Citrus Sinensis ID: 047834


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
CSQSYSASVLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFSYDHLSSETHRKCFLFCALFLKNQLIRKDEHIDLWIGEGLLRDSHNIAVARLQGESIIDSLIRVCLLEEMHDMLRDLALWIASQDKGNKILASKPENGKLIIDQQSVTWNKAVRVSLSPPSCPRLLTLLVRYASMKGLPEWFFQSMPALRVLEWSRNGDLTKLPMQK
cccHHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEccEEEEccccEEEcccccccccccEEEEcccccccccHHHHcccccccEEEcccccccccccccc
ccHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcHHHcccccccHHHHHHcccccccHHHHHHHHHHHEccccccEEcHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccEEEEEEEEcccEEEEcccccccccEEEEEEcccccccccHHHHHHccEEEEEEcccccccccccccc
CSQSYSASVLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELknypaefpgmgdlifpclkfsydhlssetHRKCFLFCALFLKNQlirkdehidlwigegllrdsHNIAVARLQGESIIDSLIRVCLLEEMHDMLRDLALWIASQDKGNkilaskpengkliidQQSVTWNKAvrvslsppscprLLTLLVRYASMkglpewffqsmpalrvlewsrngdltklpmqk
CSQSYSASVLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFSYDHLSSETHRKCFLFCALFLKNQLIRKDEHIDLWIGEGLLRDSHNIAVARLQGESIIDSLIRVCLLEEMHDMLRDLALWIASQDKGNKILASKPENGKLIIDQQSVTWNKAVrvslsppscprLLTLLVRYASMKGLPEWFFQSMPALRVLEWsrngdltklpmqk
CSQSYSASVLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFSYDHLSSETHRKCFLFCALFLKNQLIRKDEHIDLWIGEGLLRDSHNIAVARLQGESIIDSLIRVCLLEEMHDMLRDLALWIASQDKGNKILASKPENGKLIIDQQSVTWNKAVRVSLSPPSCPRLLTLLVRYASMKGLPEWFFQSMPALRVLEWSRNGDLTKLPMQK
******ASVLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFSYDHLSSETHRKCFLFCALFLKNQLIRKDEHIDLWIGEGLLRDSHNIAVARLQGESIIDSLIRVCLLEEMHDMLRDLALWIASQDKGNKILASKPENGKLIIDQQSVTWNKAVRVSLSPPSCPRLLTLLVRYASMKGLPEWFFQSMPALRVLEWSR***********
***SYSASVLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELKN******GM*DLIFPCLKFSYDHLSSETHRKCFLFCALFLKNQLIRKDEHIDLWIGEGLLRDSHNIAVARLQGESIIDSLIRVCLLEEMHDMLRDLALWIASQDKGNKILASKPENGKLIIDQQSVTWNKAVRVSLSPPSCPRLLTLLVRYASMKGLPEWFFQSMPALRVLEWSRNGDLTKLPM**
********VLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFSYDHLSSETHRKCFLFCALFLKNQLIRKDEHIDLWIGEGLLRDSHNIAVARLQGESIIDSLIRVCLLEEMHDMLRDLALWIASQDKGNKILASKPENGKLIIDQQSVTWNKAVRVSLSPPSCPRLLTLLVRYASMKGLPEWFFQSMPALRVLEWSRNGDLTKLPMQK
CSQSYSASVLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFSYDHLSSETHRKCFLFCALFLKNQLIRKDEHIDLWIGEGLLRDSHNIAVARLQGESIIDSLIRVCLLEEMHDMLRDLALWIASQDKGNKILASKPENGKLIIDQQSVTWNKAVRVSLSPPSCPRLLTLLVRYASMKGLPEWFFQSMPALRVLEWSRNGDLTKL****
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CSQSYSASVLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFSYDHLSSETHRKCFLFCALFLKNQLIRKDEHIDLWIGEGLLRDSHNIAVARLQGESIIDSLIRVCLLEEMHDMLRDLALWIASQDKGNKILASKPENGKLIIDQQSVTWNKAVRVSLSPPSCPRLLTLLVRYASMKGLPEWFFQSMPALRVLEWSRNGDLTKLPMQK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query232 2.2.26 [Sep-21-2011]
Q8RXS5 888 Probable disease resistan yes no 0.935 0.244 0.388 1e-33
Q42484 909 Disease resistance protei no no 0.943 0.240 0.358 2e-31
P60838 894 Probable disease resistan no no 0.926 0.240 0.382 7e-30
Q9C8T9 898 Putative disease resistan no no 0.948 0.244 0.355 3e-29
Q9FG91 848 Probable disease resistan no no 0.948 0.259 0.359 2e-28
P60839 884 Probable disease resistan no no 0.939 0.246 0.35 2e-28
Q9SI85 893 Probable disease resistan no no 0.961 0.249 0.352 4e-28
O82484 892 Putative disease resistan no no 0.935 0.243 0.358 5e-28
O64790 762 Probable disease resistan no no 0.922 0.280 0.350 5e-28
Q9LVT3 948 Probable disease resistan no no 0.948 0.232 0.381 9e-28
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function desciption
 Score =  143 bits (360), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 129/242 (53%), Gaps = 25/242 (10%)

Query: 7   ASVLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFS 66
           A  +   C  + L L  IG  MA  R    EW +A++ L +  AEF GM D I P LK+S
Sbjct: 339 ARTVAKKCRGLPLALNVIGETMAYKRT-VQEWRSAIDVLTSSAAEFSGMEDEILPILKYS 397

Query: 67  YDHLSSETHRKCFLFCALFLKNQLIRKDEHIDLWIGEGLLRDSHNIAVARLQGESIIDSL 126
           YD+L SE  + CF +CALF ++  I K++ +D WIGEG +    N   A  QG  II  L
Sbjct: 398 YDNLKSEQLKLCFQYCALFPEDHNIEKNDLVDYWIGEGFI--DRNKGKAENQGYEIIGIL 455

Query: 127 IRVCLLEE-------MHDMLRDLALWIAS---QDKGNKILASKPENGKLIIDQQSVTWNK 176
           +R CLL E       MHD++R++ALWIAS   + K N I+ +  ++  +    +   W  
Sbjct: 456 VRSCLLMEENQETVKMHDVVREMALWIASDFGKQKENFIVQAGLQSRNI---PEIEKWKV 512

Query: 177 AVRVSL---------SPPSCPRLLTLLVRYASMKGLPEWFFQSMPALRVLEWSRNGDLTK 227
           A RVSL           P  P+L+TLL+R   +  +   FF+ MP L VL+ S N DL  
Sbjct: 513 ARRVSLMFNNIESIRDAPESPQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRH 572

Query: 228 LP 229
           LP
Sbjct: 573 LP 574




Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG91|DRL32_ARATH Probable disease resistance protein At5g43730 OS=Arabidopsis thaliana GN=At5g43730 PE=2 SV=1 Back     alignment and function description
>sp|P60839|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|O64790|DRL17_ARATH Probable disease resistance protein At1g61300 OS=Arabidopsis thaliana GN=At1g61300 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVT3|DRL38_ARATH Probable disease resistance protein At5g47260 OS=Arabidopsis thaliana GN=At5g47260 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
147838868 882 hypothetical protein VITISV_011431 [Viti 0.965 0.253 0.440 2e-47
225442539 882 PREDICTED: probable disease resistance p 0.965 0.253 0.440 2e-47
359482561 1639 PREDICTED: probable disease resistance p 0.965 0.136 0.432 3e-47
297743174 1123 unnamed protein product [Vitis vinifera] 0.965 0.199 0.432 8e-47
147782477 1377 hypothetical protein VITISV_002420 [Viti 0.965 0.162 0.444 2e-46
359482559 883 PREDICTED: disease resistance protein RP 0.956 0.251 0.444 3e-46
147859094 881 hypothetical protein VITISV_018933 [Viti 0.956 0.251 0.432 1e-44
297743218 927 unnamed protein product [Vitis vinifera] 0.948 0.237 0.426 2e-43
225442515 904 PREDICTED: probable disease resistance p 0.948 0.243 0.426 2e-43
255574524 881 Disease resistance protein RFL1, putativ 0.926 0.244 0.418 2e-42
>gi|147838868|emb|CAN70333.1| hypothetical protein VITISV_011431 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  194 bits (494), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 107/243 (44%), Positives = 149/243 (61%), Gaps = 19/243 (7%)

Query: 7   ASVLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFS 66
           A ++   C  + L LI IG AMAS R  P EWE A+  LK+YPA+F GMGD +FP LKFS
Sbjct: 334 AKIVVEECKGLPLALIVIGRAMAS-RKTPQEWEQAIQVLKSYPAKFSGMGDQVFPILKFS 392

Query: 67  YDHLSSETHRKCFLFCALFLKNQLIRKDEHIDLWIGEGLLRDSHNIAVARLQGESIIDSL 126
           YDHL ++T + CFL+C+LF ++  I  ++ IDLWIGEG +    +I  AR QGE II SL
Sbjct: 393 YDHLDNDTTKSCFLYCSLFPEDHKIWIEDLIDLWIGEGFMDKFVDIYEARNQGEEIIRSL 452

Query: 127 IRVCLLE--------EMHDMLRDLALWIASQDKGNKILASKPENGKLIIDQQSVTWNKAV 178
              CLLE        +MHD++RD+ALW++      K  +   ++G+LI   ++V W +A 
Sbjct: 453 KLACLLEGGVSEHTCKMHDVIRDMALWLSCDYGEEKHKSFVLDHGQLIEAYETVKWKEAQ 512

Query: 179 RVSL----------SPPSCPRLLTLLVRYASMKGLPEWFFQSMPALRVLEWSRNGDLTKL 228
           R+SL            P    L TL++R ++MK LP  FFQ MP +RVL+ S N +L +L
Sbjct: 513 RISLWYSNINEGLSLSPCFLNLRTLILRNSNMKSLPIGFFQFMPVIRVLDLSYNANLVEL 572

Query: 229 PMQ 231
           P++
Sbjct: 573 PLE 575




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225442539|ref|XP_002278938.1| PREDICTED: probable disease resistance protein At5g63020 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482561|ref|XP_002277853.2| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743174|emb|CBI36041.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147782477|emb|CAN75117.1| hypothetical protein VITISV_002420 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482559|ref|XP_002277748.2| PREDICTED: disease resistance protein RPS5-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147859094|emb|CAN80410.1| hypothetical protein VITISV_018933 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743218|emb|CBI36085.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442515|ref|XP_002278439.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255574524|ref|XP_002528173.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223532385|gb|EEF34180.1| Disease resistance protein RFL1, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
TAIR|locus:2166320 888 AT5G63020 [Arabidopsis thalian 0.913 0.238 0.403 4.5e-31
TAIR|locus:2034765 884 AT1G12290 [Arabidopsis thalian 0.607 0.159 0.385 1.5e-30
TAIR|locus:2170902 862 AT5G43740 [Arabidopsis thalian 0.629 0.169 0.384 2.3e-28
TAIR|locus:2132741 892 AT4G10780 [Arabidopsis thalian 0.594 0.154 0.421 4e-28
TAIR|locus:2008510 967 AT1G61190 "AT1G61190" [Arabido 0.599 0.143 0.397 8.8e-28
TAIR|locus:2031356 884 AT1G63360 [Arabidopsis thalian 0.612 0.160 0.376 2.8e-27
TAIR|locus:2171589 948 AT5G47260 [Arabidopsis thalian 0.948 0.232 0.381 3.8e-27
TAIR|locus:2197739 762 AT1G61300 [Arabidopsis thalian 0.931 0.283 0.353 1.3e-25
TAIR|locus:2005517 909 RPS2 "RESISTANT TO P. SYRINGAE 0.814 0.207 0.350 4.8e-25
TAIR|locus:2008440 899 AT1G61180 [Arabidopsis thalian 0.931 0.240 0.348 7.7e-25
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 352 (129.0 bits), Expect = 4.5e-31, P = 4.5e-31
 Identities = 94/233 (40%), Positives = 131/233 (56%)

Query:    14 CNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFSYDHLSSE 73
             C  + L L  IG  MA  +    EW +A++ L +  AEF GM D I P LK+SYD+L SE
Sbjct:   346 CRGLPLALNVIGETMA-YKRTVQEWRSAIDVLTSSAAEFSGMEDEILPILKYSYDNLKSE 404

Query:    74 THRKCFLFCALFLKNQLIRKDEHIDLWIGEGLLRDSHNIAVARLQGESIIDSLIRVCLLE 133
               + CF +CALF ++  I K++ +D WIGEG +    N   A  QG  II  L+R CLL 
Sbjct:   405 QLKLCFQYCALFPEDHNIEKNDLVDYWIGEGFI--DRNKGKAENQGYEIIGILVRSCLLM 462

Query:   134 E-------MHDMLRDLALWIAS---QDKGNKI----LASK--PENGKLIIDQQ-SVTWNK 176
             E       MHD++R++ALWIAS   + K N I    L S+  PE  K  + ++ S+ +N 
Sbjct:   463 EENQETVKMHDVVREMALWIASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFNN 522

Query:   177 AVRVSLSPPSCPRLLTLLVRYASMKGLPEWFFQSMPALRVLEWSRNGDLTKLP 229
                +  +P S P+L+TLL+R   +  +   FF+ MP L VL+ S N DL  LP
Sbjct:   523 IESIRDAPES-PQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLP 574




GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170902 AT5G43740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031356 AT1G63360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00034346001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (882 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 1e-16
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score = 76.2 bits (188), Expect = 1e-16
 Identities = 34/97 (35%), Positives = 52/97 (53%), Gaps = 3/97 (3%)

Query: 14  CNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFSYDHLSSE 73
           C  + L L  +G  +A  ++   EWE+ + +L N  A   G+ + +   L  SYD+L   
Sbjct: 191 CKGLPLALKVLGGLLAF-KSTVQEWEHVLEQLNNELAGRDGL-NEVLSILSLSYDNLPMH 248

Query: 74  THRKCFLFCALFLKNQLIRKDEHIDLWIGEGLLRDSH 110
             R CFL+ ALF ++  IRK++ I LWI EG +  S 
Sbjct: 249 LKR-CFLYLALFPEDYNIRKEQLIKLWIAEGFVIPSD 284


Length = 285

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 232
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.95
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.79
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.67
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.15
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.93
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.16
KOG0472 565 consensus Leucine-rich repeat protein [Function un 97.11
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 97.08
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.02
KOG0617 264 consensus Ras suppressor protein (contains leucine 96.97
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 96.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 96.84
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 96.57
PLN03150 623 hypothetical protein; Provisional 96.56
PLN03210 1153 Resistant to P. syringae 6; Provisional 96.4
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.28
PLN03150 623 hypothetical protein; Provisional 96.27
KOG0472565 consensus Leucine-rich repeat protein [Function un 96.25
KOG0617264 consensus Ras suppressor protein (contains leucine 96.17
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 95.77
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 95.77
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 95.69
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 95.64
smart0037026 LRR Leucine-rich repeats, outliers. 95.53
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.53
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 95.44
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 95.39
PRK04841 903 transcriptional regulator MalT; Provisional 94.63
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.52
smart0037026 LRR Leucine-rich repeats, outliers. 94.52
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 94.46
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 94.01
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 93.62
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 93.57
PRK15386 426 type III secretion protein GogB; Provisional 93.49
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 92.95
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 92.87
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 91.78
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 90.84
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 90.69
PRK15386 426 type III secretion protein GogB; Provisional 90.64
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 90.53
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 89.55
KOG1259490 consensus Nischarin, modulator of integrin alpha5 89.49
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 89.4
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 89.22
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 89.11
KOG4237 498 consensus Extracellular matrix protein slit, conta 88.93
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 88.69
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 88.65
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 87.27
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 87.26
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 86.85
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 84.81
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 84.3
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 84.21
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 83.99
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 83.77
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 83.1
KOG3864221 consensus Uncharacterized conserved protein [Funct 82.47
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 82.03
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=5.5e-46  Score=346.99  Aligned_cols=226  Identities=34%  Similarity=0.536  Sum_probs=200.3

Q ss_pred             hhHHHHHHHHhcCCchHHHHHHHHHhcCCCCChhHHHHHHHHhhcC-CCCCCCCCcchhhHHHHhHhcCCchhHHHHHHH
Q 047834            3 QSYSASVLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELKNY-PAEFPGMGDLIFPCLKFSYDHLSSETHRKCFLF   81 (232)
Q Consensus         3 ~~~i~~~iv~~c~GlPLAl~~~g~~L~~~~~~~~~w~~~l~~L~~~-~~~~~~~~~~i~~~l~~sy~~L~~~~~k~cfl~   81 (232)
                      +.++|++|+++|+|+|||+.++|+.|+. +++..+|+++.+.+.+. ..+.+++.+.++++|++||+.||++ +|.||+|
T Consensus       341 i~~lak~v~~kC~GLPLAl~viG~~ma~-K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~-lK~CFLy  418 (889)
T KOG4658|consen  341 IEELAKEVAEKCGGLPLALNVLGGLLAC-KKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEE-LKSCFLY  418 (889)
T ss_pred             HHHHHHHHHHHhCChHHHHHHHHHHhcC-CCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHH-HHHHHHh
Confidence            4789999999999999999999999999 78889999999999887 5556667778999999999999977 8999999


Q ss_pred             hhhcCCCccccHHHHHHHHHHcCCCCCCcchHHHHHHHHHHHHHHHHcccchh-----------hHHHHHHHHHHHhccc
Q 047834           82 CALFLKNQLIRKDEHIDLWIGEGLLRDSHNIAVARLQGESIIDSLIRVCLLEE-----------MHDMLRDLALWIASQD  150 (232)
Q Consensus        82 ~a~fp~~~~~~~~~li~~w~a~g~~~~~~~~~~~~~~~~~~l~~Lv~~~ll~~-----------mhdli~~~~~~i~~~e  150 (232)
                      ||+||+||.|+++.|+..|+|+||+.+..+...++++|+.|+++||+++|+..           |||+||+||.+++.+.
T Consensus       419 calFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~  498 (889)
T KOG4658|consen  419 CALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDF  498 (889)
T ss_pred             hccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccc
Confidence            99999999999999999999999999977778899999999999999999975           9999999999999976


Q ss_pred             cCCccceecCCCCceeeccccccccccceeEec-----------------------------------CCCCCCccEEEe
Q 047834          151 KGNKILASKPENGKLIIDQQSVTWNKAVRVSLS-----------------------------------PPSCPRLLTLLV  195 (232)
Q Consensus       151 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lsl~-----------------------------------~~~l~~Lr~L~l  195 (232)
                      +...+...+..+......++...|..+|+++++                                   +..++.||+|||
T Consensus       499 ~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDL  578 (889)
T KOG4658|consen  499 GKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDL  578 (889)
T ss_pred             cccccceEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcceEEEEC
Confidence            654444555555555557788888888888887                                   234789999999


Q ss_pred             ccC-CCCCCChHhhcCCCCccEEEccCCCCCCCCCCCC
Q 047834          196 RYA-SMKGLPEWFFQSMPALRVLEWSRNGDLTKLPMQK  232 (232)
Q Consensus       196 ~~~-~l~~lp~~~i~~L~~Lr~LdL~~~~~l~~LP~si  232 (232)
                      ++| .+.+||++ |++|.+||||||++| .++.||.+|
T Consensus       579 s~~~~l~~LP~~-I~~Li~LryL~L~~t-~I~~LP~~l  614 (889)
T KOG4658|consen  579 SGNSSLSKLPSS-IGELVHLRYLDLSDT-GISHLPSGL  614 (889)
T ss_pred             CCCCccCcCChH-HhhhhhhhcccccCC-CccccchHH
Confidence            988 88999999 999999999999999 999999875



>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 1e-17
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 2e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-12
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score = 80.4 bits (198), Expect = 1e-17
 Identities = 14/147 (9%), Positives = 35/147 (23%), Gaps = 21/147 (14%)

Query: 19  LTLITIGSAMASIRNNPAEWENAVNELKNYPA-----EFPGMGDLIFPCLKFSYDHLSSE 73
            TL+    +         +     N+L++          P     +   L+   + LS E
Sbjct: 331 ATLMMFFKSCEPKTFE--KMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDE 388

Query: 74  THRKCFLFCALFLKNQLIRKDEHIDLWIGEGLLRDSHNIAVARLQGESIIDSLIRVCLLE 133
             R    F  +      I       +   +    +   +     +    +  L +   L 
Sbjct: 389 -DRSALAFAVVMPPGVDIPVKLWSCVIPVDICSNEEEQLDD---EVADRLKRLSKRGALL 444

Query: 134 E----------MHDMLRDLALWIASQD 150
                      +  ++      +    
Sbjct: 445 SGKRMPVLTFKIDHIIHMFLKHVVDAQ 471


>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.87
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.77
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.65
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.65
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.94
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.82
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.8
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.77
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.72
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.71
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.7
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.7
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 97.68
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 97.68
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.59
3m19_A 251 Variable lymphocyte receptor A diversity region; a 97.58
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 97.57
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.56
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 97.54
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.54
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.53
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.53
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 97.53
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.53
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 97.52
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 97.52
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.52
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.5
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.5
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 97.48
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.46
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.44
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.44
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.44
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.4
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.39
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.37
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 97.37
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.36
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 97.34
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.24
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.24
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.24
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.23
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.21
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 97.2
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.19
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.19
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.18
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 97.17
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.16
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.15
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 97.15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 97.13
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.12
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.11
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 97.1
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 97.1
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.04
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 97.02
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.02
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.02
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.0
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 96.99
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 96.96
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 96.96
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 96.96
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 96.96
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 96.95
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 96.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 96.93
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 96.91
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 96.91
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 96.89
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 96.89
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 96.88
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 96.87
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 96.87
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 96.82
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 96.76
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 96.76
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 96.74
4fmz_A347 Internalin; leucine rich repeat, structural genomi 96.74
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 96.74
1o6v_A 466 Internalin A; bacterial infection, extracellular r 96.73
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.73
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 96.7
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 96.64
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 96.64
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 96.63
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 96.61
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 96.61
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 96.61
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 96.59
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 96.58
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 96.57
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 96.52
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 96.52
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 96.52
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 96.49
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 96.49
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 96.43
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 96.4
1o6v_A 466 Internalin A; bacterial infection, extracellular r 96.38
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 96.36
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 96.34
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 96.33
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 96.29
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 96.28
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 96.28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 96.24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 96.22
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 96.21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 96.18
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 96.1
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 96.08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 95.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 95.9
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 95.84
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.74
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 95.51
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 94.81
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 94.53
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 94.31
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 94.17
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 94.06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 93.73
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 93.55
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 93.35
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 91.97
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 91.5
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 91.47
2fna_A357 Conserved hypothetical protein; structural genomic 90.79
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 90.58
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 90.39
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 90.37
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 89.3
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 89.3
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 87.07
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 86.75
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 86.28
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 85.97
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 85.65
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 84.3
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 83.33
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 82.4
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 81.17
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=99.87  E-value=2.2e-23  Score=187.99  Aligned_cols=136  Identities=11%  Similarity=0.057  Sum_probs=104.2

Q ss_pred             hhHHHHHHHHhcCCchHHHHHHHHHhcCCCCChhHHHHHHHHhhcCCCCCCCCCcchhhHHHHhHhcCCchhHHHHHH--
Q 047834            3 QSYSASVLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFSYDHLSSETHRKCFL--   80 (232)
Q Consensus         3 ~~~i~~~iv~~c~GlPLAl~~~g~~L~~~~~~~~~w~~~l~~L~~~~~~~~~~~~~i~~~l~~sy~~L~~~~~k~cfl--   80 (232)
                      +.+++++|+++|+|+||||+++|+.|+.  ++ +.|.   +.+.+..+...  ...+.++|.+||++||++ +|.||+  
T Consensus       315 ~~~~~~~I~~~c~GlPLAl~~~g~~l~~--~~-w~~~---~~l~~~l~~~~--~~~i~~~l~~Sy~~L~~~-lk~~f~~L  385 (549)
T 2a5y_B          315 EEDVLNKTIELSSGNPATLMMFFKSCEP--KT-FEKM---AQLNNKLESRG--LVGVECITPYSYKSLAMA-LQRCVEVL  385 (549)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHHTTCCS--SS-HHHH---HHHHHHHHHHC--SSTTCCCSSSSSSSHHHH-HHHHHHTS
T ss_pred             HHHHHHHHHHHhCCChHHHHHHHHHhcc--ch-HHHH---HHhHHHhhccc--HHHHHHHHhcccccccHH-HHHHHhcc
Confidence            4568999999999999999999999987  43 3333   33333222111  225888999999999999 799999  


Q ss_pred             ---------HhhhcCCCccccHHHHHHHHHHc--CCCCCCcchHHHHHHHHHHHHHHHHcccchh----------hHHHH
Q 047834           81 ---------FCALFLKNQLIRKDEHIDLWIGE--GLLRDSHNIAVARLQGESIIDSLIRVCLLEE----------MHDML  139 (232)
Q Consensus        81 ---------~~a~fp~~~~~~~~~li~~w~a~--g~~~~~~~~~~~~~~~~~~l~~Lv~~~ll~~----------mhdli  139 (232)
                               |||+||+++.|+    +++|+|+  ||+.........++.++ +|++|+++||++.          |||+|
T Consensus       386 s~~er~l~~~ls~fp~~~~i~----i~~w~a~~~G~i~~~~~~~~~~~~~~-~l~~L~~rsLl~~~~~~~~~~~~mHdlv  460 (549)
T 2a5y_B          386 SDEDRSALAFAVVMPPGVDIP----VKLWSCVIPVDICSNEEEQLDDEVAD-RLKRLSKRGALLSGKRMPVLTFKIDHII  460 (549)
T ss_dssp             CHHHHHHTTGGGSSCTTCCEE----HHHHHHHSCC-------CCCTHHHHH-HHHHTTTBSSCSEEECSSSCEEECCHHH
T ss_pred             chhhhhHhhheeeeCCCCeee----eeeeeeeccceeccCCCCCCHHHHHH-HHHHHHHcCCeeEecCCCceEEEeChHH
Confidence                     999999999999    8999999  99987442344567777 9999999999974          99999


Q ss_pred             HHHHHHHhccccC
Q 047834          140 RDLALWIASQDKG  152 (232)
Q Consensus       140 ~~~~~~i~~~e~~  152 (232)
                      |++|+.++.+++.
T Consensus       461 ~~~a~~~~~~~~~  473 (549)
T 2a5y_B          461 HMFLKHVVDAQTI  473 (549)
T ss_dssp             HHHHHTTSCTHHH
T ss_pred             HHHHHHHHHHHHH
Confidence            9999998877653



>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.37
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.92
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.89
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.83
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.61
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.59
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.56
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.49
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.25
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.22
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.19
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.18
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.17
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 97.17
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.16
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 97.1
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.98
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.89
d1m9la_ 198 Outer arm dynein light chain 1 {Green algae (Chlam 96.78
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.68
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.58
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 96.52
d1p9ag_266 von Willebrand factor binding domain of glycoprote 96.45
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 96.44
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 96.39
d1ozna_ 284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 96.24
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 96.14
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 96.0
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 95.62
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 94.92
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 94.07
d2astb2 284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 93.45
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 91.04
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 87.88
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 84.18
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 84.02
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.37  E-value=2.6e-14  Score=116.14  Aligned_cols=71  Identities=11%  Similarity=0.042  Sum_probs=62.8

Q ss_pred             hhHHHHHHHHhcCCchHHHHHHHHHhcCCCCChhHHHHHHHHhhcCCCCCCCCCcchhhHHHHhHhcCCchhHHHHHHHh
Q 047834            3 QSYSASVLCFACNSISLTLITIGSAMASIRNNPAEWENAVNELKNYPAEFPGMGDLIFPCLKFSYDHLSSETHRKCFLFC   82 (232)
Q Consensus         3 ~~~i~~~iv~~c~GlPLAl~~~g~~L~~~~~~~~~w~~~l~~L~~~~~~~~~~~~~i~~~l~~sy~~L~~~~~k~cfl~~   82 (232)
                      ..+++++|+++|+|+||||+++|+.|+.  ++.+.|.+..++|.+....      ++..++.+||++||++ +|.||.++
T Consensus       207 ~~~~~~~iv~~c~GlPLAl~~ig~~l~~--k~~~~~~~~~~~L~~~~~~------~v~~il~~sY~~L~~~-lk~c~~~l  277 (277)
T d2a5yb3         207 EEDVLNKTIELSSGNPATLMMFFKSCEP--KTFEKMAQLNNKLESRGLV------GVECITPYSYKSLAMA-LQRCVEVL  277 (277)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHHTTCCS--SSHHHHHHHHHHHHHHCSS------TTCCCSSSSSSSHHHH-HHHHHHTS
T ss_pred             hHHHHHHHHHHhCCCHHHHHHHHHHhcc--CCHHHHHHHHHHHhcCcHH------HHHHHHHHHHhcccHH-HHHHHHhC
Confidence            3568899999999999999999999988  8999999999999764333      6888999999999999 89999763



>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure