Citrus Sinensis ID: 047870

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MRQAGTYSGLLSKMSGRAGTHSLPLARIKKIMKKSGDDVKMISGEAPIVFSKACELFIEELTKRSWTMTMQGKRRTLLKDDVASAVIATDIFDFLLTLVSES
ccccccccccccccccccccccccHHHHHHHHHcccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccccccccc
ccccccHHHHHHHHHHccccccccHHHHHHHHHccccccccEccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHcccHHHHHHccccccc
mrqagtysgllskmsgragthslpLARIKKIMKKSgddvkmisgeapiVFSKACELFIEELTKRSWTMTMQGkrrtllkddvasAVIATDIFDFLLTLVSES
mrqagtysgllskmsgragthslplARIKKIMKKSGDDVKMISGEAPIVFSKACELFIEELTkrswtmtmqgkrrtllkddvasaVIATDIFDFLLTLVSES
MRQAGTYSGLLSKMSGRAGTHSLPLARIKKIMKKSGDDVKMISGEAPIVFSKACELFIEELTKRSWTMTMQGKRRTLLKDDVASAVIATDIFDFLLTLVSES
**************************************VKMISGEAPIVFSKACELFIEELTKRSWTMTMQGKRRTLLKDDVASAVIATDIFDFLLTLV***
***********************PLARIKKIMKKSGDDVKMISGEAPIVFSKACELFIEELTKRS*************KDDVASAVIATDIFDFLLTLVS**
MRQAGTYSGLLSKMSGRAGTHSLPLARIKKIMKKSGDDVKMISGEAPIVFSKACELFIEELTKRSWTMTMQGKRRTLLKDDVASAVIATDIFDFLLTLVSES
****GTYSGLLSKMSGRAGTHSLPLARIKKIMKKSGDDVKMISGEAPIVFSKACELFIEELTKRSWTMTMQGKRRTLLKDDVASAVIATDIFDFLLTLVSE*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRQAGTYSGLLSKMSGRAGTHSLPLARIKKIMKKSGDDVKMISGEAPIVFSKACELFIEELTKRSWTMTMQGKRRTLLKDDVASAVIATDIFDFLLTLVSES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query102 2.2.26 [Sep-21-2011]
Q9ZVL3217 Nuclear transcription fac yes no 0.784 0.368 0.654 2e-25
Q8L4B2231 Nuclear transcription fac no no 0.784 0.346 0.654 3e-25
Q9FMV5250 Nuclear transcription fac no no 0.784 0.32 0.641 5e-24
Q9SMP0234 Nuclear transcription fac no no 0.784 0.341 0.641 6e-24
Q8LCG7199 Nuclear transcription fac no no 0.784 0.402 0.592 8e-24
Q02516242 Transcriptional activator yes no 0.784 0.330 0.580 1e-22
Q9FGP7202 Nuclear transcription fac no no 0.754 0.381 0.564 7e-19
Q557I1 684 Nuclear transcription fac yes no 0.774 0.115 0.55 1e-18
Q13952 458 Nuclear transcription fac no no 0.764 0.170 0.569 2e-18
Q5E9X1 335 Nuclear transcription fac yes no 0.764 0.232 0.569 3e-18
>sp|Q9ZVL3|NFYC3_ARATH Nuclear transcription factor Y subunit C-3 OS=Arabidopsis thaliana GN=NFYC3 PE=2 SV=1 Back     alignment and function desciption
 Score =  114 bits (285), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 66/81 (81%), Gaps = 1/81 (1%)

Query: 20  THSLPLARIKKIMKKSGDDVKMISGEAPIVFSKACELFIEELTKRSWTMTMQGKRRTLLK 79
            HSLPLARIKKIMK + +DV+MIS EAP+VF++ACE+FI ELT RSW  T + KRRTL K
Sbjct: 68  NHSLPLARIKKIMK-ADEDVRMISAEAPVVFARACEMFILELTLRSWNHTEENKRRTLQK 126

Query: 80  DDVASAVIATDIFDFLLTLVS 100
           +D+A+AV  TDIFDFL+ +V 
Sbjct: 127 NDIAAAVTRTDIFDFLVDIVP 147
Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8L4B2|NFYC9_ARATH Nuclear transcription factor Y subunit C-9 OS=Arabidopsis thaliana GN=NFYC9 PE=2 SV=1 Back     alignment and function description
>sp|Q9FMV5|NFYC4_ARATH Nuclear transcription factor Y subunit C-4 OS=Arabidopsis thaliana GN=NFYC4 PE=2 SV=1 Back     alignment and function description
>sp|Q9SMP0|NFYC1_ARATH Nuclear transcription factor Y subunit C-1 OS=Arabidopsis thaliana GN=NFYC1 PE=1 SV=1 Back     alignment and function description
>sp|Q8LCG7|NFYC2_ARATH Nuclear transcription factor Y subunit C-2 OS=Arabidopsis thaliana GN=NFYC2 PE=2 SV=2 Back     alignment and function description
>sp|Q02516|HAP5_YEAST Transcriptional activator HAP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP5 PE=1 SV=1 Back     alignment and function description
>sp|Q9FGP7|NFYC6_ARATH Nuclear transcription factor Y subunit C-6 OS=Arabidopsis thaliana GN=NFYC6 PE=2 SV=1 Back     alignment and function description
>sp|Q557I1|NFYC_DICDI Nuclear transcription factor Y subunit gamma OS=Dictyostelium discoideum GN=nfyc-1 PE=3 SV=1 Back     alignment and function description
>sp|Q13952|NFYC_HUMAN Nuclear transcription factor Y subunit gamma OS=Homo sapiens GN=NFYC PE=1 SV=3 Back     alignment and function description
>sp|Q5E9X1|NFYC_BOVIN Nuclear transcription factor Y subunit gamma OS=Bos taurus GN=NFYC PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query102
224053935118 predicted protein [Populus trichocarpa] 1.0 0.864 0.834 2e-41
356546912123 PREDICTED: nuclear transcription factor 1.0 0.829 0.815 3e-41
225426367116 PREDICTED: nuclear transcription factor 1.0 0.879 0.796 3e-41
255537411117 ccaat-binding transcription factor, puta 0.970 0.846 0.83 1e-40
356543975123 PREDICTED: nuclear transcription factor 1.0 0.829 0.796 5e-40
357452515119 Nuclear transcription factor Y subunit C 1.0 0.857 0.784 4e-39
357452521117 Nuclear transcription factor Y subunit C 1.0 0.871 0.774 1e-38
449457660119 PREDICTED: nuclear transcription factor 0.941 0.806 0.737 2e-35
22407490777 predicted protein [Populus trichocarpa] 0.754 1.0 0.883 8e-32
90399211122 H0306F12.4 [Oryza sativa Indica Group] g 0.970 0.811 0.587 2e-28
>gi|224053935|ref|XP_002298046.1| predicted protein [Populus trichocarpa] gi|222845304|gb|EEE82851.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 92/103 (89%), Gaps = 1/103 (0%)

Query: 1   MRQAGTYSGLLSK-MSGRAGTHSLPLARIKKIMKKSGDDVKMISGEAPIVFSKACELFIE 59
           MRQAGTYSG+LS  +SG+ G HSLPLARIKKIMKKSG DVKMISGEAPIVFSKACELFIE
Sbjct: 1   MRQAGTYSGILSGGLSGKTGPHSLPLARIKKIMKKSGADVKMISGEAPIVFSKACELFIE 60

Query: 60  ELTKRSWTMTMQGKRRTLLKDDVASAVIATDIFDFLLTLVSES 102
           +LT+RSW MTMQGKRRTL K DVASAVI TDIFDFL+ LVS S
Sbjct: 61  DLTQRSWMMTMQGKRRTLHKVDVASAVIGTDIFDFLVNLVSNS 103

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356546912|ref|XP_003541864.1| PREDICTED: nuclear transcription factor Y subunit C-1-like [Glycine max] Back     alignment and taxonomy information
>gi|225426367|ref|XP_002269359.1| PREDICTED: nuclear transcription factor Y subunit C-3 [Vitis vinifera] gi|297742545|emb|CBI34694.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255537411|ref|XP_002509772.1| ccaat-binding transcription factor, putative [Ricinus communis] gi|223549671|gb|EEF51159.1| ccaat-binding transcription factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356543975|ref|XP_003540433.1| PREDICTED: nuclear transcription factor Y subunit C-3-like [Glycine max] Back     alignment and taxonomy information
>gi|357452515|ref|XP_003596534.1| Nuclear transcription factor Y subunit C-1 [Medicago truncatula] gi|355485582|gb|AES66785.1| Nuclear transcription factor Y subunit C-1 [Medicago truncatula] gi|388523245|gb|AFK49675.1| nuclear transcription factor Y subunit C6 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357452521|ref|XP_003596537.1| Nuclear transcription factor Y subunit C-1 [Medicago truncatula] gi|355485585|gb|AES66788.1| Nuclear transcription factor Y subunit C-1 [Medicago truncatula] gi|388523255|gb|AFK49680.1| nuclear transcription factor Y subunit C11 [Medicago truncatula] Back     alignment and taxonomy information
>gi|449457660|ref|XP_004146566.1| PREDICTED: nuclear transcription factor Y subunit C-4-like [Cucumis sativus] gi|449516407|ref|XP_004165238.1| PREDICTED: nuclear transcription factor Y subunit C-4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224074907|ref|XP_002304485.1| predicted protein [Populus trichocarpa] gi|222841917|gb|EEE79464.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|90399211|emb|CAH68282.1| H0306F12.4 [Oryza sativa Indica Group] gi|125550276|gb|EAY96098.1| hypothetical protein OsI_17975 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query102
TAIR|locus:2036034231 NF-YC9 ""nuclear factor Y, sub 0.764 0.337 0.670 3.8e-23
TAIR|locus:2010980217 NF-YC3 ""nuclear factor Y, sub 0.764 0.359 0.670 3.8e-23
TAIR|locus:2011776199 NF-YC2 ""nuclear factor Y, sub 0.764 0.391 0.607 3.4e-22
TAIR|locus:2114555234 NF-YC1 ""nuclear factor Y, sub 0.764 0.333 0.658 3.4e-22
TAIR|locus:2167306250 NF-YC4 ""nuclear factor Y, sub 0.764 0.312 0.658 3.4e-22
SGD|S000005885242 HAP5 "Subunit of the Hap2p/3p/ 0.774 0.326 0.587 6.3e-21
CGD|CAL0002670 348 HAP5 [Candida albicans (taxid: 0.764 0.224 0.569 4.4e-20
UNIPROTKB|Q5A1M2 348 HAP5 "Putative uncharacterized 0.764 0.224 0.569 4.4e-20
UNIPROTKB|G4NC05270 MGG_00472 "Transcriptional act 0.764 0.288 0.569 9.2e-20
ASPGD|ASPL0000002619265 hapE [Emericella nidulans (tax 0.764 0.294 0.556 4e-19
TAIR|locus:2036034 NF-YC9 ""nuclear factor Y, subunit C9"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 267 (99.0 bits), Expect = 3.8e-23, P = 3.8e-23
 Identities = 53/79 (67%), Positives = 66/79 (83%)

Query:    21 HSLPLARIKKIMKKSGDDVKMISGEAPIVFSKACELFIEELTKRSWTMTMQGKRRTLLKD 80
             HSLPLARIKKIMK + +DV+MIS EAP+VF++ACE+FI ELT RSW  T + KRRTL K+
Sbjct:    79 HSLPLARIKKIMK-ADEDVRMISAEAPVVFARACEMFILELTLRSWNHTEENKRRTLQKN 137

Query:    81 DVASAVIATDIFDFLLTLV 99
             D+A+AV  TDIFDFL+ +V
Sbjct:   138 DIAAAVTRTDIFDFLVDIV 156
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;ISS;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2010980 NF-YC3 ""nuclear factor Y, subunit C3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011776 NF-YC2 ""nuclear factor Y, subunit C2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2114555 NF-YC1 ""nuclear factor Y, subunit C1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167306 NF-YC4 ""nuclear factor Y, subunit C4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
SGD|S000005885 HAP5 "Subunit of the Hap2p/3p/4p/5p CCAAT-binding complex" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
CGD|CAL0002670 HAP5 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5A1M2 HAP5 "Putative uncharacterized protein HAP5" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|G4NC05 MGG_00472 "Transcriptional activator hap5" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000002619 hapE [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query102
COG5208286 COG5208, HAP5, CCAAT-binding factor, subunit C [Tr 6e-31
pfam0080865 pfam00808, CBFD_NFYB_HMF, Histone-like transcripti 2e-17
pfam0012575 pfam00125, Histone, Core histone H2A/H2B/H3/H4 4e-10
COG5247113 COG5247, BUR6, Class 2 transcription repressor NC2 2e-07
COG203691 COG2036, HHT1, Histones H3 and H4 [Chromatin struc 5e-05
>gnl|CDD|227533 COG5208, HAP5, CCAAT-binding factor, subunit C [Transcription] Back     alignment and domain information 
 Score =  110 bits (275), Expect = 6e-31
 Identities = 46/80 (57%), Positives = 63/80 (78%), Gaps = 1/80 (1%)

Query: 21  HSLPLARIKKIMKKSGDDVKMISGEAPIVFSKACELFIEELTKRSWTMTMQGKRRTLLKD 80
           H+LPLARIKK+MK + +DVKMIS EAP++F+K  E+FIEELT R+W    + KRRTL K 
Sbjct: 108 HNLPLARIKKVMK-TDEDVKMISAEAPVLFAKITEIFIEELTMRAWINAEENKRRTLQKS 166

Query: 81  DVASAVIATDIFDFLLTLVS 100
           D+A+AV  +++FDFL+ +V 
Sbjct: 167 DIAAAVKKSEMFDFLIDIVP 186

Length = 286
>gnl|CDD|201453 pfam00808, CBFD_NFYB_HMF, Histone-like transcription factor (CBF/NF-Y) and archaeal histone Back     alignment and domain information
>gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 Back     alignment and domain information
>gnl|CDD|227572 COG5247, BUR6, Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] Back     alignment and domain information
>gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 102
PF0080865 CBFD_NFYB_HMF: Histone-like transcription factor ( 99.88
COG5208286 HAP5 CCAAT-binding factor, subunit C [Transcriptio 99.86
KOG1657236 consensus CCAAT-binding factor, subunit C (HAP5) [ 99.85
KOG1659 224 consensus Class 2 transcription repressor NC2, alp 99.83
COG5247113 BUR6 Class 2 transcription repressor NC2, alpha su 99.82
KOG0869168 consensus CCAAT-binding factor, subunit A (HAP3) [ 99.64
COG5262132 HTA1 Histone H2A [Chromatin structure and dynamics 99.56
KOG0870172 consensus DNA polymerase epsilon, subunit D [Trans 99.56
KOG0871156 consensus Class 2 transcription repressor NC2, bet 99.55
cd00074115 H2A Histone 2A; H2A is a subunit of the nucleosome 99.55
COG203691 HHT1 Histones H3 and H4 [Chromatin structure and d 99.44
KOG1756131 consensus Histone 2A [Chromatin structure and dyna 99.42
smart00414106 H2A Histone 2A. 99.37
PLN00154136 histone H2A; Provisional 99.36
PTZ00017134 histone H2A; Provisional 99.33
KOG1658162 consensus DNA polymerase epsilon, subunit C [Repli 99.27
PLN00153129 histone H2A; Provisional 99.26
PLN00156139 histone H2AX; Provisional 99.25
PLN00157132 histone H2A; Provisional 99.24
COG5150148 Class 2 transcription repressor NC2, beta subunit 99.2
smart0080365 TAF TATA box binding protein associated factor. TA 99.12
PTZ00252134 histone H2A; Provisional 99.12
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 99.08
PLN00035103 histone H4; Provisional 99.03
cd0007685 H4 Histone H4, one of the four histones, along wit 99.03
PTZ00015102 histone H4; Provisional 98.9
cd0798172 TAF12 TATA Binding Protein (TBP) Associated Factor 98.89
smart0041774 H4 Histone H4. 98.82
cd0804885 TAF11 TATA Binding Protein (TBP) Associated Factor 98.37
KOG1757131 consensus Histone 2A [Chromatin structure and dyna 98.37
smart00428105 H3 Histone H3. 98.33
PF0296966 TAF: TATA box binding protein associated factor (T 98.22
smart0057677 BTP Bromodomain transcription factors and PHD doma 98.12
cd07979117 TAF9 TATA Binding Protein (TBP) Associated Factor 98.06
PF15511414 CENP-T: Centromere kinetochore component CENP-T; P 98.01
cd08050 343 TAF6 TATA Binding Protein (TBP) Associated Factor 97.99
PF0471990 TAFII28: hTAFII28-like protein conserved region; I 97.98
PF0384768 TFIID_20kDa: Transcription initiation factor TFIID 97.98
PF0941572 CENP-X: CENP-S associating Centromere protein X; I 97.92
PLN00161135 histone H3; Provisional 97.8
PLN0016097 histone H3; Provisional 97.78
smart0042789 H2B Histone H2B. 97.78
KOG1658162 consensus DNA polymerase epsilon, subunit C [Repli 97.73
PF1563076 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 97.68
PLN00121136 histone H3; Provisional 97.63
PTZ00018136 histone H3; Provisional 97.62
PF0226993 TFIID-18kDa: Transcription initiation factor IID, 97.56
PLN00158116 histone H2B; Provisional 97.49
PTZ00463117 histone H2B; Provisional 97.42
cd0797892 TAF13 The TATA Binding Protein (TBP) Associated Fa 97.36
KOG3467103 consensus Histone H4 [Chromatin structure and dyna 97.26
KOG3219195 consensus Transcription initiation factor TFIID, s 97.19
PF15510102 CENP-W: Centromere kinetochore component W 97.06
PF0752477 Bromo_TP: Bromodomain associated; InterPro: IPR006 96.96
PLN0015558 histone H2A; Provisional 96.86
KOG1744127 consensus Histone H2B [Chromatin structure and dyn 96.81
KOG1142258 consensus Transcription initiation factor TFIID, s 96.71
KOG1745137 consensus Histones H3 and H4 [Chromatin structure 96.6
KOG2549 576 consensus Transcription initiation factor TFIID, s 95.32
KOG3423176 consensus Transcription initiation factor TFIID, s 95.19
PF02291129 TFIID-31kDa: Transcription initiation factor IID, 94.8
PF05236 264 TAF4: Transcription initiation factor TFIID compon 92.62
PF0354051 TFIID_30kDa: Transcription initiation factor TFIID 92.46
COG5095 450 TAF6 Transcription initiation factor TFIID, subuni 92.16
cd08045212 TAF4 TATA Binding Protein (TBP) Associated Factor 91.29
PF1333596 Mg_chelatase_2: Magnesium chelatase, subunit ChlI 90.89
KOG2389 353 consensus Predicted bromodomain transcription fact 87.19
COG5248126 TAF19 Transcription initiation factor TFIID, subun 86.17
KOG3901109 consensus Transcription initiation factor IID subu 84.53
KOG3334148 consensus Transcription initiation factor TFIID, s 83.06
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 81.62
PRK00411394 cdc6 cell division control protein 6; Reviewed 81.36
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 80.07
>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin Back     alignment and domain information 
Probab=99.88  E-value=3.1e-22  Score=121.03  Aligned_cols=64  Identities=48%  Similarity=0.614  Sum_probs=59.3

Q ss_pred             CCCHHHHHHHhhhcCCCcccccccHHHHHHHHHHHHHHHHHHHHHHHHhhCCCCeecHHHHHHHH
Q 047870           22 SLPLARIKKIMKKSGDDVKMISGEAPIVFSKACELFIEELTKRSWTMTMQGKRRTLLKDDVASAV   86 (102)
Q Consensus        22 ~lP~srVkrImK~~d~~~~~is~eA~~~l~ka~E~Fi~~l~~~A~~~a~~~~rktI~~~di~~av   86 (102)
                      .||+++|+|||| .+|++.++|+||.+++++|+|+|+++|+.+|++.|++++||||+|+||..||
T Consensus         2 ~lP~a~vkri~k-~~~~~~~vs~ea~~~i~~a~e~Fi~~l~~~A~~~a~~~~rkti~~~Dv~~Av   65 (65)
T PF00808_consen    2 SLPLARVKRIMK-SDPDVMRVSKEAVEAIAKAAEEFIQYLAKEANEIAQRDKRKTITYEDVAKAV   65 (65)
T ss_dssp             SS-HHHHHHHHH-HTSTTSEE-HHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSEE-HHHHHHHH
T ss_pred             CCChHHHHHHhc-cCCCccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCccCHHHHHHHC
Confidence            699999999999 8899999999999999999999999999999999999999999999999986

The factor is a heteromeric complex of A and B subunits, both of which are required for DNA-binding [, ]. The subunits can interact in the absence of DNA-binding, conserved regions in each being important in mediating this interaction. The A subunit can be split into 3 domains on the basis of sequence similarity, a non-conserved N-terminal 'A domain'; a highly-conserved central 'B domain' involved in DNA-binding; and a C-terminal 'C domain', which contains a number of glutamine and acidic residues involved in protein-protein interactions []. The A subunit shows striking similarity to the HAP3 subunit of the yeast CCAAT-binding heterotrimeric transcription factor [, ]. The Kluyveromyces lactis HAP3 protein has been predicted to contain a 4-cysteine zinc finger, which is thought to be present in similar HAP3 and CBF subunit A proteins, in which the third cysteine is replaced by a serine []. This domain is found in the CCAAT transcription factor and archaeal histones.; GO: 0043565 sequence-specific DNA binding, 0005622 intracellular; PDB: 1F1E_A 2BYM_D 2BYK_D 1HTA_A 1B67_A 1JFI_B 1KU5_B 1N1J_A 1BFM_A 1B6W_A ....
>COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] Back     alignment and domain information
>KOG1657 consensus CCAAT-binding factor, subunit C (HAP5) [Transcription] Back     alignment and domain information
>KOG1659 consensus Class 2 transcription repressor NC2, alpha subunit (DRAP1) [Transcription] Back     alignment and domain information
>COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] Back     alignment and domain information
>KOG0869 consensus CCAAT-binding factor, subunit A (HAP3) [Transcription] Back     alignment and domain information
>COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0870 consensus DNA polymerase epsilon, subunit D [Transcription] Back     alignment and domain information
>KOG0871 consensus Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] Back     alignment and domain information
>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1756 consensus Histone 2A [Chromatin structure and dynamics] Back     alignment and domain information
>smart00414 H2A Histone 2A Back     alignment and domain information
>PLN00154 histone H2A; Provisional Back     alignment and domain information
>PTZ00017 histone H2A; Provisional Back     alignment and domain information
>KOG1658 consensus DNA polymerase epsilon, subunit C [Replication, recombination and repair] Back     alignment and domain information
>PLN00153 histone H2A; Provisional Back     alignment and domain information
>PLN00156 histone H2AX; Provisional Back     alignment and domain information
>PLN00157 histone H2A; Provisional Back     alignment and domain information
>COG5150 Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] Back     alignment and domain information
>smart00803 TAF TATA box binding protein associated factor Back     alignment and domain information
>PTZ00252 histone H2A; Provisional Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>PLN00035 histone H4; Provisional Back     alignment and domain information
>cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution Back     alignment and domain information
>PTZ00015 histone H4; Provisional Back     alignment and domain information
>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>smart00417 H4 Histone H4 Back     alignment and domain information
>cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG1757 consensus Histone 2A [Chromatin structure and dynamics] Back     alignment and domain information
>smart00428 H3 Histone H3 Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information
>smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins Back     alignment and domain information
>cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex Back     alignment and domain information
>PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>PF09415 CENP-X: CENP-S associating Centromere protein X; InterPro: IPR018552 Centromere protein X (CENP-X) is a component of the CENP-S complex Back     alignment and domain information
>PLN00161 histone H3; Provisional Back     alignment and domain information
>PLN00160 histone H3; Provisional Back     alignment and domain information
>smart00427 H2B Histone H2B Back     alignment and domain information
>KOG1658 consensus DNA polymerase epsilon, subunit C [Replication, recombination and repair] Back     alignment and domain information
>PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C Back     alignment and domain information
>PLN00121 histone H3; Provisional Back     alignment and domain information
>PTZ00018 histone H3; Provisional Back     alignment and domain information
>PF02269 TFIID-18kDa: Transcription initiation factor IID, 18kD subunit; InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18) Back     alignment and domain information
>PLN00158 histone H2B; Provisional Back     alignment and domain information
>PTZ00463 histone H2B; Provisional Back     alignment and domain information
>cd07978 TAF13 The TATA Binding Protein (TBP) Associated Factor 13 (TAF13) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG3467 consensus Histone H4 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3219 consensus Transcription initiation factor TFIID, subunit TAF11 [Transcription] Back     alignment and domain information
>PF15510 CENP-W: Centromere kinetochore component W Back     alignment and domain information
>PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) Back     alignment and domain information
>PLN00155 histone H2A; Provisional Back     alignment and domain information
>KOG1744 consensus Histone H2B [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1142 consensus Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG1745 consensus Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2549 consensus Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG3423 consensus Transcription initiation factor TFIID, subunit TAF10 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>PF05236 TAF4: Transcription initiation factor TFIID component TAF4 family; InterPro: IPR007900 Accurate transcription initiation at protein-coding genes by RNA polymerase II requires the assembly of a multiprotein complex around the mRNA start site Back     alignment and domain information
>PF03540 TFIID_30kDa: Transcription initiation factor TFIID 23-30kDa subunit; InterPro: IPR003923 Transcription initiation factor TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors Back     alignment and domain information
>COG5095 TAF6 Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>cd08045 TAF4 TATA Binding Protein (TBP) Associated Factor 4 (TAF4) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF13335 Mg_chelatase_2: Magnesium chelatase, subunit ChlI Back     alignment and domain information
>KOG2389 consensus Predicted bromodomain transcription factor [Transcription] Back     alignment and domain information
>COG5248 TAF19 Transcription initiation factor TFIID, subunit TAF13 [Transcription] Back     alignment and domain information
>KOG3901 consensus Transcription initiation factor IID subunit [Transcription] Back     alignment and domain information
>KOG3334 consensus Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query102
4g91_C119 Ccaat-Binding Complex From Aspergillus Nidulans Len 7e-21
4awl_C94 The Nf-y Transcription Factor Is Structurally And F 6e-20
1n1j_B97 Crystal Structure Of The Nf-YbNF-Yc Histone Pair Le 7e-20
1jfi_A98 Crystal Structure Of The Nc2-Tbp-Dna Ternary Comple 1e-04
2byk_A140 Histone Fold Heterodimer Of The Chromatin Accessibi 9e-04
>pdb|4G91|C Chain C, Ccaat-Binding Complex From Aspergillus Nidulans Length = 119 Back     alignment and structure 
Iteration: 1

 Score = 95.5 bits (236), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 44/79 (55%), Positives = 60/79 (75%), Gaps = 1/79 (1%)
Query: 21  HSLPLARIKKIMKKSGDDVKMISGEAPIVFSKACELFIEELTKRSWTMTMQGKRRTLLKD 80
           H LPLARIKK+MK +  +VKMIS EAPI+F+K C++FI ELT R+W      KRRTL + 
Sbjct: 40  HQLPLARIKKVMK-ADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRS 98
Query: 81  DVASAVIATDIFDFLLTLV 99
           D+A+A+  +D+FDFL+ +V
Sbjct: 99  DIAAALSKSDMFDFLIDIV 117
>pdb|4AWL|C Chain C, The Nf-y Transcription Factor Is Structurally And Functionally A Sequence Specific Histone Length = 94 Back     alignment and structure
>pdb|1N1J|B Chain B, Crystal Structure Of The Nf-YbNF-Yc Histone Pair Length = 97 Back     alignment and structure
>pdb|1JFI|A Chain A, Crystal Structure Of The Nc2-Tbp-Dna Ternary Complex Length = 98 Back     alignment and structure
>pdb|2BYK|A Chain A, Histone Fold Heterodimer Of The Chromatin Accessibility Complex Length = 140 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query102
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 4e-27
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 9e-27
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 4e-25
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 1e-18
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 1e-16
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 5e-12
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 6e-11
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 1e-10
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 2e-04
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Length = 140 Back     alignment and structure
 Score = 95.9 bits (238), Expect = 4e-27
 Identities = 24/88 (27%), Positives = 40/88 (45%), Gaps = 2/88 (2%)

Query: 15  SGRAGTHSLPLARIKKIMKKSGDDVKMISGEAPIVFSKACELFIEELTKRSWTMT-MQGK 73
                   LPL+R++ IMK S  D  +I+ E   + +K  ELF+  L   ++T    Q  
Sbjct: 12  RPPTAETFLPLSRVRTIMKSS-MDTGLITNEVLFLMTKCTELFVRHLAGAAYTEEFGQRP 70

Query: 74  RRTLLKDDVASAVIATDIFDFLLTLVSE 101
              L  + ++  V      +FLL +V +
Sbjct: 71  GEALKYEHLSQVVNKNKNLEFLLQIVPQ 98
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 97 Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 98 Back     alignment and structure
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Length = 128 Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 93 Back     alignment and structure
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 179 Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Length = 68 Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Length = 70 Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Length = 111 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query102
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 99.96
4g92_C119 HAPE; transcription factor, nucleosome, minor groo 99.96
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 99.95
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 99.95
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 99.92
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 99.88
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 99.81
3b0c_W76 CENP-W, centromere protein W; histone fold, DNA bi 99.8
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 99.74
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 99.65
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 99.65
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 99.64
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 99.64
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 99.62
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 99.61
1f1e_A154 Histone fold protein; archaeal histone protein, DN 99.53
1f1e_A154 Histone fold protein; archaeal histone protein, DN 99.53
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 99.51
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 99.5
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 99.48
1tzy_D103 Histone H4-VI; histone-fold, tetramer-dimer-dimer, 99.41
2yfw_B103 Histone H4, H4; cell cycle, kinetochore, centromer 99.41
2hue_C84 Histone H4; mini beta sheet, elongated beta sandwh 99.36
1id3_B102 Histone H4; nucleosome core particle, chromatin, p 99.35
1taf_B70 TFIID TBP associated factor 62; transcription init 99.07
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 98.76
3v9r_A90 MHF1, uncharacterized protein YOL086W-A; histone f 98.7
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 98.67
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 98.64
4dra_A113 Centromere protein S; DNA binding complex, DNA dam 98.6
3r45_A156 Histone H3-like centromeric protein A; histone fol 98.57
3b0b_B107 CENP-S, centromere protein S; histone fold, DNA bi 98.54
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 98.52
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 98.45
1taf_A68 TFIID TBP associated factor 42; transcription init 98.44
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 98.41
3vh5_A140 CENP-S; histone fold, chromosome segregation, DNA 98.4
4dra_E84 Centromere protein X; DNA binding complex, DNA dam 98.34
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 98.14
2nqb_D123 Histone H2B; nucleosome, NCP, chromatin, structura 98.13
1tzy_B126 Histone H2B; histone-fold, tetramer-dimer-dimer, D 98.09
3b0b_C81 CENP-X, centromere protein X; histone fold, DNA bi 98.07
1bh9_B89 TAFII28; histone fold, tata binding protein, trans 98.06
1h3o_B76 Transcription initiation factor TFIID 20/15 kDa su 97.99
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 97.98
2jss_A 192 Chimera of histone H2B.1 and histone H2A.Z; histon 97.86
2l5a_A 235 Histone H3-like centromeric protein CSE4, protein 97.4
3v9r_B88 MHF2, uncharacterized protein YDL160C-A; histone f 96.47
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 91.25
3kw6_A78 26S protease regulatory subunit 8; structural geno 90.13
1wwi_A148 Hypothetical protein TTHA1479; structural genomics 89.28
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 87.78
2krk_A86 26S protease regulatory subunit 8; structural geno 86.26
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 85.11
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 84.18
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 82.19
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 80.96
2v1u_A387 Cell division control protein 6 homolog; DNA repli 80.55
1r4v_A171 Hypothetical protein AQ_328; structural genomics, 80.33
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
Probab=99.96  E-value=8.5e-30  Score=164.72  Aligned_cols=85  Identities=53%  Similarity=0.820  Sum_probs=77.1

Q ss_pred             CCCCCCCCCHHHHHHHhhhcCCCcccccccHHHHHHHHHHHHHHHHHHHHHHHHhhCCCCeecHHHHHHHHhcCCchhhh
Q 047870           16 GRAGTHSLPLARIKKIMKKSGDDVKMISGEAPIVFSKACELFIEELTKRSWTMTMQGKRRTLLKDDVASAVIATDIFDFL   95 (102)
Q Consensus        16 ~~~~~~~lP~srVkrImK~~d~~~~~is~eA~~~l~ka~E~Fi~~l~~~A~~~a~~~~rktI~~~di~~av~~~~~~~FL   95 (102)
                      .....+.||++||+|||| .++++.+||+||++++++|+|+|+++|+.+|++.|++++||||+|+||..||+++++|+||
T Consensus        13 ~~~~~~~lP~arIkrImK-~~~~~~~is~eA~~~laka~E~Fi~~l~~~A~~~a~~~krktI~~~di~~Av~~~e~~~FL   91 (97)
T 1n1j_B           13 KDFRVQELPLARIKKIMK-LDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFL   91 (97)
T ss_dssp             -------CCHHHHHHHHT-TSTTCCCBCTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHTTCGGGGGG
T ss_pred             CCcCCCcCCHHHHHHHHc-cCccccccChHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCccCCHHHHHHHHhcCcHHHHH
Confidence            456788999999999999 9999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhccC
Q 047870           96 LTLVSE  101 (102)
Q Consensus        96 ~d~vp~  101 (102)
                      .|+||+
T Consensus        92 ~divP~   97 (97)
T 1n1j_B           92 IDIVPR   97 (97)
T ss_dssp             TTTSCC
T ss_pred             HhhCCC
Confidence            999996
>4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... Back     alignment and structure
>2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} Back     alignment and structure
>2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B Back     alignment and structure
>1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Back     alignment and structure
>3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Back     alignment and structure
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Back     alignment and structure
>4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Back     alignment and structure
>3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Back     alignment and structure
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Back     alignment and structure
>1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A Back     alignment and structure
>4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* Back     alignment and structure
>1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... Back     alignment and structure
>3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D Back     alignment and structure
>1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* Back     alignment and structure
>1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3v9r_B MHF2, uncharacterized protein YDL160C-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>1wwi_A Hypothetical protein TTHA1479; structural genomics, unknown function, riken structural genomics/proteomics initiative, RSGI; 1.58A {Thermus thermophilus HB8} SCOP: a.22.1.4 PDB: 1wws_A Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1r4v_A Hypothetical protein AQ_328; structural genomics, all-alpha, histon fold, PSI, protein ST initiative, midwest center for structural genomics; HET: MSE; 1.90A {Aquifex aeolicus} SCOP: a.22.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 102
d1n1ja_87 a.22.1.3 (A:) Nuclear transcription factor Y subun 4e-24
d1n1jb_78 a.22.1.3 (B:) Nuclear transcription factor Y subun 5e-24
d2bykb189 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila 7e-23
d2byka172 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophil 2e-21
d1jfib_135 a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain 5e-21
d1jfia_66 a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chai 2e-19
d1ku5a_66 a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococc 1e-18
d1htaa_68 a.22.1.2 (A:) Archaeal histone {Archaeon Methanoth 3e-17
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 1e-16
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 2e-07
d1q9ca_172 a.22.1.3 (A:) Histone domain of Son of sevenless p 4e-06
d2huec182 a.22.1.1 (C:20-101) Histone H4 {African clawed fro 2e-04
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure

class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: TBP-associated factors, TAFs
domain: Nuclear transcription factor Y subunit beta (Nf-Yb3)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 85.7 bits (212), Expect = 4e-24
 Identities = 18/80 (22%), Positives = 34/80 (42%)

Query: 22  SLPLARIKKIMKKSGDDVKMISGEAPIVFSKACELFIEELTKRSWTMTMQGKRRTLLKDD 81
            LP+A + +IMK +      I+ +A     +    FI  +T  +     Q KR+T+  +D
Sbjct: 2   YLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGED 61

Query: 82  VASAVIATDIFDFLLTLVSE 101
           +  A+       ++  L   
Sbjct: 62  ILFAMSTLGFDSYVEPLKLY 81
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 89 Back     information, alignment and structure
>d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 72 Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Length = 66 Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Length = 68 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 82 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query102
d1n1jb_78 Nuclear transcription factor Y subunit gamma (Nf-Y 99.97
d1n1ja_87 Nuclear transcription factor Y subunit beta (Nf-Yb 99.93
d2byka172 Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax 99.92
d1jfia_66 Negative cofactor 2, NC2, alpha chain {Human (Homo 99.91
d1jfib_135 Negative cofactor 2, NC2, beta chain {Human (Homo 99.91
d2bykb189 Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax 99.9
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 99.83
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 99.78
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 99.6
d1u35c1106 macro-H2A.1, histone domain {Human (Homo sapiens) 99.36
d1f66c_103 Histone H2A {Human (Homo sapiens), variant H2A.Z [ 99.33
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 99.33
d1tzya_106 Histone H2A {Chicken (Gallus gallus), erythrocytes 99.32
d1q9ca_172 Histone domain of Son of sevenless protein {Human 99.29
d2huec182 Histone H4 {African clawed frog (Xenopus laevis) [ 99.08
d1tzyc_95 Histone H3 {Chicken (Gallus gallus), erythrocytes 98.21
d1tafb_70 TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta 98.1
d1bh9b_89 TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} 98.05
d1tzyb_92 Histone H2B {Chicken (Gallus gallus), erythrocytes 97.93
d1h3ob_74 TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom 97.8
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 95.47
d1tafa_68 TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta 94.81
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 93.55
d1wwia1148 Hypothetical protein TTHA1479 {Thermus thermophilu 91.36
d1q9ca_172 Histone domain of Son of sevenless protein {Human 88.23
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: TBP-associated factors, TAFs
domain: Nuclear transcription factor Y subunit gamma (Nf-Yc2)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=3.5e-31  Score=163.36  Aligned_cols=78  Identities=58%  Similarity=0.907  Sum_probs=77.0

Q ss_pred             CCHHHHHHHhhhcCCCcccccccHHHHHHHHHHHHHHHHHHHHHHHHhhCCCCeecHHHHHHHHhcCCchhhhhhhccC
Q 047870           23 LPLARIKKIMKKSGDDVKMISGEAPIVFSKACELFIEELTKRSWTMTMQGKRRTLLKDDVASAVIATDIFDFLLTLVSE  101 (102)
Q Consensus        23 lP~srVkrImK~~d~~~~~is~eA~~~l~ka~E~Fi~~l~~~A~~~a~~~~rktI~~~di~~av~~~~~~~FL~d~vp~  101 (102)
                      ||++||||||| .+|+++++|+||++++++|+|+|+++|+++|++.|++++||||+|+||..|+++.++|+||.|+||+
T Consensus         1 LP~srVkrImK-~~~~~~~is~ea~~~i~~a~E~Fi~~l~~~A~~~a~~~~rkti~~~dl~~av~~~~~~~FL~d~vPk   78 (78)
T d1n1jb_           1 LPLARIKKIMK-LDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR   78 (78)
T ss_dssp             CCHHHHHHHHT-TSTTCCCBCTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHTTCGGGGGGTTTSCC
T ss_pred             CCHHHHHHHHh-cCCcccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcCCHHHHHHHHhcCChhHHHHHhCCC
Confidence            79999999999 9999999999999999999999999999999999999999999999999999999999999999996
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1wwia1 a.22.1.4 (A:1-148) Hypothetical protein TTHA1479 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure