Citrus Sinensis ID: 047834
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 232 | ||||||
| 147838868 | 882 | hypothetical protein VITISV_011431 [Viti | 0.965 | 0.253 | 0.440 | 2e-47 | |
| 225442539 | 882 | PREDICTED: probable disease resistance p | 0.965 | 0.253 | 0.440 | 2e-47 | |
| 359482561 | 1639 | PREDICTED: probable disease resistance p | 0.965 | 0.136 | 0.432 | 3e-47 | |
| 297743174 | 1123 | unnamed protein product [Vitis vinifera] | 0.965 | 0.199 | 0.432 | 8e-47 | |
| 147782477 | 1377 | hypothetical protein VITISV_002420 [Viti | 0.965 | 0.162 | 0.444 | 2e-46 | |
| 359482559 | 883 | PREDICTED: disease resistance protein RP | 0.956 | 0.251 | 0.444 | 3e-46 | |
| 147859094 | 881 | hypothetical protein VITISV_018933 [Viti | 0.956 | 0.251 | 0.432 | 1e-44 | |
| 297743218 | 927 | unnamed protein product [Vitis vinifera] | 0.948 | 0.237 | 0.426 | 2e-43 | |
| 225442515 | 904 | PREDICTED: probable disease resistance p | 0.948 | 0.243 | 0.426 | 2e-43 | |
| 255574524 | 881 | Disease resistance protein RFL1, putativ | 0.926 | 0.244 | 0.418 | 2e-42 |
| >gi|147838868|emb|CAN70333.1| hypothetical protein VITISV_011431 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 194 bits (494), Expect = 2e-47, Method: Compositional matrix adjust.
Identities = 107/243 (44%), Positives = 149/243 (61%), Gaps = 19/243 (7%)
Query: 7 ASVLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFS 66
A ++ C + L LI IG AMAS R P EWE A+ LK+YPA+F GMGD +FP LKFS
Sbjct: 334 AKIVVEECKGLPLALIVIGRAMAS-RKTPQEWEQAIQVLKSYPAKFSGMGDQVFPILKFS 392
Query: 67 YDHLSSETHRKCFLFCALFLKNQLIRKDEHIDLWIGEGLLRDSHNIAVARLQGESIIDSL 126
YDHL ++T + CFL+C+LF ++ I ++ IDLWIGEG + +I AR QGE II SL
Sbjct: 393 YDHLDNDTTKSCFLYCSLFPEDHKIWIEDLIDLWIGEGFMDKFVDIYEARNQGEEIIRSL 452
Query: 127 IRVCLLE--------EMHDMLRDLALWIASQDKGNKILASKPENGKLIIDQQSVTWNKAV 178
CLLE +MHD++RD+ALW++ K + ++G+LI ++V W +A
Sbjct: 453 KLACLLEGGVSEHTCKMHDVIRDMALWLSCDYGEEKHKSFVLDHGQLIEAYETVKWKEAQ 512
Query: 179 RVSL----------SPPSCPRLLTLLVRYASMKGLPEWFFQSMPALRVLEWSRNGDLTKL 228
R+SL P L TL++R ++MK LP FFQ MP +RVL+ S N +L +L
Sbjct: 513 RISLWYSNINEGLSLSPCFLNLRTLILRNSNMKSLPIGFFQFMPVIRVLDLSYNANLVEL 572
Query: 229 PMQ 231
P++
Sbjct: 573 PLE 575
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225442539|ref|XP_002278938.1| PREDICTED: probable disease resistance protein At5g63020 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359482561|ref|XP_002277853.2| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297743174|emb|CBI36041.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147782477|emb|CAN75117.1| hypothetical protein VITISV_002420 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359482559|ref|XP_002277748.2| PREDICTED: disease resistance protein RPS5-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147859094|emb|CAN80410.1| hypothetical protein VITISV_018933 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297743218|emb|CBI36085.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225442515|ref|XP_002278439.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255574524|ref|XP_002528173.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223532385|gb|EEF34180.1| Disease resistance protein RFL1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 232 | ||||||
| TAIR|locus:2166320 | 888 | AT5G63020 [Arabidopsis thalian | 0.913 | 0.238 | 0.403 | 4.5e-31 | |
| TAIR|locus:2034765 | 884 | AT1G12290 [Arabidopsis thalian | 0.607 | 0.159 | 0.385 | 1.5e-30 | |
| TAIR|locus:2170902 | 862 | AT5G43740 [Arabidopsis thalian | 0.629 | 0.169 | 0.384 | 2.3e-28 | |
| TAIR|locus:2132741 | 892 | AT4G10780 [Arabidopsis thalian | 0.594 | 0.154 | 0.421 | 4e-28 | |
| TAIR|locus:2008510 | 967 | AT1G61190 "AT1G61190" [Arabido | 0.599 | 0.143 | 0.397 | 8.8e-28 | |
| TAIR|locus:2031356 | 884 | AT1G63360 [Arabidopsis thalian | 0.612 | 0.160 | 0.376 | 2.8e-27 | |
| TAIR|locus:2171589 | 948 | AT5G47260 [Arabidopsis thalian | 0.948 | 0.232 | 0.381 | 3.8e-27 | |
| TAIR|locus:2197739 | 762 | AT1G61300 [Arabidopsis thalian | 0.931 | 0.283 | 0.353 | 1.3e-25 | |
| TAIR|locus:2005517 | 909 | RPS2 "RESISTANT TO P. SYRINGAE | 0.814 | 0.207 | 0.350 | 4.8e-25 | |
| TAIR|locus:2008440 | 899 | AT1G61180 [Arabidopsis thalian | 0.931 | 0.240 | 0.348 | 7.7e-25 |
| TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 352 (129.0 bits), Expect = 4.5e-31, P = 4.5e-31
Identities = 94/233 (40%), Positives = 131/233 (56%)
Query: 14 CNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFSYDHLSSE 73
C + L L IG MA + EW +A++ L + AEF GM D I P LK+SYD+L SE
Sbjct: 346 CRGLPLALNVIGETMA-YKRTVQEWRSAIDVLTSSAAEFSGMEDEILPILKYSYDNLKSE 404
Query: 74 THRKCFLFCALFLKNQLIRKDEHIDLWIGEGLLRDSHNIAVARLQGESIIDSLIRVCLLE 133
+ CF +CALF ++ I K++ +D WIGEG + N A QG II L+R CLL
Sbjct: 405 QLKLCFQYCALFPEDHNIEKNDLVDYWIGEGFI--DRNKGKAENQGYEIIGILVRSCLLM 462
Query: 134 E-------MHDMLRDLALWIAS---QDKGNKI----LASK--PENGKLIIDQQ-SVTWNK 176
E MHD++R++ALWIAS + K N I L S+ PE K + ++ S+ +N
Sbjct: 463 EENQETVKMHDVVREMALWIASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFNN 522
Query: 177 AVRVSLSPPSCPRLLTLLVRYASMKGLPEWFFQSMPALRVLEWSRNGDLTKLP 229
+ +P S P+L+TLL+R + + FF+ MP L VL+ S N DL LP
Sbjct: 523 IESIRDAPES-PQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLP 574
|
|
| TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170902 AT5G43740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2031356 AT1G63360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00034346001 | SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (882 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 232 | |||
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 1e-16 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
Score = 76.2 bits (188), Expect = 1e-16
Identities = 34/97 (35%), Positives = 52/97 (53%), Gaps = 3/97 (3%)
Query: 14 CNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFSYDHLSSE 73
C + L L +G +A ++ EWE+ + +L N A G+ + + L SYD+L
Sbjct: 191 CKGLPLALKVLGGLLAF-KSTVQEWEHVLEQLNNELAGRDGL-NEVLSILSLSYDNLPMH 248
Query: 74 THRKCFLFCALFLKNQLIRKDEHIDLWIGEGLLRDSH 110
R CFL+ ALF ++ IRK++ I LWI EG + S
Sbjct: 249 LKR-CFLYLALFPEDYNIRKEQLIKLWIAEGFVIPSD 284
|
Length = 285 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 100.0 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.95 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 99.79 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.67 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.15 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.93 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 97.16 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 97.11 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 97.08 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 97.02 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 96.97 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 96.95 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 96.84 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 96.57 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.56 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 96.4 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 96.28 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.27 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 96.25 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 96.17 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 95.77 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 95.77 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 95.69 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 95.64 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 95.53 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 95.53 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 95.44 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 95.39 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 94.63 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 94.52 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 94.52 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 94.46 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 94.01 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 93.62 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 93.57 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 93.49 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 92.95 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 92.87 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 91.78 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 90.84 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 90.69 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 90.64 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 90.53 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 89.55 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 89.49 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 89.4 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 89.22 | |
| smart00364 | 26 | LRR_BAC Leucine-rich repeats, bacterial type. | 89.11 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 88.93 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 88.69 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 88.65 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 87.27 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 87.26 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 86.85 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 84.81 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 84.3 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 84.21 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 83.99 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 83.77 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 83.1 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 82.47 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 82.03 |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.5e-46 Score=346.99 Aligned_cols=226 Identities=34% Similarity=0.536 Sum_probs=200.3
Q ss_pred hhHHHHHHHHhcCCchHHHHHHHHHhcCCCCChhHHHHHHHHhhcC-CCCCCCCCcchhhHHHHhHhcCCchhHHHHHHH
Q 047834 3 QSYSASVLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELKNY-PAEFPGMGDLIFPCLKFSYDHLSSETHRKCFLF 81 (232)
Q Consensus 3 ~~~i~~~iv~~c~GlPLAl~~~g~~L~~~~~~~~~w~~~l~~L~~~-~~~~~~~~~~i~~~l~~sy~~L~~~~~k~cfl~ 81 (232)
+.++|++|+++|+|+|||+.++|+.|+. +++..+|+++.+.+.+. ..+.+++.+.++++|++||+.||++ +|.||+|
T Consensus 341 i~~lak~v~~kC~GLPLAl~viG~~ma~-K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~-lK~CFLy 418 (889)
T KOG4658|consen 341 IEELAKEVAEKCGGLPLALNVLGGLLAC-KKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEE-LKSCFLY 418 (889)
T ss_pred HHHHHHHHHHHhCChHHHHHHHHHHhcC-CCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHH-HHHHHHh
Confidence 4789999999999999999999999999 78889999999999887 5556667778999999999999977 8999999
Q ss_pred hhhcCCCccccHHHHHHHHHHcCCCCCCcchHHHHHHHHHHHHHHHHcccchh-----------hHHHHHHHHHHHhccc
Q 047834 82 CALFLKNQLIRKDEHIDLWIGEGLLRDSHNIAVARLQGESIIDSLIRVCLLEE-----------MHDMLRDLALWIASQD 150 (232)
Q Consensus 82 ~a~fp~~~~~~~~~li~~w~a~g~~~~~~~~~~~~~~~~~~l~~Lv~~~ll~~-----------mhdli~~~~~~i~~~e 150 (232)
||+||+||.|+++.|+..|+|+||+.+..+...++++|+.|+++||+++|+.. |||+||+||.+++.+.
T Consensus 419 calFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~ 498 (889)
T KOG4658|consen 419 CALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDF 498 (889)
T ss_pred hccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccc
Confidence 99999999999999999999999999977778899999999999999999975 9999999999999976
Q ss_pred cCCccceecCCCCceeeccccccccccceeEec-----------------------------------CCCCCCccEEEe
Q 047834 151 KGNKILASKPENGKLIIDQQSVTWNKAVRVSLS-----------------------------------PPSCPRLLTLLV 195 (232)
Q Consensus 151 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lsl~-----------------------------------~~~l~~Lr~L~l 195 (232)
+...+...+..+......++...|..+|+++++ +..++.||+|||
T Consensus 499 ~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDL 578 (889)
T KOG4658|consen 499 GKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDL 578 (889)
T ss_pred cccccceEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcceEEEEC
Confidence 654444555555555557788888888888887 234789999999
Q ss_pred ccC-CCCCCChHhhcCCCCccEEEccCCCCCCCCCCCC
Q 047834 196 RYA-SMKGLPEWFFQSMPALRVLEWSRNGDLTKLPMQK 232 (232)
Q Consensus 196 ~~~-~l~~lp~~~i~~L~~Lr~LdL~~~~~l~~LP~si 232 (232)
++| .+.+||++ |++|.+||||||++| .++.||.+|
T Consensus 579 s~~~~l~~LP~~-I~~Li~LryL~L~~t-~I~~LP~~l 614 (889)
T KOG4658|consen 579 SGNSSLSKLPSS-IGELVHLRYLDLSDT-GISHLPSGL 614 (889)
T ss_pred CCCCccCcCChH-HhhhhhhhcccccCC-CccccchHH
Confidence 988 88999999 999999999999999 999999875
|
|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00364 LRR_BAC Leucine-rich repeats, bacterial type | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 232 | |||
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 1e-17 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 2e-17 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-12 |
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
Score = 80.4 bits (198), Expect = 1e-17
Identities = 14/147 (9%), Positives = 35/147 (23%), Gaps = 21/147 (14%)
Query: 19 LTLITIGSAMASIRNNPAEWENAVNELKNYPA-----EFPGMGDLIFPCLKFSYDHLSSE 73
TL+ + + N+L++ P + L+ + LS E
Sbjct: 331 ATLMMFFKSCEPKTFE--KMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDE 388
Query: 74 THRKCFLFCALFLKNQLIRKDEHIDLWIGEGLLRDSHNIAVARLQGESIIDSLIRVCLLE 133
R F + I + + + + + + L + L
Sbjct: 389 -DRSALAFAVVMPPGVDIPVKLWSCVIPVDICSNEEEQLDD---EVADRLKRLSKRGALL 444
Query: 134 E----------MHDMLRDLALWIASQD 150
+ ++ +
Sbjct: 445 SGKRMPVLTFKIDHIIHMFLKHVVDAQ 471
|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 99.87 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.77 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 99.65 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 99.65 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.04 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.94 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.82 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.8 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.77 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.72 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.72 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.71 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.71 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.7 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.7 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.68 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.68 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.6 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.59 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.59 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.58 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 97.57 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.56 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.54 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.54 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.53 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.53 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 97.53 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.53 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.52 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.52 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.52 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.5 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.5 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.48 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.46 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.44 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.44 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.44 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.44 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.4 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.39 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.37 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.37 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.36 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.34 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.24 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.24 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.24 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.23 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.21 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.2 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.19 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.19 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.18 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 97.17 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.17 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.16 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.16 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.15 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.15 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.13 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.13 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.12 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.11 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.11 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.1 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.1 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.04 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.02 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.02 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.02 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.0 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 96.99 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 96.96 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 96.96 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 96.96 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 96.96 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.95 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 96.94 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 96.93 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 96.91 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 96.91 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 96.89 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 96.89 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 96.88 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 96.87 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 96.87 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 96.82 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 96.76 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 96.76 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 96.74 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 96.74 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 96.74 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 96.73 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.73 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 96.7 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 96.64 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 96.64 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 96.63 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 96.61 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 96.61 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 96.61 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 96.59 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 96.58 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 96.57 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 96.52 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 96.52 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 96.52 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 96.49 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 96.49 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 96.43 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 96.4 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 96.38 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 96.36 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 96.34 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 96.33 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 96.29 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 96.28 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.28 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 96.24 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 96.22 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.21 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 96.18 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.11 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 96.1 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 96.08 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.07 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 95.91 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 95.9 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 95.84 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 95.74 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 95.51 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 94.81 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 94.53 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 94.31 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 94.17 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 94.06 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 93.73 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 93.55 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 93.35 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 91.97 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 91.5 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 91.47 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 90.79 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 90.58 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 90.39 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 90.37 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 89.3 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 89.3 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 87.07 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 86.75 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 86.28 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 85.97 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 85.65 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 84.3 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 83.33 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 82.4 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 81.17 |
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
Probab=99.87 E-value=2.2e-23 Score=187.99 Aligned_cols=136 Identities=11% Similarity=0.057 Sum_probs=104.2
Q ss_pred hhHHHHHHHHhcCCchHHHHHHHHHhcCCCCChhHHHHHHHHhhcCCCCCCCCCcchhhHHHHhHhcCCchhHHHHHH--
Q 047834 3 QSYSASVLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFSYDHLSSETHRKCFL-- 80 (232)
Q Consensus 3 ~~~i~~~iv~~c~GlPLAl~~~g~~L~~~~~~~~~w~~~l~~L~~~~~~~~~~~~~i~~~l~~sy~~L~~~~~k~cfl-- 80 (232)
+.+++++|+++|+|+||||+++|+.|+. ++ +.|. +.+.+..+... ...+.++|.+||++||++ +|.||+
T Consensus 315 ~~~~~~~I~~~c~GlPLAl~~~g~~l~~--~~-w~~~---~~l~~~l~~~~--~~~i~~~l~~Sy~~L~~~-lk~~f~~L 385 (549)
T 2a5y_B 315 EEDVLNKTIELSSGNPATLMMFFKSCEP--KT-FEKM---AQLNNKLESRG--LVGVECITPYSYKSLAMA-LQRCVEVL 385 (549)
T ss_dssp HHHHHHHHHHHHTTCHHHHHHHHTTCCS--SS-HHHH---HHHHHHHHHHC--SSTTCCCSSSSSSSHHHH-HHHHHHTS
T ss_pred HHHHHHHHHHHhCCChHHHHHHHHHhcc--ch-HHHH---HHhHHHhhccc--HHHHHHHHhcccccccHH-HHHHHhcc
Confidence 4568999999999999999999999987 43 3333 33333222111 225888999999999999 799999
Q ss_pred ---------HhhhcCCCccccHHHHHHHHHHc--CCCCCCcchHHHHHHHHHHHHHHHHcccchh----------hHHHH
Q 047834 81 ---------FCALFLKNQLIRKDEHIDLWIGE--GLLRDSHNIAVARLQGESIIDSLIRVCLLEE----------MHDML 139 (232)
Q Consensus 81 ---------~~a~fp~~~~~~~~~li~~w~a~--g~~~~~~~~~~~~~~~~~~l~~Lv~~~ll~~----------mhdli 139 (232)
|||+||+++.|+ +++|+|+ ||+.........++.++ +|++|+++||++. |||+|
T Consensus 386 s~~er~l~~~ls~fp~~~~i~----i~~w~a~~~G~i~~~~~~~~~~~~~~-~l~~L~~rsLl~~~~~~~~~~~~mHdlv 460 (549)
T 2a5y_B 386 SDEDRSALAFAVVMPPGVDIP----VKLWSCVIPVDICSNEEEQLDDEVAD-RLKRLSKRGALLSGKRMPVLTFKIDHII 460 (549)
T ss_dssp CHHHHHHTTGGGSSCTTCCEE----HHHHHHHSCC-------CCCTHHHHH-HHHHTTTBSSCSEEECSSSCEEECCHHH
T ss_pred chhhhhHhhheeeeCCCCeee----eeeeeeeccceeccCCCCCCHHHHHH-HHHHHHHcCCeeEecCCCceEEEeChHH
Confidence 999999999999 8999999 99987442344567777 9999999999974 99999
Q ss_pred HHHHHHHhccccC
Q 047834 140 RDLALWIASQDKG 152 (232)
Q Consensus 140 ~~~~~~i~~~e~~ 152 (232)
|++|+.++.+++.
T Consensus 461 ~~~a~~~~~~~~~ 473 (549)
T 2a5y_B 461 HMFLKHVVDAQTI 473 (549)
T ss_dssp HHHHHTTSCTHHH
T ss_pred HHHHHHHHHHHHH
Confidence 9999998877653
|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 99.37 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.92 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.89 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.83 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.61 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.59 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.56 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.56 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.55 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.49 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.25 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.22 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.19 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.18 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.17 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.17 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.16 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.1 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 96.98 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 96.89 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.78 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 96.68 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.58 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 96.52 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 96.45 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 96.44 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 96.39 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 96.24 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.14 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 96.0 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 95.62 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 94.92 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 94.07 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 93.45 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 91.04 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 87.88 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 84.18 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 84.02 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.37 E-value=2.6e-14 Score=116.14 Aligned_cols=71 Identities=11% Similarity=0.042 Sum_probs=62.8
Q ss_pred hhHHHHHHHHhcCCchHHHHHHHHHhcCCCCChhHHHHHHHHhhcCCCCCCCCCcchhhHHHHhHhcCCchhHHHHHHHh
Q 047834 3 QSYSASVLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFSYDHLSSETHRKCFLFC 82 (232)
Q Consensus 3 ~~~i~~~iv~~c~GlPLAl~~~g~~L~~~~~~~~~w~~~l~~L~~~~~~~~~~~~~i~~~l~~sy~~L~~~~~k~cfl~~ 82 (232)
..+++++|+++|+|+||||+++|+.|+. ++.+.|.+..++|.+.... ++..++.+||++||++ +|.||.++
T Consensus 207 ~~~~~~~iv~~c~GlPLAl~~ig~~l~~--k~~~~~~~~~~~L~~~~~~------~v~~il~~sY~~L~~~-lk~c~~~l 277 (277)
T d2a5yb3 207 EEDVLNKTIELSSGNPATLMMFFKSCEP--KTFEKMAQLNNKLESRGLV------GVECITPYSYKSLAMA-LQRCVEVL 277 (277)
T ss_dssp HHHHHHHHHHHHTTCHHHHHHHHTTCCS--SSHHHHHHHHHHHHHHCSS------TTCCCSSSSSSSHHHH-HHHHHHTS
T ss_pred hHHHHHHHHHHhCCCHHHHHHHHHHhcc--CCHHHHHHHHHHHhcCcHH------HHHHHHHHHHhcccHH-HHHHHHhC
Confidence 3568899999999999999999999988 8999999999999764333 6888999999999999 89999763
|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|