Citrus Sinensis ID: 047857

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220
MARMKPQALLIQSKRKKGPTRISAKTIIICNLIVVLIVLCLVVTYRHWSHSQRSNEQIGNESSTVEDDAYAVSKKFDLPGHAVLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYFKAGHSKDLAAADEWTSRGKIRSQLRTSPKHEAFMIGTVKSKDSKGFELYITTAPIPDLNDKLIVFGRVVKGEDVVQEIEEVDTDEHYQPKSDVGIINVTLKHAI
ccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHccccccccEEEEEEccEEEEEEEEccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEccccccccccEEEEccccccccccccEEEEEEccHHHHHHHHcccccccccccccEEEEEEEEEEcc
cccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHccEEEEccccccccccccccHHHHHcccccccccccEEEEEEccccEEEEEcccHccHHHHHHHHHHHccccccccccccccccccccccccHHHcccccccccEEEEEccccccEcccEEEEccccHHHcccccEEEEEEEcHHHHHHHHcccEcccccEcccEEEEEEEEEccc
MARMKPQALLIQSkrkkgptrisaKTIIICNLIVVLIVLCLVVTYrhwshsqrsneqignesstveddayavskkfdlpghavlntsKGYIIVELfkdgspetVDKFIDLCQKgyfkaghskdlaaadewtsrgkirsqlrtspkheafmigtvkskdskgfelyittapipdlndklIVFGrvvkgedvvqeieevdtdehyqpksdvgIINVTLKHAI
marmkpqalliqskrkkgptrisaKTIIICNLIVVLIVLCLVVTYRHwshsqrsneqignesstVEDDAYAVSKKFDLPGHAVLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYFKAGHSKdlaaadewtsrgkirsqlrtspkheafmigtvkskdskgFELYITtapipdlndklIVFGRVVKGEDVVQEIeevdtdehyqpksdvgiiNVTLKHAI
MARMKPQALLIQSKRKKGPTRISAKTiiicnlivvlivlclvvTYRHWSHSQRSNEQIGNESSTVEDDAYAVSKKFDLPGHAVLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYFKAGHSKDLAAADEWTSRGKIRSQLRTSPKHEAFMIGTVKSKDSKGFELYITTAPIPDLNDKLIVFGRVVKGEDVVQEIEEVDTDEHYQPKSDVGIINVTLKHAI
*********************ISAKTIIICNLIVVLIVLCLVVTYRHWS*******************AYAVSKKFDLPGHAVLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYFKAGHSKDLAAADEW*****************AFMIGTVKSKDSKGFELYITTAPIPDLNDKLIVFGRVVKGEDVVQEIEEVDTDEHY****DVGIINVT*****
***************************IICNLIVVLIVLCLVVTYRH*****************************DLPGHAVLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYFKAGHSKDLAAADEWTSRGKIRSQLRTSPKHEAFMIGTVKSKDSKGFELYITTAPIPDLNDKLIVFGRVVKGEDVVQEIEEVDTDEHYQPKSDVGIINVTLKHA*
MARMKPQALLIQ********RISAKTIIICNLIVVLIVLCLVVTYRHW*****************EDDAYAVSKKFDLPGHAVLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYFKAGHSKDLAAADEWTSRGKIRSQLRTSPKHEAFMIGTVKSKDSKGFELYITTAPIPDLNDKLIVFGRVVKGEDVVQEIEEVDTDEHYQPKSDVGIINVTLKHAI
**RMKPQ*LLIQ**R*KGPTRISAKTIIICNLIVVLIVLCLVVTYRHWSHSQR********************KKFDLPGHAVLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYFKAGHSKDLAAADEWTSRGKIRSQLRTSPKHEAFMIGTVKSKDSKGFELYITTAPIPDLNDKLIVFGRVVKGEDVVQEIEEVDTDEHYQPKSDVGIINVTLKHA*
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARMKPQALLIQSKRKKGPTRISAKTIIICNLIVVLIVLCLVVTYRHWSHSQRSNEQIGNESSTVEDDAYAVSKKFDLPGHAVLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYFKAGHSKDLAAADEWTSRGKIRSQLRTSPKHEAFMIGTVKSKDSKGFELYITTAPIPDLNDKLIVFGRVVKGEDVVQEIEEVDTDEHYQPKSDVGIINVTLKHAI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query220 2.2.26 [Sep-21-2011]
Q94A16230 Peptidyl-prolyl cis-trans no no 0.959 0.917 0.497 4e-51
P0C1J1533 Peptidyl-prolyl cis-trans N/A no 0.731 0.302 0.264 4e-11
Q29RZ2644 Peptidylprolyl isomerase yes no 0.618 0.211 0.287 3e-10
Q8CEC6646 Peptidylprolyl isomerase yes no 0.618 0.210 0.287 4e-10
Q5NVL7646 Peptidylprolyl isomerase yes no 0.618 0.210 0.287 7e-10
Q96BP3646 Peptidylprolyl isomerase yes no 0.618 0.210 0.287 7e-10
Q13427 754 Peptidyl-prolyl cis-trans no no 0.609 0.177 0.298 3e-08
O55035 752 Peptidyl-prolyl cis-trans no no 0.618 0.180 0.295 3e-08
A2AR02 752 Peptidyl-prolyl cis-trans no no 0.618 0.180 0.295 4e-08
Q5ASQ0162 Peptidyl-prolyl cis-trans yes no 0.590 0.802 0.260 5e-08
>sp|Q94A16|CP21C_ARATH Peptidyl-prolyl cis-trans isomerase CYP21-3, mitochondrial OS=Arabidopsis thaliana GN=CYP21-3 PE=2 SV=2 Back     alignment and function desciption
 Score =  201 bits (510), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 115/231 (49%), Positives = 147/231 (63%), Gaps = 20/231 (8%)

Query: 1   MARMKPQALLIQSKRKKGPTRISAKTIIICNLIVVLIVLCLVVTYRHWSHSQRSNEQIGN 60
           MA++KPQALL QSK+KKGP+RIS   I+I  L V+L+V  L   YR W+H  RS     N
Sbjct: 1   MAKIKPQALLQQSKKKKGPSRISITNIVIYTLAVLLLVFVLFSAYRRWTH--RSEIPTHN 58

Query: 61  ESSTVEDDAYAVSKKFDLPGHAVLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYFK--- 117
             S +ED A+   K  DLP  A L+T KG + +ELFKD +P  VD+F+  CQ GYFK   
Sbjct: 59  GRSVLEDAAFPGMKNVDLPRFATLDTGKGSVTIELFKDTAPNVVDQFMKFCQDGYFKGFL 118

Query: 118 -----------AGHSKDLAAADEWTSRGKIRSQLRTSPKHEAFMIGTVKSKDSKG-FELY 165
                      AG S +  A  +W      R  + TS KHE FM+GT K+K+ +G FE +
Sbjct: 119 FSRVVKHFVIQAGDSAEFDAVKDWALD---RKNIDTSLKHEEFMVGTPKAKNEQGGFEFF 175

Query: 166 ITTAPIPDLNDKLIVFGRVVKGEDVVQEIEEVDTDEHYQPKSDVGIINVTL 216
           I +A I DLN+KL VFGRV KG+DVVQEIEEV+TD+ YQPKS + I++VTL
Sbjct: 176 IVSAQIKDLNEKLTVFGRVSKGQDVVQEIEEVETDDQYQPKSPIEIMSVTL 226
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|P0C1J1|PPIL2_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 2 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp14 PE=3 SV=1 Back     alignment and function description
>sp|Q29RZ2|PPWD1_BOVIN Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Bos taurus GN=PPWD1 PE=2 SV=1 Back     alignment and function description
>sp|Q8CEC6|PPWD1_MOUSE Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Mus musculus GN=Ppwd1 PE=2 SV=2 Back     alignment and function description
>sp|Q5NVL7|PPWD1_PONAB Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Pongo abelii GN=PPWD1 PE=2 SV=1 Back     alignment and function description
>sp|Q96BP3|PPWD1_HUMAN Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens GN=PPWD1 PE=1 SV=1 Back     alignment and function description
>sp|Q13427|PPIG_HUMAN Peptidyl-prolyl cis-trans isomerase G OS=Homo sapiens GN=PPIG PE=1 SV=2 Back     alignment and function description
>sp|O55035|PPIG_RAT Peptidyl-prolyl cis-trans isomerase G OS=Rattus norvegicus GN=Ppig PE=1 SV=2 Back     alignment and function description
>sp|A2AR02|PPIG_MOUSE Peptidyl-prolyl cis-trans isomerase G OS=Mus musculus GN=Ppig PE=1 SV=1 Back     alignment and function description
>sp|Q5ASQ0|PPIL1_EMENI Peptidyl-prolyl cis-trans isomerase-like 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query220
224099151234 predicted protein [Populus trichocarpa] 0.990 0.931 0.690 3e-88
225431948234 PREDICTED: peptidyl-prolyl cis-trans iso 0.981 0.923 0.676 1e-80
224111976234 predicted protein [Populus trichocarpa] 0.990 0.931 0.673 8e-79
297829206236 peptidyl-prolyl cis-trans isomerase cycl 1.0 0.932 0.601 2e-74
15230766236 Cyclophilin-like peptidyl-prolyl cis-tra 0.986 0.919 0.605 1e-73
217071554230 unknown [Medicago truncatula] gi|3885148 0.968 0.926 0.594 4e-67
388516631229 unknown [Lotus japonicus] 0.972 0.934 0.565 6e-67
388504344230 unknown [Medicago truncatula] 0.968 0.926 0.590 2e-66
358248798232 uncharacterized protein LOC100803596 [Gl 0.981 0.931 0.572 8e-66
356576997230 PREDICTED: peptidyl-prolyl cis-trans iso 0.972 0.930 0.572 2e-65
>gi|224099151|ref|XP_002311384.1| predicted protein [Populus trichocarpa] gi|222851204|gb|EEE88751.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  330 bits (846), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 163/236 (69%), Positives = 191/236 (80%), Gaps = 18/236 (7%)

Query: 1   MARMKPQALLIQSKRKKGPTRISAKTIIICNLIVVLIVLCLVVTYRHWSHSQRSNEQIGN 60
           MAR+KPQALL QSK+KKGP RISA TI +CNL+V++I+L LV TYRHWS  QRS  Q G+
Sbjct: 1   MARIKPQALLNQSKKKKGPARISATTIFLCNLVVLVIILSLVATYRHWS--QRSKNQPGS 58

Query: 61  ESSTVED--DAYAVSKKFDLPGHAVLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYFK- 117
             ST ED  D++A SKK+DLPG+A+LNTSKGYI VEL+KDGSP  VDKF+DLCQKGYFK 
Sbjct: 59  GLSTFEDTADSFADSKKYDLPGYAILNTSKGYITVELYKDGSPMIVDKFLDLCQKGYFKG 118

Query: 118 -------------AGHSKDLAAADEWTSRGKIRSQLRTSPKHEAFMIGTVKSKDSKGFEL 164
                        AGHS+ L AA++WT++GK+ S+L TSPKHEAFMIGT K++DS GFEL
Sbjct: 119 IPFHHVIKHYVIQAGHSQGLGAAEDWTTKGKLHSRLATSPKHEAFMIGTSKTRDSTGFEL 178

Query: 165 YITTAPIPDLNDKLIVFGRVVKGEDVVQEIEEVDTDEHYQPKSDVGIINVTLKHAI 220
           +ITTAPIPDLNDK++VFGR VKGEDVVQEIEEVDTDEHY+PKS VGII VTLK  I
Sbjct: 179 FITTAPIPDLNDKILVFGRAVKGEDVVQEIEEVDTDEHYRPKSPVGIIGVTLKREI 234

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225431948|ref|XP_002277818.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-3, mitochondrial [Vitis vinifera] gi|296083251|emb|CBI22887.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111976|ref|XP_002316040.1| predicted protein [Populus trichocarpa] gi|222865080|gb|EEF02211.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297829206|ref|XP_002882485.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein [Arabidopsis lyrata subsp. lyrata] gi|297328325|gb|EFH58744.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15230766|ref|NP_187319.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] gi|42572289|ref|NP_974240.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] gi|42572291|ref|NP_974241.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] gi|12321915|gb|AAG50994.1|AC036106_7 unknown protein; 32328-30725 [Arabidopsis thaliana] gi|26450491|dbj|BAC42359.1| unknown protein [Arabidopsis thaliana] gi|28973051|gb|AAO63850.1| unknown protein [Arabidopsis thaliana] gi|45680870|gb|AAS75304.1| single domain cyclophilin type peptidyl-prolyl cis-trans isomerase [Arabidopsis thaliana] gi|332640908|gb|AEE74429.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] gi|332640909|gb|AEE74430.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] gi|332640910|gb|AEE74431.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|217071554|gb|ACJ84137.1| unknown [Medicago truncatula] gi|388514865|gb|AFK45494.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388516631|gb|AFK46377.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388504344|gb|AFK40238.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|358248798|ref|NP_001239686.1| uncharacterized protein LOC100803596 [Glycine max] gi|255634745|gb|ACU17734.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356576997|ref|XP_003556616.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-3, mitochondrial-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query220
TAIR|locus:2103420236 AT3G66654 [Arabidopsis thalian 0.986 0.919 0.566 3.4e-61
TAIR|locus:2065205230 AT2G47320 [Arabidopsis thalian 0.959 0.917 0.467 2.1e-45
TAIR|locus:2076003631 CYP71 "cyclophilin 71" [Arabid 0.727 0.253 0.307 5.6e-13
UNIPROTKB|E2RSE4 738 PPIG "Uncharacterized protein" 0.613 0.182 0.32 1.1e-11
UNIPROTKB|E9PG73 739 PPIG "Peptidyl-prolyl cis-tran 0.613 0.182 0.32 1.1e-11
DICTYBASE|DDB_G0269054635 ppwd1 "cyclophilin-type peptid 0.713 0.247 0.277 1.1e-11
POMBASE|SPBC1709.04c173 cyp3 "cyclophilin family pepti 0.254 0.323 0.446 1.9e-11
UNIPROTKB|C9JN15246 PPIG "Peptidyl-prolyl cis-tran 0.313 0.280 0.380 5.9e-11
DICTYBASE|DDB_G0280401174 cypD "cyclophilin D" [Dictyost 0.286 0.362 0.375 1.4e-10
TAIR|locus:2053491164 AT2G36130 [Arabidopsis thalian 0.609 0.817 0.3 2.5e-10
TAIR|locus:2103420 AT3G66654 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 626 (225.4 bits), Expect = 3.4e-61, P = 3.4e-61
 Identities = 132/233 (56%), Positives = 157/233 (67%)

Query:     1 MARMKPQALLIQSKRKKGPTRISAKTXXXXXXXXXXXXXXXXXTYRHWSHSQRSNEQIGN 60
             MA++KPQALL QSK+KKGP+RIS  T                 TYRHWS   R+  +   
Sbjct:     1 MAKIKPQALLNQSKKKKGPSRISISTIIVCNLVVAVVILSLVTTYRHWSQRSRNTIEHET 60

Query:    61 ESSTVEDDAYAVSKK-FDLPGHAVLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYFK-- 117
              S   ED   A  +K +DLPG A +NTSKG I VELFK+GSPE VDKF+DLCQK +FK  
Sbjct:    61 RSQRFEDTNTASGQKTYDLPGFADINTSKGLITVELFKEGSPEVVDKFLDLCQKDHFKGM 120

Query:   118 ------------AGHSKDLAAADEWTSRGKIRSQLRTSPKHEAFMIGTVKSK-DSKGFEL 164
                         AGHS      +EWT++GK+R +L   PKHEAFM+GT K+K ++K FEL
Sbjct:   121 PFQRVIKNYLVQAGHSPSSIPVEEWTAKGKLRGRLHIGPKHEAFMLGTPKNKGNNKDFEL 180

Query:   165 YITTAPIPDLNDKLIVFGRVVKGEDVVQEIEEVDTDEHYQPKSDVGIINVTLK 217
              ITTAPIPDLND+LIVFGRV+KGEDVVQEIEEVDTDEH+QPKS +GI  V LK
Sbjct:   181 LITTAPIPDLNDQLIVFGRVLKGEDVVQEIEEVDTDEHFQPKSPIGITGVVLK 233
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IEA;ISS
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2065205 AT2G47320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076003 CYP71 "cyclophilin 71" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSE4 PPIG "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PG73 PPIG "Peptidyl-prolyl cis-trans isomerase G" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269054 ppwd1 "cyclophilin-type peptidylprolyl cis-trans isomerase (PPIase)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPBC1709.04c cyp3 "cyclophilin family peptidyl-prolyl cis- trans isomerase Cyp3" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|C9JN15 PPIG "Peptidyl-prolyl cis-trans isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0280401 cypD "cyclophilin D" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2053491 AT2G36130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.921
4th Layer5.2.1.80.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 1e-28
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 3e-22
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 3e-17
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 2e-13
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 1e-12
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 2e-12
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 1e-11
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 2e-08
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 2e-08
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 7e-08
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 1e-06
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 3e-05
PRK10903190 PRK10903, PRK10903, peptidyl-prolyl cis-trans isom 1e-04
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 2e-04
PRK10791164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 3e-04
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information 
 Score =  104 bits (262), Expect = 1e-28
 Identities = 45/157 (28%), Positives = 71/157 (45%), Gaps = 37/157 (23%)

Query: 83  VLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYFK------------------------- 117
            L+T+KG I++EL+ D +P+TV+ F+ L + G++                          
Sbjct: 1   TLDTTKGRIVIELYGDEAPKTVENFLSLARGGFYDGTTFHRVIPGFMIQGGDPTGTGGGG 60

Query: 118 AGHSKDLAAADEWTSRGKIRSQLRTSPKHEAFMIGTVKS-KDSKGFELYITTAPIPDLND 176
           +G        DE                H    +    +  ++ G + +ITTAP P L+ 
Sbjct: 61  SGPGYKFP--DENFPLKY---------HHRRGTLSMANAGPNTNGSQFFITTAPTPHLDG 109

Query: 177 KLIVFGRVVKGEDVVQEIEEVDTDEHYQPKSDVGIIN 213
           K  VFG+VV+G DVV +IE  DTDE+ +P   V I +
Sbjct: 110 KHTVFGKVVEGMDVVDKIERGDTDENGRPIKPVTISD 146

This family contains eukaryotic, bacterial and archeal proteins which exhibit a peptidylprolyl cis- trans isomerases activity (PPIase, Rotamase) and in addition bind the immunosuppressive drug cyclosporin (CsA). Immunosuppression in vertebrates is believed to be the result of the cyclophilin A-cyclosporin protein drug complex binding to and inhibiting the protein-phosphatase calcineurin. PPIase is an enzyme which accelerates protein folding by catalyzing the cis-trans isomerization of the peptide bonds preceding proline residues. Cyclophilins are a diverse family in terms of function and have been implicated in protein folding processes which depend on catalytic /chaperone-like activities. This group contains human cyclophilin 40, a co-chaperone of the hsp90 chaperone system; human cyclophilin A, a chaperone in the HIV-1 infectious process and; human cyclophilin H, a component of the U4/U6 snRNP, whose isomerization or chaperoning activities may play a role in RNA splicing. . Length = 146
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 220
KOG0881164 consensus Cyclophilin type peptidyl-prolyl cis-tra 100.0
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 100.0
KOG0883518 consensus Cyclophilin type, U box-containing pepti 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
KOG0884161 consensus Similar to cyclophilin-type peptidyl-pro 100.0
KOG0880217 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 100.0
KOG0546 372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 100.0
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 100.0
PTZ00221249 cyclophilin; Provisional 100.0
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
PTZ00060183 cyclophilin; Provisional 100.0
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 100.0
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 100.0
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 100.0
KOG0879177 consensus U-snRNP-associated cyclophilin type pept 100.0
KOG0885 439 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 99.98
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.97
KOG0865167 consensus Cyclophilin type peptidyl-prolyl cis-tra 99.91
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 99.04
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 97.09
PRK00969 508 hypothetical protein; Provisional 97.0
TIGR03268503 methan_mark_3 putative methanogenesis marker prote 96.35
COG4070 512 Predicted peptidyl-prolyl cis-trans isomerase (rot 95.86
PRK00969508 hypothetical protein; Provisional 95.65
COG4070512 Predicted peptidyl-prolyl cis-trans isomerase (rot 94.74
>KOG0881 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=3e-43  Score=264.41  Aligned_cols=141  Identities=28%  Similarity=0.480  Sum_probs=135.4

Q ss_pred             CCCceEEEEeccceEEEEEcCCCChHHHHHHHHHHhcCccc--------------cCCCCCCCCCCCcccCCccCCCCCC
Q 047857           77 DLPGHAVLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYFK--------------AGHSKDLAAADEWTSRGKIRSQLRT  142 (220)
Q Consensus        77 ~~~~~v~~~T~~G~i~ieL~~~~aP~~~~nF~~L~~~g~Y~--------------gGd~~~~g~~~~~~~~~~~~~e~~~  142 (220)
                      ..+..|.++|++|.|++|||-+.||+||.||..|++.||||              ||||+|+|.++.+.++.+|.+|.+.
T Consensus         7 ~q~~~V~LeTsmG~i~~ElY~kHaP~TC~NF~eLarrgYYn~v~FHRii~DFmiQGGDPTGTGRGGaSIYG~kF~DEi~~   86 (164)
T KOG0881|consen    7 WQPPNVTLETSMGKITLELYWKHAPRTCQNFAELARRGYYNGVIFHRIIKDFMIQGGDPTGTGRGGASIYGDKFEDEIHS   86 (164)
T ss_pred             CCCCeEEEeecccceehhhhhhcCcHHHHHHHHHHhcccccceeeeehhhhheeecCCCCCCCCCccccccchhhhhhhh
Confidence            34456999999999999999999999999999999999999              9999999999999999999999999


Q ss_pred             CCCCC-CeEEEeec-CCCCCCceEEEEcCCCCCCCCCccEEEEEecCHHHHHHHHhCCCCCCCCCCCceEEEEEEEe
Q 047857          143 SPKHE-AFMIGTVK-SKDSKGFELYITTAPIPDLNDKLIVFGRVVKGEDVVQEIEEVDTDEHYQPKSDVGIINVTLK  217 (220)
Q Consensus       143 ~l~h~-~G~v~ma~-~~~~~~sqFfIt~~~~~~Ld~~~tVFG~Vv~Gmdvv~~I~~~~~~~~~~P~~~i~I~~~~i~  217 (220)
                      .|+|. .|.++||+ +||+||||||||+.+.+||||+||+||||..||+|+.++..+++|.++||+.+++|.++...
T Consensus        87 dLkhTGAGILsMANaGPnTNgSQFFiTLAPt~~LDGKHTIFGRV~~Gm~vikr~G~v~Td~~DRPi~~~kIika~~~  163 (164)
T KOG0881|consen   87 DLKHTGAGILSMANAGPNTNGSQFFITLAPTQWLDGKHTIFGRVCSGMEVIKRMGMVETDNSDRPIDEVKIIKAYPS  163 (164)
T ss_pred             hhcccchhhhhhhccCCCCCCceEEEEecCccccCCcceeehhhhhhHHHHHhhcceecCCCCCCccceeeEeeecC
Confidence            99999 99999999 99999999999999999999999999999999999999999999999999999999998764

>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>KOG0884 consensus Similar to cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0880 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>KOG0879 consensus U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0885 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0865 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 3e-11
2gw2_A198 Crystal Structure Of The Peptidyl-Prolyl Isomerase 7e-11
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 2e-10
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 2e-10
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 3e-10
2he9_A192 Structure Of The Peptidylprolyl Isomerase Domain Of 6e-09
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 2e-08
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 2e-08
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 2e-08
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 7e-08
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 3e-07
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 3e-07
2rmc_A182 Crystal Structure Of Murine Cyclophilin C Complexed 7e-07
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 9e-07
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 2e-06
1zkc_A197 Crystal Structure Of The Cyclophiln_ring Domain Of 2e-06
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 2e-06
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 2e-06
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 2e-06
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 7e-06
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 8e-06
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 2e-05
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 2e-05
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 3e-05
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 7e-05
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 7e-05
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 7e-05
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 7e-05
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 8e-05
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 8e-05
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 1e-04
3bo7_A201 Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro 1e-04
1ihg_A 370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 2e-04
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure 
Iteration: 1

 Score = 65.1 bits (157), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 73/153 (47%), Gaps = 17/153 (11%)
Query: 82  AVLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYF--------------KAGHSKDLAAA 127
           A+++TS G I  +LF    P+TV+ F    + GY+              + G        
Sbjct: 24  AIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGFMIQTGDPTGTGMG 83
Query: 128 DEWTSRGKIRSQLRTSPKHE-AFMIGTVKS-KDSKGFELYITTAPIPDLNDKLIVFGRVV 185
            E    G+   +  ++ +H+  + +    +  ++ G + +IT  P P L++K  VFGRV 
Sbjct: 84  GESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVT 143
Query: 186 KGEDVVQEIEEVDTDEHY-QPKSDVGIINVTLK 217
           KG +VVQ I  V  +    +P  DV IIN+T+K
Sbjct: 144 KGMEVVQRISNVKVNPKTDKPYEDVSIINITVK 176
>pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure
>pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
2b71_A196 Cyclophilin-like protein; structural genomics, str 7e-24
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 5e-23
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 5e-23
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 2e-21
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 3e-21
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 4e-21
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 3e-20
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 3e-20
2hq6_A185 Serologically defined colon cancer antigen 10; pro 5e-20
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 6e-20
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 2e-19
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 6e-18
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 5e-15
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 8e-14
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 2e-13
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 1e-11
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 2e-11
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 3e-11
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 4e-11
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 9e-10
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 1e-09
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 1e-09
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 3e-09
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 1e-08
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 8e-08
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 2e-07
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 3e-07
1z81_A229 Cyclophilin; structural genomics, structural genom 6e-07
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 7e-07
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 8e-07
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-06
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 1e-06
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 2e-06
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 4e-06
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 1e-05
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
 Score = 93.2 bits (232), Expect = 7e-24
 Identities = 44/186 (23%), Positives = 71/186 (38%), Gaps = 42/186 (22%)

Query: 60  NESSTVEDD--AYAVSKKFDLPGHAVLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYF- 116
           +E +   ++  AY   K     G+  + T+ G   VEL+   SP+T   F  LC+ G++ 
Sbjct: 17  SEKTKSLEEKIAYYKMKGHTERGYITIYTNLGDFEVELYWYHSPKTCLNFYTLCEMGFYD 76

Query: 117 ----------------------KAGHSK-DLAAADEWTSRGKIRSQLRTSPKHEAFMIGT 153
                                 K G S       DE      I  +L    KH     G 
Sbjct: 77  NTIFHRVIPNFVIQGGDPTGTGKGGKSIYGEYFEDE------INKEL----KHTG--AGI 124

Query: 154 V----KSKDSKGFELYITTAPIPDLNDKLIVFGRVVKGEDVVQEIEEVDTDEHYQPKSDV 209
           +       ++   + +IT AP+P L+ K  +F RV K    ++ I  V T    +P  D+
Sbjct: 125 LSMSNNGPNTNSSQFFITLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKPIFDL 184

Query: 210 GIINVT 215
            I+  +
Sbjct: 185 KILRTS 190
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query220
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 100.0
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 100.0
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 100.0
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
2hq6_A185 Serologically defined colon cancer antigen 10; pro 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 100.0
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 99.97
2nnz_A153 Hypothetical protein; beta-barrel, structural geno 91.12
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
Probab=100.00  E-value=1e-43  Score=283.67  Aligned_cols=140  Identities=26%  Similarity=0.505  Sum_probs=132.0

Q ss_pred             ceEEEEeccceEEEEEcCCCChHHHHHHHHHHhcCccc--------------cCCCCCCCCCCCcccCCccCCCCCCCCC
Q 047857           80 GHAVLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYFK--------------AGHSKDLAAADEWTSRGKIRSQLRTSPK  145 (220)
Q Consensus        80 ~~v~~~T~~G~i~ieL~~~~aP~~~~nF~~L~~~g~Y~--------------gGd~~~~g~~~~~~~~~~~~~e~~~~l~  145 (220)
                      +.|+++|+.|+|+||||++.||+||+||++||++|||+              +||+.++|.++.+.++..+++|..+.++
T Consensus         1 m~v~~~T~~G~i~ieL~~~~aP~t~~NF~~L~~~g~Y~g~~fhRvi~~f~iQgGd~~~~g~gg~si~g~~~~dE~~~~l~   80 (161)
T 2ok3_A            1 MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLK   80 (161)
T ss_dssp             CEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCBCCEEETTTEEEECCTTSSSSCCCCTTSSCBCCCCCTTCC
T ss_pred             CEEEEEeCCccEEEEEcCCCCcHHHHHHHHHhhhcccCCCEEEEEECCCEEecCCCCCCCCCCCcccCCccccccCcCcC
Confidence            45899999999999999999999999999999999999              8999988887777888889999877899


Q ss_pred             CC-CeEEEeec-CCCCCCceEEEEcCCCCCCCCCccEEEEEecCHHHHHHHHhCCCCCC-CCCCCceEEEEEEEeeC
Q 047857          146 HE-AFMIGTVK-SKDSKGFELYITTAPIPDLNDKLIVFGRVVKGEDVVQEIEEVDTDEH-YQPKSDVGIINVTLKHA  219 (220)
Q Consensus       146 h~-~G~v~ma~-~~~~~~sqFfIt~~~~~~Ld~~~tVFG~Vv~Gmdvv~~I~~~~~~~~-~~P~~~i~I~~~~i~~d  219 (220)
                      |. +|+|+||+ +|++++|||||++.++||||++|+|||+|++|||||++|++.+++.+ ++|.++|+|.+|+|++|
T Consensus        81 h~~~G~lsma~~gp~s~~SQFfI~~~~~~~Ldg~~tvFG~Vv~G~dvv~~I~~~~~~~~~~~P~~~v~I~~~~i~~~  157 (161)
T 2ok3_A           81 HNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHAN  157 (161)
T ss_dssp             SCSTTEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTCCBCTTTCCBSSCCBEEEEEEECC
T ss_pred             cCCCeEEEEecCCCCCcceEEEEEcCCCCccCCCEeEEEEEeCCHHHHHHHHhCCccCCCCCcCCCeEEEEEEEecC
Confidence            85 99999999 89999999999999999999999999999999999999999999887 99999999999999976
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure
>2nnz_A Hypothetical protein; beta-barrel, structural genomics, ontario centre for structu proteomics, OCSP, unknown function; NMR {Archaeoglobus fulgidus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 220
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 7e-21
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 2e-19
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 6e-19
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 1e-18
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 7e-16
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 2e-15
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 2e-15
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 6e-15
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 2e-14
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 2e-14
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 3e-14
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 7e-14
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 2e-13
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 2e-13
d1lopa_164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 3e-13
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 3e-13
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 2e-12
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 2e-12
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 3e-12
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 3e-12
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 2e-10
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 3e-10
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Putative cyclophilin PFE0505w
species: Plasmodium falciparum [TaxId: 5833]

 Score = 83.1 bits (204), Expect = 7e-21
 Identities = 37/154 (24%), Positives = 62/154 (40%), Gaps = 16/154 (10%)

Query: 79  PGHAVLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYFKAGHSKDLAAADEWTSR----- 133
           P  A++ T+ G I + LF     +TV  F      GY+       +       +      
Sbjct: 1   PKSAIIYTTMGDIHISLFYKECKKTVQNFSVHSINGYYNNCIFHRVIKHFMVQTGDPSGD 60

Query: 134 --GKIRSQLRTSPKHEAFMIGTVK---------SKDSKGFELYITTAPIPDLNDKLIVFG 182
             G                +   K           ++ G + +ITT P P L+ K  VFG
Sbjct: 61  GTGGESIWGNEFEDEFFDHLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFG 120

Query: 183 RVVKGEDVVQEIEEVDTDEHYQPKSDVGIINVTL 216
           +V +G  +V +IE+V TD+  +P  D+ I+N+ +
Sbjct: 121 KVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI 154
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query220
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 100.0
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 100.0
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 100.0
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 100.0
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 100.0
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 100.0
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 100.0
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 100.0
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 100.0
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 100.0
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin-like protein PPIL3B
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1e-40  Score=263.94  Aligned_cols=140  Identities=26%  Similarity=0.502  Sum_probs=127.9

Q ss_pred             ceEEEEeccceEEEEEcCCCChHHHHHHHHHHhcCccc--------------cCCCCCCCCCCCcccCCccCCCCCCCCC
Q 047857           80 GHAVLNTSKGYIIVELFKDGSPETVDKFIDLCQKGYFK--------------AGHSKDLAAADEWTSRGKIRSQLRTSPK  145 (220)
Q Consensus        80 ~~v~~~T~~G~i~ieL~~~~aP~~~~nF~~L~~~g~Y~--------------gGd~~~~g~~~~~~~~~~~~~e~~~~l~  145 (220)
                      |.|+++|+.|+|+|+||++.||++|+||++||+++||+              +||+.+.+.++.+.++..++.|....++
T Consensus         1 msV~~~T~~G~i~ieL~~~~aP~tv~nF~~L~~~g~Y~~~~f~rv~~~~~iq~Gd~~~~~~~~~~~~~~~~~~e~~~~~~   80 (159)
T d2ok3a1           1 MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLK   80 (159)
T ss_dssp             CEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCBCCEEETTTEEEECCTTSSSSCCCCTTSSCBCCCCCTTCC
T ss_pred             CEEEEEeCCeEEEEEEcCCCChHHHHHHHHHHhhhcccceeEecccCCeEEEeCCccccCCCCcccCCCccccccccCCC
Confidence            46999999999999999999999999999999999999              7888766666666667778888777888


Q ss_pred             CC-CeEEEeec-CCCCCCceEEEEcCCCCCCCCCccEEEEEecCHHHHHHHHhCCCCC-CCCCCCceEEEEEEEeeC
Q 047857          146 HE-AFMIGTVK-SKDSKGFELYITTAPIPDLNDKLIVFGRVVKGEDVVQEIEEVDTDE-HYQPKSDVGIINVTLKHA  219 (220)
Q Consensus       146 h~-~G~v~ma~-~~~~~~sqFfIt~~~~~~Ld~~~tVFG~Vv~Gmdvv~~I~~~~~~~-~~~P~~~i~I~~~~i~~d  219 (220)
                      |. +|+|+|++ ++++++|||||++++.|+||++|+|||+|++|||||++|++.++++ +++|.++|+|++|+|+.|
T Consensus        81 ~~~~G~lsma~~~~~s~~sqFfIt~~~~p~ld~~~tvFG~V~~G~~vl~~I~~~~~~~~~~~P~~~i~I~~v~i~~~  157 (159)
T d2ok3a1          81 HNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHAN  157 (159)
T ss_dssp             SCSTTEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTCCBCTTTCCBSSCCBEEEEEEECC
T ss_pred             CCCCeEEEEeeCCCCCcCcceEeeeccCcccccceEEEEecccchHHHHHHHcCcCCCCCCCcCCCcEEEEEEEEeC
Confidence            86 99999999 8999999999999999999999999999999999999999999976 478999999999999976
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure