rgz_A          511 GRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMF-KQSGKIAANFIAGKRYVYIKNDGMKKECHG  589 (768)
T ss_dssp             GGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGG-TTTTCBCCSTTCSCEEEEEECCSCCTTCCS
T ss_pred             hcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHh-cccchhhhhccccccccccccccccccccc
Confidence            7777777777777777777777777777777777777777777776665 3444433333221                 


Q ss_pred             -----ccceecCccccCCCCCCEEEccccccccccchhhccccccccccCCCCccccccccccccccceeeeecceeEEe
Q 047797          642 -----NFHGNIPFQLCHLAFIQVLDLSLNNISGKIPKCFSNFSMMIQEKSSNPIIGLANEILVVPGYIYYFRYLDNVLLT  716 (927)
Q Consensus       642 -----~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  716 (927)
                           .+.+..+..+..++.++.++++.|.++|.+|..+                                         
T Consensus       590 ~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~-----------------------------------------  628 (768)
T 3rgz_A          590 AGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTF-----------------------------------------  628 (768)
T ss_dssp             SEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSC-----------------------------------------
T ss_pred             cccccccccccchhhhccccccccccccceecccCchhh-----------------------------------------
Confidence                 1122223333333344444444444444444433                                         


Q ss_pred             eecccccccccccceeEEEccCCcccccCccccccccCCCEEecccccccccCCccccCCCCCCeEeCCCCcCcccCCcc
Q 047797          717 WKGSEHEYKSTLGFVKYLDLSSNKLCEAIPEEITDLVGLTALNLSRNNLTGLIPPKIGQLKSLDFLDLSRNHFSGNIPSS  796 (927)
Q Consensus       717 ~~~~~~~~~~~l~~L~~LdLs~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~  796 (927)
                               ..++.|+.|||++|+++|.+|..|+++++|+.|+|++|+++|.+|+.++++++|++|||++|+++|.+|..
T Consensus       629 ---------~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~  699 (768)
T 3rgz_A          629 ---------DNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQA  699 (768)
T ss_dssp             ---------SSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGG
T ss_pred             ---------hccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChH
Confidence                     44556699999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCeEeCcCCcCcccCCCCCcCCCCcccccCCCCCCCCCCCCCCCCCC
Q 047797          797 LSLLSGLSVLDLSYNSLSGKIPLGTQLQSFNASVYAGNLELCGLPLPNKCADE  849 (927)
Q Consensus       797 l~~l~~L~~L~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~~~~~C~~~  849 (927)
                      ++.+++|++||+++|+++|.||..+++++|...+|.||+++||.|+. .|...
T Consensus       700 l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~  751 (768)
T 3rgz_A          700 MSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPS  751 (768)
T ss_dssp             GGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSC
T ss_pred             HhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCC
Confidence            99999999999999999999999999999999999999999999987 89543



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 927
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-21
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-11
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 8e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 9e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 92.1 bits (227), Expect = 8e-21
 Identities = 72/280 (25%), Positives = 105/280 (37%), Gaps = 7/280 (2%)

Query: 567 NNRFSGKIPDSMGFLHNIQTLSLRNNRLNG--ELPSSLKNCSKLRVLDLRKNALFGEVPT 624
           N  + G + D+    + +  L L    L     +PSSL N   L  L +           
Sbjct: 35  NRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIP 94

Query: 625 CVGGSLQNLIILRLKSNNFHGNIPFQLCHLAFIQVLDLSLNNISGKIPKCFSNFSMMIQE 684
                L  L  L +   N  G IP  L  +  +  LD S N +SG +P   S+   ++  
Sbjct: 95  PAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGI 154

Query: 685 K-SSNPIIGLANEILVVPGYIYYFRYLDNVLLTWKGSEHEYKSTLGFVKYLDLSSNKLCE 743
               N I G   +       ++    +    LT         +           S  + E
Sbjct: 155 TFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTG----KIPPTFANLNLAFVDLSRNMLE 210

Query: 744 AIPEEITDLVGLTALNLSRNNLTGLIPPKIGQLKSLDFLDLSRNHFSGNIPSSLSLLSGL 803
                +      T       N       K+G  K+L+ LDL  N   G +P  L+ L  L
Sbjct: 211 GDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFL 270

Query: 804 SVLDLSYNSLSGKIPLGTQLQSFNASVYAGNLELCGLPLP 843
             L++S+N+L G+IP G  LQ F+ S YA N  LCG PLP
Sbjct: 271 HSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP 310


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query927
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.75
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.41
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.38
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.28
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.15
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.28
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.16
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.45
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.35
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.55
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.39
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=1.4e-38  Score=342.57  Aligned_cols=294  Identities=26%  Similarity=0.415  Sum_probs=193.4

Q ss_pred             CCCHHHHHHHHHhhhcCcCCCCCcCCCCCCCCCCCCcc--ccceeecCCC--CCEEEEECCCCchhhhhcccccc--ccC
Q 047797           34 RCIDEEREALLTFKQSLVDEYGVLSSWGSEDGKRDCCK--WRGVRCSNTT--GHVKVLNLQTSDHEFARRKFLKG--KIS  107 (927)
Q Consensus        34 ~~~~~~~~~ll~~k~~~~~~~~~~~~W~~~~~~~~~c~--w~gv~c~~~~--~~v~~L~L~~~~~~~~~~~~l~g--~~~  107 (927)
                      .|.++|++||++||+++.||. .+++|.   .++|||.  |+||+|+..+  +||++|+|++        +.+.|  .+|
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~---~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~--------~~l~g~~~lp   69 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSG--------LNLPKPYPIP   69 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEEC--------CCCSSCEECC
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-cCCCCC---CCCCCCCCcCCCeEEeCCCCcEEEEEEECCC--------CCCCCCCCCC
Confidence            699999999999999999875 689997   4789995  9999998644  4899999998        67777  577


Q ss_pred             ccccCCCCCCeeeCCC-CCCCCCCCCccccCCCCCCEEECCCCCCCCCCCccCCCCCCCcEEecCCCCccCCCCcccccC
Q 047797          108 PALLKLRGLRHLDLSK-NDFGGSPVPEFIGSLSKLRYLNLSCGTPSSKIPHPFRDLSGFEYFNVENSNLFSVGSLERLSH  186 (927)
Q Consensus       108 ~~l~~l~~L~~L~Ls~-n~~~~~~lp~~l~~l~~L~~L~Ls~n~~~~~~p~~l~~l~~L~~L~Ls~~~~~~~~~~~~l~~  186 (927)
                      ++++++++|++|||++ |.+++. +|..++++++|++|+|++|++.+..|..+.++..|++++++.|..           
T Consensus        70 ~~l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~-----------  137 (313)
T d1ogqa_          70 SSLANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNAL-----------  137 (313)
T ss_dssp             GGGGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEE-----------
T ss_pred             hHHhcCccccccccccccccccc-cccccccccccchhhhccccccccccccccchhhhcccccccccc-----------
Confidence            8888888888888886 677775 888888888888888888877776665555555555555433322           


Q ss_pred             CCCCcEEECCCccCCCCCchHHhhcCCCCCCEEEcCCCCCCCCCCchhhccccccCccEEEcCCCCCCCCCcchhHhhcc
Q 047797          187 LSSLRHLDLSCINLTKSSDWFQVVSQLHSLKTLVLRSCYLPPINPSFIWLFNLSTSIETLDLSDNHLPSSSVYPWLFNLS  266 (927)
Q Consensus       187 l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~l~~~~~~L~~L~Ls~n~l~~~~~~~~l~~~~  266 (927)
                                                              .+..|  ..+.++ +.++++++++|.+.+ .+|..+..+.
T Consensus       138 ----------------------------------------~~~~p--~~l~~l-~~L~~l~l~~n~l~~-~ip~~~~~l~  173 (313)
T d1ogqa_         138 ----------------------------------------SGTLP--PSISSL-PNLVGITFDGNRISG-AIPDSYGSFS  173 (313)
T ss_dssp             ----------------------------------------ESCCC--GGGGGC-TTCCEEECCSSCCEE-ECCGGGGCCC
T ss_pred             ----------------------------------------cccCc--hhhccC-cccceeecccccccc-cccccccccc
Confidence                                                    11122  223333 444555555555444 4455444444


Q ss_pred             cCccEEEccCCcCcCCcchhhhcCCCCCEEEccCCcCCCcCcccccCCCCCcEEeCCCCCCCCchhHHHhhccCCCcCCC
Q 047797          267 RNILHLDLGFNHLQGSIPEAFQHMVSLRLLSLASNELEGGIPKFFGNMCSLNQLYLPRNKLSGQLSELIQNLSSGCTVNS  346 (927)
Q Consensus       267 ~~L~~L~Ls~n~i~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~~~~~~~  346 (927)
                      ..++.+++++|++++..|..+..+..+ .++++.+...+.+|..+..+++++.+++++|.+                   
T Consensus       174 ~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l-------------------  233 (313)
T d1ogqa_         174 KLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSL-------------------  233 (313)
T ss_dssp             TTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTSCCSEEECCSSEE-------------------
T ss_pred             ccccccccccccccccccccccccccc-ccccccccccccccccccccccccccccccccc-------------------
Confidence            233555666665555555555544333 455555555555555555555455554444444                   


Q ss_pred             ccEEEccCCCCcccCCCCCCCCCCCEEEccCCcCCCcchhhhhccCCCCEEecCCcccccccChhhhhcCCCCCEEEccC
Q 047797          347 LEGLCLYANDITGPIPDLGRFLSLKVLKLGENHLNGTINKSLSHLFKLETLSLDGNSFTGVISETFFSNMSNLQMLFLAD  426 (927)
Q Consensus       347 L~~L~L~~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~  426 (927)
                                 .+.++.++.+++|++|++++|+++|.+|..++++++|++|+|++|+++|.+|.  ++++++|+.+++++
T Consensus       234 -----------~~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~--~~~L~~L~~l~l~~  300 (313)
T d1ogqa_         234 -----------AFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ--GGNLQRFDVSAYAN  300 (313)
T ss_dssp             -----------CCBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC--STTGGGSCGGGTCS
T ss_pred             -----------cccccccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC--cccCCCCCHHHhCC
Confidence                       44444455556777777777777777777777777777777777777777764  45666666666766


Q ss_pred             Cc
Q 047797          427 NS  428 (927)
Q Consensus       427 n~  428 (927)
                      |+
T Consensus       301 N~  302 (313)
T d1ogqa_         301 NK  302 (313)
T ss_dssp             SS
T ss_pred             Cc
Confidence            65



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure