Citrus Sinensis ID: 047927


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000-----
MVLVSGQCQSDQQSLLLQMKSRLTFDSSVSFRMVQWSQSNDCCTWSGVDCDEAGRVIGLDLSEESISAGIDNSSSLFSLKYLQSLNLAFNMFNATEIPSGLGNLTNLTTLNLSNAGFAGQIPIQVSGMTRLVTLDLSGMYFVRAPLKLENPNLSGLLQNLAELRELYLDGVNISAPGIEWCQALSSLVPKLQVLSLSGCFLSGPVDPSLSNLRSLSVIRLDMNDLYSPVPEFLADFSNLTSLYLSSCGLHGAFPEKILQLPTLETLDLSYNELLQGSLPDFHQNLSLETLILSATNFSGILPDSIKNLKNLSRVEFYLCNFNGPIPTSMSDLSQLVYLDMSFNHFSGPIPSLHMFRNLAYLDLSYNIFTGGISSIGWEQLLNLFHVDLSHNNLGGSIPQSLFELPMVQHLLLADNQFDGHVTEISNASSSLLDTLDLSDNNLEGPIPLSFFELKNLKILLLSSNKFVGTIELDAIQRLRNLFRLDLSYNRLAVVAGSSVYCFPPLLTTLSLASCKLSAIPNLRKQTKLYHLDLSDNQISGEIPNWLWKIGKDSFNHLNLSHNLLVSLEQPYSISDLTSLSVLDLHSNQIQGKIPPLPPNAAYVDYSGNNFTSSIPVDIGSFMSLSIFFSFSKNSLTGVIPESICNATNLLVLDLSYNYLSGMIPTCLINMSDSQLGVLNLRRNNLNGTVSATFPANCSLRTLDLNGNQLEGMVPKSLANCSVLEILDLGNNQFDDTFPCWVKNASRLHVLILRSNNFFGNISCPRYNVSWPMLQIIDLASNKFSGRLPQKWLLNLEAMMVDEGRSQSELKHLQYRFLNLSQAYYQDAITVTIKGLEMKLAKILNIFTSIDFSRNNFEGPIPEEMGLLQSLCALNLSHNALTGSIPSLIGNLREIESLDLSMNNLSGTIPAQLASLNFLSVLNLSYNHLVGRIPTSTQLQSFLATSFEGNDRLWGPPLNVCPTNSSKALPSAPASTDEIDWFFMAMAIGFAVGFGSVVAPLMFSRK
cEEEEccccHHHHHHHHHHHcccccccccccccccccccccccccccEEEcccccEEEEEcccccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccHHHHccccccccEEEcccccccccccHHHHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccHHccccccccEEEccccccEEEcccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccHHHHcccccccEEEccccEEEEEEccccccccccccEEEcccccccccccccccccccEEEcccccccccccHHHHHHccccccEEEccccccccccccccccccccccEEEccccccccccccccccccEEEccccccccccccccccccccEEEEEccccccEEcccccccccccccEEEcccccccccccHHHHHcccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHHcccccEEEcccccccccccHHHHccccccEEEccccccEEEccccccccccccccEEEcccccccccccHHHHccccccccccccccccccEEEEEEccccccEEEEEEEEEEcccHHHHHHHccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEHHHHHHHHHHHHHHEEEcc
ccccccccccHHHHHHHHHHHHcccccccccHccccccccccccEEEEEEccccEEEEEEcccccccccccccHHHHcHHHHcEEEccccccccccccHHHcccccccEEEcccccccccccHHHHcccccEEEEcccccccccccccccccHHHHHHHcccccEEEcccccccccccHHHHHHHccccccEEEEcccccccccccHHHHcccccEEEEcccccccccccHHHHccccccEEEEccccccccccHHHHcccccEEEEEccccccccccccHccccccEEEEEccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccEEEEEccccccccccHHHHHHcccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccccEEEcccccccccccHHHHccccccEEEEccccccccccHHHHHHHccccEEEccccccccccccccccccHHHHHHHHHccccccccccccccccEEEEcccccccccccHHHHccccccEEEEEcccccccccccccccccccccEEEEcccccccccccccccccEEEEEccccccccccHHHccccccEEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHcccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHcccccEEEEcccccccccccHHHccccccEEEEEEcccccccccccccccccccEEEEEEccccccccccHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEEcccccHHHHHHccEEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcc
mvlvsgqcqsDQQSLLLQMKSRLTFDSSVSFRMVQwsqsndcctwsgvdcdeagrvigldlseesisagidnsssLFSLKYLQSLNLAFNMFnateipsglgnltnlttlnlsnagfagqipiqvsGMTRLVTLDLsgmyfvraplklenpnlSGLLQNLAELRELYLdgvnisapgIEWCQALSSLVpklqvlslsgcflsgpvdpslsnlrslSVIRLdmndlyspvpefLADFSNLTSLYLsscglhgafpekilqlptletLDLSYNELlqgslpdfhqnLSLETLILSATNFSGILPDSIKNLKNLSRVEFYLcnfngpiptsmsdlSQLVYLDMsfnhfsgpipslhmfrNLAYLDLSYNIFTGGISSIGWEQLLNLFHVDLshnnlggsipqslfelPMVQHLLLadnqfdghvTEISNAssslldtldlsdnnlegpiplsffELKNLKILLLSSNKFVGTIELDAIQRLRNLFRLDLSYNRLAvvagssvycfppllttLSLAScklsaipnlrkqtklyhldlsdnqisgeipnwlwkigkdsfnhlnlshnllvsleqpysisdltslsvldlhsnqiqgkipplppnaayvdysgnnftssipvdigsFMSLSIFFSFsknsltgvipesicnATNLLVLDLSYNylsgmiptclinmsdsqlgVLNLrrnnlngtvsatfpancslrtldlngnqlegmvpkslanCSVLEIldlgnnqfddtfpcwvknasRLHVLILRSnnffgniscprynvswpmLQIIDLAsnkfsgrlpqKWLLNLEAMMVDEGRSQSELKHLQYRFLNLSQAYYQDAITVTIKGLEMKLAKILNIFTSidfsrnnfegpipeEMGLLQSLCALNlshnaltgsipsliGNLREIESLDlsmnnlsgtipAQLASLNFLSVLNLSYNhlvgriptstqLQSFLATsfegndrlwgpplnvcptnsskalpsapastdEIDWFFMAMAIGFAVGFGSvvaplmfsrk
mvlvsgqcqsdqQSLLLQMKSRLTFDSSVSFRMVQWSQSNDCCTWSGVDCDEAGRVIGLDLSEESISAGIDNSSSLFSLKYLQSLNLAFNMFNATEIPSGLGNLTNLTTLNLSNAGFAGQIPIQVSGMTRLVTLDLSGMYFVRAPLKLENPNLSGLLQNLAELRELYLDGVNISAPGIEWCQALSSLVPKLQVLSLSGCFLSGPVDPSLSNLRSLSVIRLDMNDLYSPVPEFLADFSNLTSLYLSSCGLHGAFPEKILQLPTLETLDLSYNELLQGSLPDFHQNLSLETLILSATNFSGILPDSIKNLKNLSRVEFYLCNFNGPIPTSMSDLSQLVYLDMSFNHFSGPIPSLHMFRNLAYLDLSYNIFTGGISSIGWEQLLNLFHVDLSHNNLGGSIPQSLFELPMVQHLLLADNQFDGHVTEISNASSSLLDTLDLSDNNLEGPIPLSFFELKNLKILLLSSNKFVGTIELDAIQRLRNLFRLDLSYNRLAVVAGSSVYCFPPLLTTLSLASCKLSAIPNLRKQTKLYHLDLSDNQISGEIPNWLWKIGKDSFNHLNLSHNLLVSLEQPYSISDLTSLSVLDLHSNQIQGKIPPLPPNAAYVDYSGNNFTSSIPVDIGSFMSLSIFFSFSKNSLTGVIPESICNATNLLVLDLSYNYLSGMIPTCLINMSDSQLGVLNLRRNNLNGTVSATFPANCSLRTLDLNGNQLEGMVPKSLANCSVLEILDLGNNQFDDTFPCWVKNASRLHVLILRSNNFFGNISCPRYNVSWPMLQIIDLASNKFSGRLPQKWLLNLEAMMVDEGRSQSELKHLQYRFLNLSQAYYQDAITVTIKGLEMKLAKILNIFTSIDFSRNNFEGPIPEEMGLLQSLCALNLSHNALTGSIPSLIGNLREIESLDLSMNNLSGTIPAQLASLNFLSVLNLSYNHLVGRIPTSTQLQSFLATSFEGNDRLWGPPLNVCPTNSSKALPSAPASTDEIDWFFMAMAIGFAVGFGSVVAPLMFSRK
MVLVsgqcqsdqqslllqMKSRLTFDSSVSFRMVQWSQSNDCCTWSGVDCDEAGRVIGLDLSEESISAGIDNSSSLFSLKYLQSLNLAFNMFNATEIPsglgnltnlttlnlsnAGFAGQIPIQVSGMTRLVTLDLSGMYFVRAPLKLENPNLSGLLQNLAELRELYLDGVNISAPGIEWCQALSSLVPKLQVLSLSGCFLSGPVDPSLSNLRSLSVIRLDMNDLYSPVPEFLADFSNLTSLYLSSCGLHGAFPEKILQLPTLETLDLSYNELLQGSLPDFHQNLSLETLILSATNFSGILPDSIKNLKNLSRVEFYLCNFNGPIPTSMSDLSQLVYLDMSFNHFSGPIPSLHMFRNLAYLDLSYNIFTGGISSIGWEQLLNLFHVDLSHNNLGGSIPQSLFELPMVQHLLLADNQFDGHVTEIsnassslldtldlsdnnlEGPIPLSFFElknlkilllssnkFVGTIELDAIQRLRNLFRLDLSYNRLAVVAGSSVYCFPPLLTTLSLASCKLSAIPNLRKQTKLYHLDLSDNQISGEIPNWLWKIGKDSFnhlnlshnllvslEQPYSISDLTSLSVLDLHSNQIQGKIPPLPPNAAYVDYSGNNFTSSIPVDIGsfmslsiffsfsKNSLTGVIPESICNATNLLVLDLSYNYLSGMIPTCLINMSDSQlgvlnlrrnnlngTVSATFPANCSLRTLDLNGNQLEGMVPKSLANCSVLEILDLGNNQFDDTFPCWVKNASRLHVLILRSNNFFGNISCPRYNVSWPMLQIIDLASNKFSGRLPQKWLLNLEAMMVDEGRSQSELKHLQYRFLNLSQAYYQDAITVTIKGLEMKLAKILNIFTSIDFSRNNFEGPIPEEMGLLQSLCALNLSHNALTGSIPSLIGNLREIESLDLSMNNLSGTIPAQLASLNFLSVLNLSYNHLVGRIPTSTQLQSFLATSFEGNDRLWGPPLNVCPTNSSKALPSAPASTDEIDWFFMAMAIGFAVGFGSVVAPLMFSRK
*********************RLTFDSSVSFRMVQWSQSNDCCTWSGVDCDEAGRVIGLDLSEESISAGIDNSSSLFSLKYLQSLNLAFNMFNATEIPSGLGNLTNLTTLNLSNAGFAGQIPIQVSGMTRLVTLDLSGMYFVRAPLKLENPNLSGLLQNLAELRELYLDGVNISAPGIEWCQALSSLVPKLQVLSLSGCFLSGPVDPSLSNLRSLSVIRLDMNDLYSPVPEFLADFSNLTSLYLSSCGLHGAFPEKILQLPTLETLDLSYNELLQGSLPDFHQNLSLETLILSATNFSGILPDSIKNLKNLSRVEFYLCNFNGPIPTSMSDLSQLVYLDMSFNHFSGPIPSLHMFRNLAYLDLSYNIFTGGISSIGWEQLLNLFHVDLSHNNLGGSIPQSLFELPMVQHLLLADNQFDGHVTEISNASSSLLDTLDLSDNNLEGPIPLSFFELKNLKILLLSSNKFVGTIELDAIQRLRNLFRLDLSYNRLAVVAGSSVYCFPPLLTTLSLASCKLSAIPNLRKQTKLYHLDLSDNQISGEIPNWLWKIGKDSFNHLNLSHNLLVSLEQPYSISDLTSLSVLDLHSNQIQGKIPPLPPNAAYVDYSGNNFTSSIPVDIGSFMSLSIFFSFSKNSLTGVIPESICNATNLLVLDLSYNYLSGMIPTCLINMSDSQLGVLNLRRNNLNGTVSATFPANCSLRTLDLNGNQLEGMVPKSLANCSVLEILDLGNNQFDDTFPCWVKNASRLHVLILRSNNFFGNISCPRYNVSWPMLQIIDLASNKFSGRLPQKWLLNLEAMMVDEGRSQSELKHLQYRFLNLSQAYYQDAITVTIKGLEMKLAKILNIFTSIDFSRNNFEGPIPEEMGLLQSLCALNLSHNALTGSIPSLIGNLREIESLDLSMNNLSGTIPAQLASLNFLSVLNLSYNHLVGRIPTSTQLQSFLATSFEGNDRLWGPPLNVC***************DEIDWFFMAMAIGFAVGFGSVVAPLMF***
MVLVSGQCQSDQQSLLLQMKSRLTFDSSVSFRMVQWSQSNDCCTWSGVDCDEAGRVIGLDLSEESISAGIDNSSSLFSLKYLQSLNLAFNMFNATEIPSGLGNLTNLTTLNLSNAGFAGQIPIQVSGMTRLVTLDLSGMYFVRAPLKLENPNLSGLLQNLAELRELYLDGVNISAPGIEWCQALSSLVPKLQVLSLSGCFLSGPVDPSLSNLRSLSVIRLDMNDLYSPVPEFLADFSNLTSLYLSSCGLHGAFPEKILQLPTLETLDLSYNELLQGSLPDFHQNLSLETLILSATNFSGILPDSIKNLKNLSRVEFYLCNFNGPIPTSMSDLSQLVYLDMSFNHFSGPIPSLHMFRNLAYLDLSYNIFTGGISSIGWEQLLNLFHVDLSHNNLGGSIPQSLFELPMVQHLLLADNQFDGHVTEISNASSSLLDTLDLSDNNLEGPIPLSFFELKNLKILLLSSNKFVGTIELDAIQRLRNLFRLDLSYNRLAVVAGSSVYCFPPLLTTLSLASCKLSAIPNLRKQTKLYHLDLSDNQISGEIPNWLWKIGKDSFNHLNLSHNLLVSLEQPYSISDLTSLSVLDLHSNQIQGKIPPLPPNAAYVDYSGNNFTSSIPVDIGSFMSLSIFFSFSKNSLTGVIPESICNATNLLVLDLSYNYLSGMIPTCLINMSDSQLGVLNLRRNNLNGTVSATFPANCSLRTLDLNGNQLEGMVPKSLANCSVLEILDLGNNQFDDTFPCWVKNASRLHVLILRSNNFFGNISCPRYNVSWPMLQIIDLASNKFSGRLPQKWLLNLEAMMVDEG**QSELKHLQYRFLNLSQAYYQDAITVTIKGLEMKLAKILNIFTSIDFSRNNFEGPIPEEMGLLQSLCALNLSHNALTGSIPSLIGNLREIESLDLSMNNLSGTIPAQLASLNFLSVLNLSYNHLVGRIPTSTQLQSFLATSFEGNDRLWG***************************FMAMAIGFAVGFGSVVAPLMFSRK
************QSLLLQMKSRLTFDSSVSFRMVQWSQSNDCCTWSGVDCDEAGRVIGLDLSEESISAGIDNSSSLFSLKYLQSLNLAFNMFNATEIPSGLGNLTNLTTLNLSNAGFAGQIPIQVSGMTRLVTLDLSGMYFVRAPLKLENPNLSGLLQNLAELRELYLDGVNISAPGIEWCQALSSLVPKLQVLSLSGCFLSGPVDPSLSNLRSLSVIRLDMNDLYSPVPEFLADFSNLTSLYLSSCGLHGAFPEKILQLPTLETLDLSYNELLQGSLPDFHQNLSLETLILSATNFSGILPDSIKNLKNLSRVEFYLCNFNGPIPTSMSDLSQLVYLDMSFNHFSGPIPSLHMFRNLAYLDLSYNIFTGGISSIGWEQLLNLFHVDLSHNNLGGSIPQSLFELPMVQHLLLADNQFDGHVTEISNASSSLLDTLDLSDNNLEGPIPLSFFELKNLKILLLSSNKFVGTIELDAIQRLRNLFRLDLSYNRLAVVAGSSVYCFPPLLTTLSLASCKLSAIPNLRKQTKLYHLDLSDNQISGEIPNWLWKIGKDSFNHLNLSHNLLVSLEQPYSISDLTSLSVLDLHSNQIQGKIPPLPPNAAYVDYSGNNFTSSIPVDIGSFMSLSIFFSFSKNSLTGVIPESICNATNLLVLDLSYNYLSGMIPTCLINMSDSQLGVLNLRRNNLNGTVSATFPANCSLRTLDLNGNQLEGMVPKSLANCSVLEILDLGNNQFDDTFPCWVKNASRLHVLILRSNNFFGNISCPRYNVSWPMLQIIDLASNKFSGRLPQKWLLNLEAMMVDEGRSQSELKHLQYRFLNLSQAYYQDAITVTIKGLEMKLAKILNIFTSIDFSRNNFEGPIPEEMGLLQSLCALNLSHNALTGSIPSLIGNLREIESLDLSMNNLSGTIPAQLASLNFLSVLNLSYNHLVGRIPTSTQLQSFLATSFEGNDRLWGPPLNVCPTNS*********STDEIDWFFMAMAIGFAVGFGSVVAPLMFSRK
*VL*SGQCQSDQQSLLLQMKSRLTFDSSVSFRMVQWSQSNDCCTWSGVDCDEAGRVIGLDLSEESISAGIDNSSSLFSLKYLQSLNLAFNMFNATEIPSGLGNLTNLTTLNLSNAGFAGQIPIQVSGMTRLVTLDLSGMYFVRAPLKLENPNLSGLLQNLAELRELYLDGVNISAPGIEWCQALSSLVPKLQVLSLSGCFLSGPVDPSLSNLRSLSVIRLDMNDLYSPVPEFLADFSNLTSLYLSSCGLHGAFPEKILQLPTLETLDLSYNELLQGSLPDFHQNLSLETLILSATNFSGILPDSIKNLKNLSRVEFYLCNFNGPIPTSMSDLSQLVYLDMSFNHFSGPIPSLHMFRNLAYLDLSYNIFTGGISSIGWEQLLNLFHVDLSHNNLGGSIPQSLFELPMVQHLLLADNQFDGHVTEISNASSSLLDTLDLSDNNLEGPIPLSFFELKNLKILLLSSNKFVGTIELDAIQRLRNLFRLDLSYNRLAVVAGSSVYCFPPLLTTLSLASCKLSAIPNLRKQTKLYHLDLSDNQISGEIPNWLWKIGKDSFNHLNLSHNLLVSLEQPYSISDLTSLSVLDLHSNQIQGKIPPLPPNAAYVDYSGNNFTSSIPVDIGSFMSLSIFFSFSKNSLTGVIPESICNATNLLVLDLSYNYLSGMIPTCLINMSDSQLGVLNLRRNNLNGTVSATFPANCSLRTLDLNGNQLEGMVPKSLANCSVLEILDLGNNQFDDTFPCWVKNASRLHVLILRSNNFFGNISCPRYNVSWPMLQIIDLASNKFSGRLPQKWLLNLEAMMVDEGRSQSELKHLQYRFLNLSQAYYQDAITVTIKGLEMKLAKILNIFTSIDFSRNNFEGPIPEEMGLLQSLCALNLSHNALTGSIPSLIGNLREIESLDLSMNNLSGTIPAQLASLNFLSVLNLSYNHLVGRIPTSTQLQSFLATSFEGNDRLWGPPLNVCP**************DEIDWFFMAMAIGFAVGFGSVVAPLMFSRK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLVSGQCQSDQQSLLLQMKSRLTFDSSVSFRMVQWSQSNDCCTWSGVDCDEAGRVIGLDLSEESISAGIDNSSSLFSLKYLQSLNLAFNMFNATEIPSGLGNLTNLTTLNLSNAGFAGQIPIQVSGMTRLVTLDLSGMYFVRAPLKLENPNLSGLLQNLAELRELYLDGVNISAPGIEWCQALSSLVPKLQVLSLSGCFLSGPVDPSLSNLRSLSVIRLDMNDLYSPVPEFLADFSNLTSLYLSSCGLHGAFPEKILQLPTLETLDLSYNELLQGSLPDFHQNLSLETLILSATNFSGILPDSIKNLKNLSRVEFYLCNFNGPIPTSMSDLSQLVYLDMSFNHFSGPIPSLHMFRNLAYLDLSYNIFTGGISSIGWEQLLNLFHVDLSHNNLGGSIPQSLFELPMVQHLLLADNQFDGHVTEISNASSSLLDTLDLSDNNLEGPIPLSFFELKNLKILLLSSNKFVGTIELDAIQRLRNLFRLDLSYNRLAVVAGSSVYCFPPLLTTLSLASCKLSAIPNLRKQTKLYHLDLSDNQISGEIPNWLWKIGKDSFNHLNLSHNLLVSLEQPYSISDLTSLSVLDLHSNQIQGKIPPLPPNAAYVDYSGNNFTSSIPVDIGSFMSLSIFFSFSKNSLTGVIPESICNATNLLVLDLSYNYLSGMIPTCLINMSDSQLGVLNLRRNNLNGTVSATFPANCSLRTLDLNGNQLEGMVPKSLANCSVLEILDLGNNQFDDTFPCWVKNASRLHVLILRSNNFFGNISCPRYNVSWPMLQIIDLASNKFSGRLPQKWLLNLEAMMVDEGRSQSELKHLQYRFLNLSQAYYQDAITVTIKGLEMKLAKILNIFTSIDFSRNNFEGPIPEEMGLLQSLCALNLSHNALTGSIPSLIGNLREIESLDLSMNNLSGTIPAQLASLNFLSVLNLSYNHLVGRIPTSTQLQSFLATSFEGNDRLWGPPLNVCPTNSSKALPSAPASTDEIDWFFMAMAIGFAVGFGSVVAPLMFSRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1005 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.690 0.819 0.361 1e-92
C0LGQ5 1249 LRR receptor-like serine/ no no 0.850 0.684 0.308 8e-79
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.720 0.578 0.330 2e-74
Q9FL28 1173 LRR receptor-like serine/ no no 0.690 0.591 0.333 1e-67
Q9LVP0 1102 Probable leucine-rich rep no no 0.641 0.585 0.307 4e-62
O49318 1124 Probable leucine-rich rep no no 0.634 0.567 0.303 7e-62
Q9LYN8 1192 Leucine-rich repeat recep no no 0.640 0.540 0.312 1e-58
C0LGS2 1136 Probable LRR receptor-lik no no 0.613 0.543 0.319 3e-58
O82318 960 Probably inactive leucine no no 0.564 0.590 0.342 1e-55
Q9SHI2 1101 Leucine-rich repeat recep no no 0.650 0.594 0.307 6e-55
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  342 bits (876), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 262/724 (36%), Positives = 372/724 (51%), Gaps = 30/724 (4%)

Query: 287 LETLILSATNFSGILPDSIKNLKNLSRVEFYLCNFNGPIPTSMSDLSQLVYLDMSFNHFS 346
           L  L L+  N  G +P S+ NL +L+ V  Y   F G IP S+ +L+QL +L ++ N  +
Sbjct: 112 LRHLDLTNCNLYGEIPSSLGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILANNVLT 171

Query: 347 GPIPS-LHMFRNLAYLDLSYNIFTGGI-SSIGWEQLLNLFHVDLSHNNLGGSIPQSLFEL 404
           G IPS L     L  L+L  N   G I  SIG   L  L ++ L+ NNL G IP SL  L
Sbjct: 172 GEIPSSLGNLSRLVNLELFSNRLVGKIPDSIG--DLKQLRNLSLASNNLIGEIPSSLGNL 229

Query: 405 PMVQHLLLADNQFDGHV-TEISNASSSLLDTLDLSDNNLEGPIPLSFFELKNLKILLLSS 463
             + HL+L  NQ  G V   I N     L  +   +N+L G IP+SF  L  L I +LSS
Sbjct: 230 SNLVHLVLTHNQLVGEVPASIGNLIE--LRVMSFENNSLSGNIPISFANLTKLSIFVLSS 287

Query: 464 NKFVGTIELDAIQRLRNLFRLDLSYNRLAVVAGSSVYCFPPLLTTLSLASCKLSA---IP 520
           N F  T   D +    NL   D+SYN  +     S+   P L  ++ L   + +      
Sbjct: 288 NNFTSTFPFD-MSIFHNLEYFDVSYNSFSGPFPKSLLLIPSL-ESIYLQENQFTGPIEFA 345

Query: 521 NLRKQTKLYHLDLSDNQISGEIPNWLWKIGKDSFNHLNLSHNLLVSLEQPYSISDLTSLS 580
           N    TKL  L L  N++ G IP  + ++   +   L++SHN       P +IS L +L 
Sbjct: 346 NTSSSTKLQDLILGRNRLHGPIPESISRLL--NLEELDISHNNFTGAIPP-TISKLVNLL 402

Query: 581 VLDLHSNQIQGKIPPLPPNAAYVDYSGNNFTSSIPVDIGSFMSLSIFFSFSKNSLTGVIP 640
            LDL  N ++G++P        +  S N+F+S    +     +L      + NS  G IP
Sbjct: 403 HLDLSKNNLEGEVPACLWRLNTMVLSHNSFSSF--ENTSQEEALIEELDLNSNSFQGPIP 460

Query: 641 ESICNATNLLVLDLSYNYLSGMIPTCLINMSDSQLGVLNLRRNNLNGTVSATFPANCSLR 700
             IC  ++L  LDLS N  SG IP+C+ N S S +  LNL  NN +GT+   F     L 
Sbjct: 461 YMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGS-IKELNLGDNNFSGTLPDIFSKATELV 519

Query: 701 TLDLNGNQLEGMVPKSLANCSVLEILDLGNNQFDDTFPCWVKNASRLHVLILRSNNFFGN 760
           +LD++ NQLEG  PKSL NC  LE++++ +N+  D FP W+++   LHVL LRSN F+G 
Sbjct: 520 SLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRSNKFYGP 579

Query: 761 ISCPRYNVSWPMLQIIDLASNKFSGRLPQKWLLNLEAMMVDEGRSQSELKHLQYRFLNLS 820
           +     ++ +  L+IID++ N FSG LP  +  N + M         E+      F   +
Sbjct: 580 LYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTT----LTEEMDQYMTEFWRYA 635

Query: 821 QAYYQDAITVTIKGLEMKLAKILNIFTSIDFSRNNFEGPIPEEMGLLQSLCALNLSHNAL 880
            +YY +   V  KG++M   +I   F +IDFS N   G IPE +G L+ L  LNLS NA 
Sbjct: 636 DSYYHEMEMVN-KGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAF 694

Query: 881 TGSIPSLIGNLREIESLDLSMNNLSGTIPAQLASLNFLSVLNLSYNHLVGRIPTSTQLQS 940
           T  IP  + NL ++E+LD+S N LSG IP  LA+L+FLS +N S+N L G +P  TQ Q 
Sbjct: 695 TSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQR 754

Query: 941 FLATSFEGNDRLWGPPLNVC----PTNSSKALPSAPASTDE--IDWFFMAMAIGFAVGFG 994
              +SF  N  L+G   ++C      N +  LP   +  +E   +W   A+A G  V  G
Sbjct: 755 QKCSSFLDNPGLYGLE-DICRDTGALNPTSQLPEDLSEAEENMFNWVAAAIAYGPGVLCG 813

Query: 995 SVVA 998
            V+ 
Sbjct: 814 LVIG 817




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1005
3594812981070 PREDICTED: LRR receptor-like serine/thre 0.995 0.934 0.584 0.0
3594813001054 PREDICTED: leucine-rich repeat receptor 0.991 0.944 0.581 0.0
359481293 1197 PREDICTED: leucine-rich repeat receptor 0.996 0.836 0.582 0.0
3594813041057 PREDICTED: LRR receptor-like serine/thre 0.996 0.947 0.563 0.0
1478060631032 hypothetical protein VITISV_032508 [Viti 0.979 0.953 0.581 0.0
3594812961075 PREDICTED: receptor-like protein 12-like 0.997 0.932 0.574 0.0
2241391841032 predicted protein [Populus trichocarpa] 0.990 0.964 0.560 0.0
214011438 1128 GbVe [Gossypium barbadense] 0.988 0.880 0.561 0.0
237899607 1139 verticillium wilt disease resistance pro 0.995 0.877 0.542 0.0
2555793021060 serine/threonine-protein kinase bri1, pu 0.993 0.941 0.543 0.0
>gi|359481298|ref|XP_003632604.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1099 bits (2843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/1016 (58%), Positives = 729/1016 (71%), Gaps = 16/1016 (1%)

Query: 1    MVLVSGQCQSD-------QQSLLLQMKSRLTFDSSVSFRMVQWSQSNDCCTWSGVDCDEA 53
            + LVSG+C SD       Q SLLLQ+K+ L F+ + S ++V W+ S DCC+W GV  D  
Sbjct: 23   VALVSGECLSDGSICLEDQMSLLLQLKNTLKFNVAASSKLVSWNPSMDCCSWGGVTWDAT 82

Query: 54   GRVIGLDLSEESISAGIDNSSSLFSLKYLQSLNLAFNMFNATEIPSGLGNLTNLTTLNLS 113
            G V+ LDLS +SI  G +N+SS+FSL+YLQSLNLA N FN+++IPSG G L NL  LNLS
Sbjct: 83   GHVVALDLSSQSIYGGFNNTSSIFSLQYLQSLNLADNSFNSSQIPSGFGKLGNLMYLNLS 142

Query: 114  NAGFAGQIPIQVSGMTRLVTLDLSGMYFVRAPLKLENPNLSGLLQNLAELRELYLDGVNI 173
            NAGF+GQIPI+VS +T+LVT+D S  Y     LKLENPNL  L+QNL ELRELYL+GVNI
Sbjct: 143  NAGFSGQIPIEVSCLTKLVTIDFSVFYLGVPTLKLENPNLRMLVQNLTELRELYLNGVNI 202

Query: 174  SAPGIEWCQALSSLVPKLQVLSLSGCFLSGPVDPSLSNLRSLSVIRLDMNDLYSPVPEFL 233
            SA G EWCQALSS VP LQVLSL  C+LSGP+D SL  LRSLS IRLD N+  +PVPEFL
Sbjct: 203  SAQGKEWCQALSSSVPNLQVLSLPSCYLSGPLDSSLQKLRSLSSIRLDGNNFSAPVPEFL 262

Query: 234  ADFSNLTSLYLSSCGLHGAFPEKILQLPTLETLDLSYNELLQGSLPDFHQNLSLETLILS 293
            A+FSNLT L LSSCGL+G FPEKI Q+PTL+ LDLS N+LL GSLP+F QN SLETL+L 
Sbjct: 263  ANFSNLTQLRLSSCGLNGTFPEKIFQVPTLQILDLSNNKLLLGSLPEFPQNGSLETLVLP 322

Query: 294  ATNFSGILPDSIKNLKNLSRVEFYLCNFNGPIPTSMSDLSQLVYLDMSFNHFSGPIPSLH 353
             T FSG +P+SI NLK L+R+E   CNF+GPIP S ++L+QLVYLD+S N FSGPIP   
Sbjct: 323  DTKFSGKVPNSIGNLKRLTRIELARCNFSGPIPNSTANLAQLVYLDLSENKFSGPIPPFS 382

Query: 354  MFRNLAYLDLSYNIFTGGISSIGWEQLLNLFHVDLSHNNLGGSIPQSLFELPMVQHLLLA 413
            + +NL  ++LS+N  TG I S   + L+NL  +DL  N+L GS+P  LF LP +Q + L+
Sbjct: 383  LSKNLTRINLSHNYLTGPIPSSHLDGLVNLVILDLRDNSLNGSLPMPLFSLPSLQKIQLS 442

Query: 414  DNQFDGHVTEISNASSSLLDTLDLSDNNLEGPIPLSFFELKNLKILLLSSNKFVGTIELD 473
            +NQF G +++ S    S+LDTLDLS NNLEG IP+S F+L+ L IL LSSNKF GT+ L 
Sbjct: 443  NNQFSGPLSKFS-VVPSVLDTLDLSSNNLEGQIPVSIFDLQCLNILDLSSNKFNGTVLLS 501

Query: 474  AIQRLRNLFRLDLSYNRLAV--VAGSSVYCFPPLLTTLSLASCKLSAIPNLRKQTKLYHL 531
            + Q+L NL  L LSYN L++    G+        LTTL LASCKL  +P+L  Q++L +L
Sbjct: 502  SFQKLGNLTTLSLSYNNLSINSSVGNPTLPLLLNLTTLKLASCKLRTLPDLSTQSRLTYL 561

Query: 532  DLSDNQISGEIPNWLWKIGKDSFNHLNLSHNLLVSLEQPYSISDLTS-LSVLDLHSNQIQ 590
            DLSDNQI G IPNW+WKIG  S  HLNLSHNLL  L++P  +S+ T  LS+LDLHSNQ+ 
Sbjct: 562  DLSDNQICGNIPNWIWKIGNCSLAHLNLSHNLLEDLQEP--LSNFTPYLSILDLHSNQLH 619

Query: 591  GKIPPLPPNAAYVDYSGNNFTSSIPVDIGSFMSLSIFFSFSKNSLTGVIPESICNATNLL 650
            G+IP  P   +YVDYS N FTSSIP  IG ++S +IFFS SKN++TG IP SICNAT L 
Sbjct: 620  GQIPTPPQFCSYVDYSDNRFTSSIPDGIGVYISFTIFFSLSKNNITGSIPRSICNATYLQ 679

Query: 651  VLDLSYNYLSGMIPTCLINMSDSQLGVLNLRRNNLNGTVSATFPANCSLRTLDLNGNQLE 710
            VLD S N+LSG IP+CLI      LGVLNLRRNN +G +   FP NC L+TLDL+ N +E
Sbjct: 680  VLDFSDNHLSGKIPSCLIEY--GTLGVLNLRRNNFSGAIPGKFPVNCLLQTLDLSRNHIE 737

Query: 711  GMVPKSLANCSVLEILDLGNNQFDDTFPCWVKNASRLHVLILRSNNFFGNISCPRYNVSW 770
            G +P SLANC+ LE+L+LGNNQ + TFPC +KN + L VL+LR NNF G+I C + N +W
Sbjct: 738  GKIPGSLANCTALEVLNLGNNQMNGTFPCLLKNITTLRVLVLRGNNFQGSIGCCKSNSTW 797

Query: 771  PMLQIIDLASNKFSGRLPQKWLLNLEAMMVDEGRSQSELKHLQYRFLNLSQAYYQDAITV 830
             MLQI+DLA N FSG+LP        AMM  E   QS+LKHLQ+R L  SQ YYQDA+TV
Sbjct: 798  AMLQIVDLAFNNFSGKLPATCFSTWTAMMAGENEVQSKLKHLQFRVLQFSQLYYQDAVTV 857

Query: 831  TIKGLEMKLAKILNIFTSIDFSRNNFEGPIPEEMGLLQSLCALNLSHNALTGSIPSLIGN 890
            T KGLEM+L K+L ++TSID S NNF+G IPE MG   SL  LNLSHN  TG IPS IGN
Sbjct: 858  TSKGLEMELVKVLTLYTSIDLSCNNFQGDIPEVMGNFTSLYVLNLSHNGFTGHIPSSIGN 917

Query: 891  LREIESLDLSMNNLSGTIPAQLASLNFLSVLNLSYNHLVGRIPTSTQLQSFLATSFEGND 950
            LR++ESLDLS N LSG IP QLA+LNFLSVLNLS+N LVGRIP   Q+Q+F  TS+EGN 
Sbjct: 918  LRQLESLDLSQNRLSGEIPTQLANLNFLSVLNLSFNQLVGRIPPGNQMQTFSETSYEGNK 977

Query: 951  RLWGPPLNVCPTNSSKALPSA-PASTDEIDWFFMAMAIGFAVGFGSVVAPLMFSRK 1005
             L G PL++  T+           S  EI W ++A  IGF  G G V+ PL+  R+
Sbjct: 978  ELCGWPLDLSCTDPPPEFDDRHSGSRMEIKWEYIAPEIGFVTGLGIVIWPLVLCRR 1033




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359481300|ref|XP_002269481.2| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481293|ref|XP_003632602.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481304|ref|XP_002270356.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147806063|emb|CAN76702.1| hypothetical protein VITISV_032508 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481296|ref|XP_003632603.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224139184|ref|XP_002323001.1| predicted protein [Populus trichocarpa] gi|222867631|gb|EEF04762.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|214011438|gb|ACJ61469.1| GbVe [Gossypium barbadense] Back     alignment and taxonomy information
>gi|237899607|gb|ACR33108.1| verticillium wilt disease resistance protein [Solanum lycopersicum] gi|237899611|gb|ACR33110.1| verticillium wilt disease resistance protein [Solanum lycopersicum] gi|237899613|gb|ACR33111.1| verticillium wilt disease resistance protein [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|255579302|ref|XP_002530496.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223529953|gb|EEF31880.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1005
TAIR|locus:2085537894 RLP34 "AT3G11010" [Arabidopsis 0.515 0.579 0.337 5.3e-100
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.518 0.552 0.340 8.6e-100
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.511 0.587 0.343 4.8e-93
TAIR|locus:2055772983 RLP19 "receptor like protein 1 0.841 0.860 0.321 3.6e-89
TAIR|locus:2825762994 RLP6 "AT1G45616" [Arabidopsis 0.820 0.829 0.326 6.7e-88
TAIR|locus:2144392957 RLP53 "receptor like protein 5 0.787 0.826 0.311 4.7e-87
TAIR|locus:2078112868 RLP32 "receptor like protein 3 0.689 0.798 0.322 1.2e-83
TAIR|locus:2825384847 RLP12 "AT1G71400" [Arabidopsis 0.690 0.819 0.332 1e-82
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.840 0.829 0.302 9.7e-80
TAIR|locus:2180587811 RLP52 "receptor like protein 5 0.680 0.843 0.326 1.6e-79
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 660 (237.4 bits), Expect = 5.3e-100, Sum P(2) = 5.3e-100
 Identities = 189/560 (33%), Positives = 280/560 (50%)

Query:   466 FVGTIELDAIQRLRNLFRLDLSY-NRLAVVAGSSVYCFPPLLTTLSLASCKLSAIP--NL 522
             F+G I   +I +L NL  L +S+ N        S++     L  L L+    + I   ++
Sbjct:   335 FIGPIP-SSISKLINLQELGISHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDI 393

Query:   523 RKQTK-LYHLDLSDNQISGEIPNWLWKIGKD--SFXXXXXXXXXXXXXEQPYSISDLTSL 579
                 K L  LDLS N +S    +    +  D  S              + P  +     L
Sbjct:   394 LPYFKTLRSLDLSGNLVSATNKS---SVSSDPPSQSIQSLYLSGCGITDFPEILRTQHEL 450

Query:   580 SVLDLHSNQIQGKIPP---LPPNAAYVDYSGNNFTS-SIPVDIGXXXXXXXXXXXXKNSL 635
               LD+ +N+I+G++P      PN  Y++ S N F     P                 N+ 
Sbjct:   451 GFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFIGFQRPTK---PEPSMAYLLGSNNNF 507

Query:   636 TGVIPESICNATNLLVLDLSYNYLSGMIPTCLINMSDSQXXXXXXXXXXXXXTVSATFPA 695
             TG IP  IC   +L  LDLS N  SG IP C+ N+  +               +S  FP 
Sbjct:   508 TGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSN-----LSELNLRQNNLSGGFPE 562

Query:   696 NC--SLRTLDLNGNQLEGMVPKSLANCSVLEILDLGNNQFDDTFPCWVKNASRLHVLILR 753
             +   SLR+LD+  NQL G +P+SL   S LE+L++ +N+ +D FP W+ +  +L VL+LR
Sbjct:   563 HIFESLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLR 622

Query:   754 SNNFFGNISCPRYNVSWPMLQIIDLASNKFSGRLPQKWLLNLEAMMVDEGRSQSELKHLQ 813
             SN F G I+       +P L+IID++ N F+G LP ++ +    M    G +  +  ++ 
Sbjct:   623 SNAFHGPIN----QALFPKLRIIDISHNHFNGSLPTEYFVEWSRMS-SLG-TYEDGSNVN 676

Query:   814 YRFLNLSQAYYQDAITVTIKGLEMKLAKILNIFTSIDFSRNNFEGPIPEEMGLLQSLCAL 873
             Y    L   YYQD++ +  KG+E +L +IL I+T++DFS N FEG IP+ +GLL+ L  L
Sbjct:   677 Y----LGSGYYQDSMVLMNKGVESELVRILTIYTAVDFSGNKFEGEIPKSIGLLKELHVL 732

Query:   874 NLSHNALTGSIPSLIGNLREIESLDLSMNNLSGTIPAQLASLNFLSVLNLSYNHLVGRIP 933
             NLS+NA TG IPS IGNL  +ESLD+S N L G IP ++ +L+ LS +N S+N L G +P
Sbjct:   733 NLSNNAFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVP 792

Query:   934 TSTQLQSFLATSFEGNDRLWGPPLN-VCP---TNSSKALPSAPASTDE----IDWFFMAM 985
                Q  +   +SFEGN  L+G  L  VC    T +S      P + +E    I W   A+
Sbjct:   793 GGQQFLTQRCSSFEGNLGLFGSSLEEVCRDIHTPASHQQFETPQTEEEDEDLISWIAAAI 852

Query:   986 AIGFAVGFGSVVAPLMFSRK 1005
               G  + FG +   ++ S K
Sbjct:   853 GFGPGIAFGLMFGYILVSYK 872


GO:0005575 "cellular_component" evidence=ND
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180587 RLP52 "receptor like protein 52" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1005
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-69
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-60
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-07
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 0.003
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  248 bits (636), Expect = 6e-69
 Identities = 201/632 (31%), Positives = 302/632 (47%), Gaps = 65/632 (10%)

Query: 386  VDLSHNNLGGSIPQSLFELPMVQHLLLADNQFDGHVTEISNASSSLLDTLDLSDNNLEGP 445
            +DLS  N+ G I  ++F LP +Q + L++NQ  G + +    +SS L  L+LS+NN  G 
Sbjct: 74   IDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGS 133

Query: 446  IPLSFFELKNLKILLLSSNKFVGTIELDAIQRLRNLFRLDLSYNRLAVVAGSSVYCFPPL 505
            IP     + NL+ L LS+N   G I  D I    +L  LDL  N L       V   P  
Sbjct: 134  IPRGS--IPNLETLDLSNNMLSGEIPND-IGSFSSLKVLDLGGNVL-------VGKIPNS 183

Query: 506  LTTLS------LASCKLSA-IP-NLRKQTKLYHLDLSDNQISGEIPNWLWKIGK-DSFNH 556
            LT L+      LAS +L   IP  L +   L  + L  N +SGEIP    +IG   S NH
Sbjct: 184  LTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPY---EIGGLTSLNH 240

Query: 557  LNLSHNLLVSLEQPYSISDLTSLSVLDLHSNQIQGKIPPLP---PNAAYVDYSGNNFTSS 613
            L+L +N L     P S+ +L +L  L L+ N++ G IPP          +D S N+ +  
Sbjct: 241  LDLVYNNLTG-PIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGE 299

Query: 614  IPVDIGSFMSLSIFFSFSKNSLTGVIPESICNATNLLVLDLSYNYLSGMIPTCLINMSDS 673
            IP  +    +L I   FS N+ TG IP ++ +   L VL L  N  SG IP  L   ++ 
Sbjct: 300  IPELVIQLQNLEILHLFS-NNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNN- 357

Query: 674  QLGVLNLRRNNLNGTVSATFPANCSLRTLDLNGNQLEGMVPKSLANCSVLEILDLGNNQF 733
             L VL+L  NNL G +     ++ +L  L L  N LEG +PKSL  C  L  + L +N F
Sbjct: 358  -LTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSF 416

Query: 734  DDTFPCWVKNASRLHVLILRSNNFFGNISCPRYNVSWPMLQIIDLASNKFSGRLPQKWLL 793
                P        ++ L + +NN  G I+  ++++  P LQ++ LA NKF G LP     
Sbjct: 417  SGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDM--PSLQMLSLARNKFFGGLP----- 469

Query: 794  NLEAMMVDEGRSQSELKHLQYRFLNLSQAYYQDAITVTIKGLEMKLAKILNIFTSIDFSR 853
                   D   S+      +   L+LS+  +  A+   +      L++++ +      S 
Sbjct: 470  -------DSFGSK------RLENLDLSRNQFSGAVPRKL----GSLSELMQL----KLSE 508

Query: 854  NNFEGPIPEEMGLLQSLCALNLSHNALTGSIPSLIGNLREIESLDLSMNNLSGTIPAQLA 913
            N   G IP+E+   + L +L+LSHN L+G IP+    +  +  LDLS N LSG IP  L 
Sbjct: 509  NKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLG 568

Query: 914  SLNFLSVLNLSYNHLVGRIPTSTQLQSFLATSFEGNDRLWGPPLNVCPTNSSKALPSAP- 972
            ++  L  +N+S+NHL G +P++    +  A++  GN  L       C  +++  LP    
Sbjct: 569  NVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDL-------CGGDTTSGLPPCKR 621

Query: 973  ASTDEIDWFFMAMAIGFAVGFGSVVAPLMFSR 1004
                   WF++   +G  +    V    +F R
Sbjct: 622  VRKTPSWWFYITCTLGAFLVLALVAFGFVFIR 653


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1005
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
PLN03150623 hypothetical protein; Provisional 99.58
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
PLN03150623 hypothetical protein; Provisional 99.38
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.24
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.23
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.2
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.01
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.98
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.95
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.92
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.91
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.87
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.86
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.85
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.83
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.78
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.75
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.7
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.68
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.62
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.62
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.47
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.25
KOG4341483 consensus F-box protein containing LRR [General fu 98.25
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.18
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.17
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.16
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.06
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.05
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.03
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.02
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.99
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.84
PRK15386426 type III secretion protein GogB; Provisional 97.82
PRK15386426 type III secretion protein GogB; Provisional 97.68
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.62
KOG4341483 consensus F-box protein containing LRR [General fu 97.57
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.41
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.36
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.29
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.04
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.67
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.66
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.4
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.32
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.15
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.07
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.86
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.69
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.31
KOG4308478 consensus LRR-containing protein [Function unknown 93.7
KOG4308478 consensus LRR-containing protein [Function unknown 93.15
KOG0473 326 consensus Leucine-rich repeat protein [Function un 92.9
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.06
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.67
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 88.75
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.21
smart0037026 LRR Leucine-rich repeats, outliers. 88.21
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 85.45
smart0037026 LRR Leucine-rich repeats, outliers. 85.4
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.4
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.64
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.14
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.56
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.4e-68  Score=672.92  Aligned_cols=584  Identities=37%  Similarity=0.605  Sum_probs=384.2

Q ss_pred             cHHHHHHHHHHhhhCCCCCCCcccccCCCCCCCCcccceeEECCCCCEEEEEcCCCCcccccCCCcccccccccceeecC
Q 047927            9 QSDQQSLLLQMKSRLTFDSSVSFRMVQWSQSNDCCTWSGVDCDEAGRVIGLDLSEESISAGIDNSSSLFSLKYLQSLNLA   88 (1005)
Q Consensus         9 ~~~~~~~ll~~k~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~~~~v~~L~L~~~~l~~~~~~~~~l~~l~~L~~L~Ls   88 (1005)
                      .++|++||++||+++. +|.  +.+++|+...+||.|.||+|+..++|+.|||+++.+.+.+  +..+..+++|++|+|+
T Consensus        27 ~~~~~~~l~~~~~~~~-~~~--~~~~~w~~~~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~--~~~~~~l~~L~~L~Ls  101 (968)
T PLN00113         27 HAEELELLLSFKSSIN-DPL--KYLSNWNSSADVCLWQGITCNNSSRVVSIDLSGKNISGKI--SSAIFRLPYIQTINLS  101 (968)
T ss_pred             CHHHHHHHHHHHHhCC-CCc--ccCCCCCCCCCCCcCcceecCCCCcEEEEEecCCCccccC--ChHHhCCCCCCEEECC
Confidence            5689999999999996 353  4788998788999999999987789999999999988766  6677778888888888


Q ss_pred             CccCCCCCCCCccc-CCCCCcEEEcccCCCcCCCcccccCCCCCcEEeCCCcccccCccccCCCChhhhhhcCccCceee
Q 047927           89 FNMFNATEIPSGLG-NLTNLTTLNLSNAGFAGQIPIQVSGMTRLVTLDLSGMYFVRAPLKLENPNLSGLLQNLAELRELY  167 (1005)
Q Consensus        89 ~~~~~~~~lp~~l~-~l~~L~~L~Ls~n~~~~~lp~~l~~l~~L~~L~ls~n~~~~~~~~~~~~~~~~~l~~l~~L~~L~  167 (1005)
                      +|.+.+. +|..+. .+++|++|++++|.+.+.+|.  +.++                                      
T Consensus       102 ~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~--------------------------------------  140 (968)
T PLN00113        102 NNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIP--------------------------------------  140 (968)
T ss_pred             CCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccC--------------------------------------
Confidence            8777654 666544 677777777777777666653  2233                                      


Q ss_pred             cCCccCCCchhhHHHHHhccCCCccEEEccCCCCCCCCCccccCCCCCcEEECCCCCCCCCcchhccCCCCCcEEEccCC
Q 047927          168 LDGVNISAPGIEWCQALSSLVPKLQVLSLSGCFLSGPVDPSLSNLRSLSVIRLDMNDLYSPVPEFLADFSNLTSLYLSSC  247 (1005)
Q Consensus       168 l~~~~~~~~~~~~~~~l~~l~~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~p~~l~~l~~L~~L~L~~n  247 (1005)
                                            +|++|++++|.+.+..|..++++++|++|++++|.+.+.+|..++++++|++|++++|
T Consensus       141 ----------------------~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n  198 (968)
T PLN00113        141 ----------------------NLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASN  198 (968)
T ss_pred             ----------------------CCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCC
Confidence                                  3444444445555555666666666777777666666666666666666666666666


Q ss_pred             CCCccCccccCCCCCCCEEeCCCCCCCCCCCCcccCCCCCcEEEcccccccccCchhhccCCCCCEEeecCCccCCCCCc
Q 047927          248 GLHGAFPEKILQLPTLETLDLSYNELLQGSLPDFHQNLSLETLILSATNFSGILPDSIKNLKNLSRVEFYLCNFNGPIPT  327 (1005)
Q Consensus       248 ~l~~~~p~~l~~l~~L~~L~Ls~n~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~l~~n~~~~~~~~  327 (1005)
                      .+++.+|..++++++|++|++++|.+                        ++.+|..++++++|++|++++|.+.+.+|.
T Consensus       199 ~l~~~~p~~l~~l~~L~~L~L~~n~l------------------------~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~  254 (968)
T PLN00113        199 QLVGQIPRELGQMKSLKWIYLGYNNL------------------------SGEIPYEIGGLTSLNHLDLVYNNLTGPIPS  254 (968)
T ss_pred             CCcCcCChHHcCcCCccEEECcCCcc------------------------CCcCChhHhcCCCCCEEECcCceeccccCh
Confidence            66666666666666666555555532                        334555555555666666655555555555


Q ss_pred             cCCCCCCCcEEECcCCcCccCCCcccccCcccEEECCCCcCcCCCCcccccccccccEEEcCCCcCCCccCccCCCCCCC
Q 047927          328 SMSDLSQLVYLDMSFNHFSGPIPSLHMFRNLAYLDLSYNIFTGGISSIGWEQLLNLFHVDLSHNNLGGSIPQSLFELPMV  407 (1005)
Q Consensus       328 ~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L  407 (1005)
                      .++++++|++|++++|.+.+.+                       |.. +..+++|++|++++|.+.+            
T Consensus       255 ~l~~l~~L~~L~L~~n~l~~~~-----------------------p~~-l~~l~~L~~L~Ls~n~l~~------------  298 (968)
T PLN00113        255 SLGNLKNLQYLFLYQNKLSGPI-----------------------PPS-IFSLQKLISLDLSDNSLSG------------  298 (968)
T ss_pred             hHhCCCCCCEEECcCCeeeccC-----------------------chh-HhhccCcCEEECcCCeecc------------
Confidence            5555555555555555443222                       211 3334444444444444333            


Q ss_pred             CEEeCcCcccccccccccccccccCCEEeCCCCccCCCCCccccCcCCCcEEECCCCcceeccchhHHHhcCCCCeEecc
Q 047927          408 QHLLLADNQFDGHVTEISNASSSLLDTLDLSDNNLEGPIPLSFFELKNLKILLLSSNKFVGTIELDAIQRLRNLFRLDLS  487 (1005)
Q Consensus       408 ~~L~l~~n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~l~~l~~L~~L~l~  487 (1005)
                                                           .+|..+..+++|+.|++++|.+.+.++. .             
T Consensus       299 -------------------------------------~~p~~~~~l~~L~~L~l~~n~~~~~~~~-~-------------  327 (968)
T PLN00113        299 -------------------------------------EIPELVIQLQNLEILHLFSNNFTGKIPV-A-------------  327 (968)
T ss_pred             -------------------------------------CCChhHcCCCCCcEEECCCCccCCcCCh-h-------------
Confidence                                                 3333444445555555555544432221 1             


Q ss_pred             CCeeeEecCCcccccCcccceEEcCCccCcCCCCCCCCCceeEEECcCCcCCCCCChhhhhhcCCcccEEeCCCCcccCC
Q 047927          488 YNRLAVVAGSSVYCFPPLLTTLSLASCKLSAIPNLRKQTKLYHLDLSDNQISGEIPNWLWKIGKDSFNHLNLSHNLLVSL  567 (1005)
Q Consensus       488 ~n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~l~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~~~~~~L~~L~L~~n~l~~~  567 (1005)
                                                        +..+++|+.|++++|.+.+.+|..+..                   
T Consensus       328 ----------------------------------~~~l~~L~~L~L~~n~l~~~~p~~l~~-------------------  354 (968)
T PLN00113        328 ----------------------------------LTSLPRLQVLQLWSNKFSGEIPKNLGK-------------------  354 (968)
T ss_pred             ----------------------------------HhcCCCCCEEECcCCCCcCcCChHHhC-------------------
Confidence                                              122223334444444443333332211                   


Q ss_pred             CCCCccccCCcccEEEeccCcccccCCCCCCCcceeeCcCCcCccCCCcchhcccCceEEEEecCCcccccCChhhhccC
Q 047927          568 EQPYSISDLTSLSVLDLHSNQIQGKIPPLPPNAAYVDYSGNNFTSSIPVDIGSFMSLSIFFSFSKNSLTGVIPESICNAT  647 (1005)
Q Consensus       568 ~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~ls~n~~~~~~p~~~~~~~~~L~~L~l~~n~l~~~~p~~l~~l~  647 (1005)
                              +++|+.|++++|.+                                              ++.+|..++.++
T Consensus       355 --------~~~L~~L~Ls~n~l----------------------------------------------~~~~p~~~~~~~  380 (968)
T PLN00113        355 --------HNNLTVLDLSTNNL----------------------------------------------TGEIPEGLCSSG  380 (968)
T ss_pred             --------CCCCcEEECCCCee----------------------------------------------EeeCChhHhCcC
Confidence                    12333333333332                                              223344455555


Q ss_pred             CCCeEEccCccccccCCchhhhcCcccccEEECCCCcCCccccCccCCCCCccEEeCCCCeecccCcccccCCCCCCEEE
Q 047927          648 NLLVLDLSYNYLSGMIPTCLINMSDSQLGVLNLRRNNLNGTVSATFPANCSLRTLDLNGNQLEGMVPKSLANCSVLEILD  727 (1005)
Q Consensus       648 ~L~~L~Ls~N~l~~~~p~~~~~l~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~  727 (1005)
                      +|+.|++++|++.+.+|..+..++                          +|+.|++++|++++.+|..+..+++|+.|+
T Consensus       381 ~L~~L~l~~n~l~~~~p~~~~~~~--------------------------~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~  434 (968)
T PLN00113        381 NLFKLILFSNSLEGEIPKSLGACR--------------------------SLRRVRLQDNSFSGELPSEFTKLPLVYFLD  434 (968)
T ss_pred             CCCEEECcCCEecccCCHHHhCCC--------------------------CCCEEECcCCEeeeECChhHhcCCCCCEEE
Confidence            566666666666655555555544                          444555555555555555555555555555


Q ss_pred             CCCCcCCCCcchhhhcCCCCcEEecCCCcCCcccCCCCCCCCCCCccEEEccCCcccccCChHHHhhhhhhhhccCCchh
Q 047927          728 LGNNQFDDTFPCWVKNASRLHVLILRSNNFFGNISCPRYNVSWPMLQIIDLASNKFSGRLPQKWLLNLEAMMVDEGRSQS  807 (1005)
Q Consensus       728 Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~~~~~~~~~l~~L~~L~ls~N~~~~~~p~~~~~~l~~~~~~~~~~~~  807 (1005)
                      +++|++++.+|.++..+++|+.|++++|++.+.+  |... ..++|+.||+++|++++.+|..+                
T Consensus       435 Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~--p~~~-~~~~L~~L~ls~n~l~~~~~~~~----------------  495 (968)
T PLN00113        435 ISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGL--PDSF-GSKRLENLDLSRNQFSGAVPRKL----------------  495 (968)
T ss_pred             CcCCcccCccChhhccCCCCcEEECcCceeeeec--Cccc-ccccceEEECcCCccCCccChhh----------------
Confidence            5555555555555555555555555555555544  3322 34677888888888887777533                


Q ss_pred             hhchhhheecccccccccccEEEEEcchHHHHHHhcccceEEECCCCeeeccCcccccCCCCCCEEECCCCcCcccCchh
Q 047927          808 ELKHLQYRFLNLSQAYYQDAITVTIKGLEMKLAKILNIFTSIDFSRNNFEGPIPEEMGLLQSLCALNLSHNALTGSIPSL  887 (1005)
Q Consensus       808 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~Ls~N~l~g~ip~~~~~l~~L~~L~Ls~N~l~g~ip~~  887 (1005)
                                                       ..++.|+.|+|++|+++|.+|+.++++++|++|+|++|.++|.+|..
T Consensus       496 ---------------------------------~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~  542 (968)
T PLN00113        496 ---------------------------------GSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPAS  542 (968)
T ss_pred             ---------------------------------hhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChh
Confidence                                             13567889999999999999999999999999999999999999999


Q ss_pred             hhcCCCCCEEeCCCCcCcccCcccccCCCCCCeEEccCCcccccCCCCCcccccccccccCCCCCCCCC
Q 047927          888 IGNLREIESLDLSMNNLSGTIPAQLASLNFLSVLNLSYNHLVGRIPTSTQLQSFLATSFEGNDRLWGPP  956 (1005)
Q Consensus       888 ~~~l~~L~~LdLs~N~l~~~ip~~l~~l~~L~~L~ls~N~l~g~ip~~~~~~~~~~~~~~gn~~lc~~~  956 (1005)
                      ++++++|+.|||++|+++|.+|..+.++++|++||+++|+++|.+|..+++.++.+.+|.||+.+||++
T Consensus       543 ~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        543 FSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             HhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            999999999999999999999999999999999999999999999999999999999999999999865



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1005
3rgx_A768 Structural Insight Into Brassinosteroid Perception 4e-38
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 8e-38
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-16
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-15
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 1e-05
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 1e-05
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 1e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 156 bits (395), Expect = 4e-38, Method: Compositional matrix adjust. Identities = 199/738 (26%), Positives = 305/738 (41%), Gaps = 114/738 (15%) Query: 271 NELLQGSLPDFHQNLSLETLILSATNFSGILPDSIKNLKNLSRVEFY-----LCNFNGPI 325 N + GS+ F + SL +L LS + SG + ++ +L + S ++F +F G + Sbjct: 86 NSHINGSVSGFKCSASLTSLDLSRNSLSGPV-TTLTSLGSCSGLKFLNVSSNTLDFPGKV 144 Query: 326 PTSMSDLSQLVYLDMSFNHFSGPIPSLHMFRN----LAYLDLSYNIFTGGISSIGWEQLL 381 + L+ L LD+S N SG + + L +L +S N +G + + + Sbjct: 145 SGGLK-LNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD---VSRCV 200 Query: 382 NLFHVDLSHNNLGGSIPQSLFELPMVQHLLLADNQFDGHVTEIXXXXXXXXXXXXXXXXX 441 NL +D+S NN IP L + +QHL ++ N+ G + Sbjct: 201 NLEFLDVSSNNFSTGIP-FLGDCSALQHLDISGNKLSGDFSR------------------ 241 Query: 442 XEGPIPLSFFEXXXXXXXXXXXXXFVGTIELDAIQRLRNLFRLDLSYNRLAVVAGSSVYC 501 AI L L++S N+ V Sbjct: 242 --------------------------------AISTCTELKLLNISSNQF-------VGP 262 Query: 502 FPPL----LTTLSLASCKLSA-IPNLRKQT--KLYHLDLSDNQISGEIPNWLWKIGKDSF 554 PPL L LSLA K + IP+ L LDLS N G +P + G S Sbjct: 263 IPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFF---GSCSL 319 Query: 555 XXXXXXXXXXXXXEQPY-SISDLTSLSVLDLHSNQIQGKIPP----LPPNAAYVDYSGNN 609 E P ++ + L VLDL N+ G++P L + +D S NN Sbjct: 320 LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 379 Query: 610 FTSSI-PVDIGXXXXXXXXXXXXKNSLTGVIPESICNATNLLVLDLSYNYLSGMIPTCLI 668 F+ I P N TG IP ++ N + L+ L LS+NYLSG IP+ L Sbjct: 380 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 439 Query: 669 NMSDSQXXXXXXXXXXXXXTVSATFPANCSLRTLDLNGNQLEGMVPKSLANCSVLEILDL 728 ++S + + +L TL L+ N L G +P L+NC+ L + L Sbjct: 440 SLSKLRDLKLWLNMLEGEIPQELMYVK--TLETLILDFNDLTGEIPSGLSNCTNLNWISL 497 Query: 729 GNNQFDDTFPCWVKNASRLHVLILRSNNFFGNISCPRYNVSWPMLQIIDLASNKFSGRLP 788 NN+ P W+ L +L L +N+F GNI P L +DL +N F+G +P Sbjct: 498 SNNRLTGEIPKWIGRLENLAILKLSNNSFSGNI--PAELGDCRSLIWLDLNTNLFNGTIP 555 Query: 789 -----------------QKWLLNLEAMMVDEGRSQSELKHLQ-YRFLNLSQAYYQDAITV 830 ++++ M E L Q R L++ ++ + Sbjct: 556 AAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNI 615 Query: 831 TIKGLEMKLAKILNIFTS---IDFSRNNFEGPIPEEMGLLQSLCALNLSHNALTGSIPSL 887 T + + + S +D S N G IP+E+G + L LNL HN ++GSIP Sbjct: 616 TSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDE 675 Query: 888 IGNLREIESLDLSMNNLSGTIPAQLASLNFLSVLNLSYNHLVGRIPTSTQLQSFLATSFE 947 +G+LR + LDLS N L G IP +++L L+ ++LS N+L G IP Q ++F F Sbjct: 676 VGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFL 735 Query: 948 GNDRLWGPPLNVC-PTNS 964 N L G PL C P+N+ Sbjct: 736 NNPGLCGYPLPRCDPSNA 753
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1005
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 0.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-140
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-73
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-95
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-81
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-69
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-40
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-81
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-73
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-67
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-50
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-37
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-20
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-78
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-69
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-66
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-62
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-44
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-73
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-64
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-58
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-57
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-68
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-60
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-56
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-56
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-54
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-68
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-58
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-59
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-54
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-50
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-49
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-48
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-53
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-49
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-44
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-50
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-48
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-48
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-45
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-27
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-43
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-42
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-42
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-41
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-32
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-37
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-33
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-23
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-35
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-23
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-34
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-34
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-33
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-32
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-18
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-29
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-25
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-28
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-27
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-27
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-26
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-27
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-14
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-24
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-20
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-22
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-22
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-21
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-14
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-12
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  547 bits (1413), Expect = 0.0
 Identities = 216/773 (27%), Positives = 326/773 (42%), Gaps = 103/773 (13%)

Query: 237 SNLTSLYLSSCGLH---GAFPEKILQLPTLETLDLSYNELLQGSLPDFHQNLSLETLILS 293
             +TS+ LSS  L+    A    +L L  LE+L LS + +  GS+  F  + SL +L LS
Sbjct: 50  DKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHI-NGSVSGFKCSASLTSLDLS 108

Query: 294 ATNFSGILPD--SIKNLKNLSRVEFYLCNFNGPIPTS-MSDLSQLVYLDMSFNHFSGPIP 350
             + SG +    S+ +   L  +       + P   S    L+ L  LD+S N  SG   
Sbjct: 109 RNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANV 168

Query: 351 S----LHMFRNLAYLDLSYNIFTGGISSIGWEQLLNLFHVDLSHNNLGGSIPQSLFELPM 406
                      L +L +S N  +G +  +   + +NL  +D+S NN    IP  L +   
Sbjct: 169 VGWVLSDGCGELKHLAISGNKISGDVD-VS--RCVNLEFLDVSSNNFSTGIP-FLGDCSA 224

Query: 407 VQHLLLADNQFDGHV-TEISNASSSLLDTLDLSDNNLEGPIPLSFFELKNLKILLLSSNK 465
           +QHL ++ N+  G     IS  +   L  L++S N   GPIP     LK+L+ L L+ NK
Sbjct: 225 LQHLDISGNKLSGDFSRAISTCTE--LKLLNISSNQFVGPIPPL--PLKSLQYLSLAENK 280

Query: 466 FVGTIELDAIQRLRNLFRLDLSYNRLAVVAGSSVYCFPPLLTTLSLASCKLSAIPN-LRK 524
           F G I          L  LDLS N      G+                     +P     
Sbjct: 281 FTGEIPDFLSGACDTLTGLDLSGNHFY---GA---------------------VPPFFGS 316

Query: 525 QTKLYHLDLSDNQISGEIPNWLWKIGKDSFNHLNLSHNLLVSLEQPYSISDLTSLSVLDL 584
            + L  L LS N  SGE+P                            ++  +  L VLDL
Sbjct: 317 CSLLESLALSSNNFSGELPMD--------------------------TLLKMRGLKVLDL 350

Query: 585 HSNQIQGKIPP----LPPNAAYVDYSGNNFTSSIPVDIGSFMSLSI-FFSFSKNSLTGVI 639
             N+  G++P     L  +   +D S NNF+  I  ++      ++       N  TG I
Sbjct: 351 SFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKI 410

Query: 640 PESICNATNLLVLDLSYNYLSGMIPTCLINMSDSQLGVLNLRRNNLNGTVSATFPANCSL 699
           P ++ N + L+ L LS+NYLSG IP+ L ++S  +L  L L  N L G +        +L
Sbjct: 411 PPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS--KLRDLKLWLNMLEGEIPQELMYVKTL 468

Query: 700 RTLDLNGNQLEGMVPKSLANCSVLEILDLGNNQFDDTFPCWVKNASRLHVLILRSNNFFG 759
            TL L+ N L G +P  L+NC+ L  + L NN+     P W+     L +L L +N+F G
Sbjct: 469 ETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSG 528

Query: 760 NISCPRYNVSWPMLQIIDLASNKFSGRLPQKWLLNLEAMMVDEGRSQSELKHLQY----- 814
           NI  P        L  +DL +N F+G +P   +      +     +     +++      
Sbjct: 529 NI--PAELGDCRSLIWLDLNTNLFNGTIP-AAMFKQSGKIAANFIAGKRYVYIKNDGMKK 585

Query: 815 -----------------RFLNLSQAYYQDAITVTIKGLEMKLAKILNIFTSIDFSRNNFE 857
                            +   LS     +  +    G              +D S N   
Sbjct: 586 ECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLS 645

Query: 858 GPIPEEMGLLQSLCALNLSHNALTGSIPSLIGNLREIESLDLSMNNLSGTIPAQLASLNF 917
           G IP+E+G +  L  LNL HN ++GSIP  +G+LR +  LDLS N L G IP  +++L  
Sbjct: 646 GYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTM 705

Query: 918 LSVLNLSYNHLVGRIPTSTQLQSFLATSFEGNDRLWGPPLNVCPTNSSKALPS 970
           L+ ++LS N+L G IP   Q ++F    F  N  L G PL  C  +++     
Sbjct: 706 LTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAH 758


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1005
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.54
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.5
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.42
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.42
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.4
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.4
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.38
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.37
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.34
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.32
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.23
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.22
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.21
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.06
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.02
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.84
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.69
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.67
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.57
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.54
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.4
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.36
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.34
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.25
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.78
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.72
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.01
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.01
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.93
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.2
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.7e-90  Score=847.95  Aligned_cols=716  Identities=30%  Similarity=0.439  Sum_probs=480.4

Q ss_pred             ccccCCCcHHHHHHHHHHhhhCCCCCCCcccccCCCCCCCCcccceeEECCCCCEEEEEcCCCCcccc---cCCCccccc
Q 047927            2 VLVSGQCQSDQQSLLLQMKSRLTFDSSVSFRMVQWSQSNDCCTWSGVDCDEAGRVIGLDLSEESISAG---IDNSSSLFS   78 (1005)
Q Consensus         2 ~~~~~~~~~~~~~~ll~~k~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~~~~v~~L~L~~~~l~~~---~~~~~~l~~   78 (1005)
                      +++.+++.++||+|||+||+++. ||.   ++++|+.+.+||+|.||+|+ .+||++|||+++.+.|.   +  ++++.+
T Consensus         3 ~~~~~~~~~~~~~all~~k~~~~-~~~---~l~~W~~~~~~C~w~gv~C~-~~~v~~L~L~~~~l~g~~~~l--~~~l~~   75 (768)
T 3rgz_A            3 QASPSQSLYREIHQLISFKDVLP-DKN---LLPDWSSNKNPCTFDGVTCR-DDKVTSIDLSSKPLNVGFSAV--SSSLLS   75 (768)
T ss_dssp             -----CCHHHHHHHHHHHHTTCS-CTT---SSTTCCTTSCGGGSTTEEEE-TTEEEEEECTTSCCCEEHHHH--HHHTTT
T ss_pred             cCccccCCHHHHHHHHHHHhhCC-Ccc---cccCCCCCCCCcCCcceEEC-CCcEEEEECCCCCcCCccCcc--ChhHhc
Confidence            45667778899999999999997 453   78999878899999999998 68999999999999887   6  678999


Q ss_pred             ccccceeecCCccCCCCCCCCcccCCCCCcEEEcccCCCcCCCcc--cccCCCCCcEEeCCCcccccCccccCCCChhhh
Q 047927           79 LKYLQSLNLAFNMFNATEIPSGLGNLTNLTTLNLSNAGFAGQIPI--QVSGMTRLVTLDLSGMYFVRAPLKLENPNLSGL  156 (1005)
Q Consensus        79 l~~L~~L~Ls~~~~~~~~lp~~l~~l~~L~~L~Ls~n~~~~~lp~--~l~~l~~L~~L~ls~n~~~~~~~~~~~~~~~~~  156 (1005)
                      +++|++++++.+.+.  .+|+.++++++|++|||++|.+.+.+|.  .++++++|++|++++|.+..             
T Consensus        76 L~~L~~l~~~~~~~~--~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~-------------  140 (768)
T 3rgz_A           76 LTGLESLFLSNSHIN--GSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDF-------------  140 (768)
T ss_dssp             CTTCCEEECTTSCEE--ECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEEC-------------
T ss_pred             cCcccccCCcCCCcC--CCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCC-------------
Confidence            999999999998763  3678999999999999999999988888  88999999999888876432             


Q ss_pred             hhcCccCceeecCCccCCCchhhHHHHHhccCCCccEEEccCCCCCCCCCccc-cCCCCCcEEECCCCCCCCCcchh---
Q 047927          157 LQNLAELRELYLDGVNISAPGIEWCQALSSLVPKLQVLSLSGCFLSGPVDPSL-SNLRSLSVIRLDMNDLYSPVPEF---  232 (1005)
Q Consensus       157 l~~l~~L~~L~l~~~~~~~~~~~~~~~l~~l~~~L~~L~L~~n~~~~~~~~~l-~~l~~L~~L~l~~n~~~~~~p~~---  232 (1005)
                                                                     ..|..+ .++++|++|++++|.+.+..|..   
T Consensus       141 -----------------------------------------------~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~  173 (768)
T 3rgz_A          141 -----------------------------------------------PGKVSGGLKLNSLEVLDLSANSISGANVVGWVL  173 (768)
T ss_dssp             -----------------------------------------------CSSCCSCCCCTTCSEEECCSSCCEEETHHHHHH
T ss_pred             -----------------------------------------------cCCHHHhccCCCCCEEECCCCccCCcCChhhhh
Confidence                                                           222222 45556666666666665555544   


Q ss_pred             ccCCCCCcEEEccCCCCCccCccccCCCCCCCEEeCCCCCCCCCCCCcccCCCCCcEEEcccccccccCchhhccCCCCC
Q 047927          233 LADFSNLTSLYLSSCGLHGAFPEKILQLPTLETLDLSYNELLQGSLPDFHQNLSLETLILSATNFSGILPDSIKNLKNLS  312 (1005)
Q Consensus       233 l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~  312 (1005)
                      +.++++|++|++++|.+++..|.  ..+++|++|++++|.+                        ++..|. ++++++|+
T Consensus       174 ~~~l~~L~~L~Ls~n~l~~~~~~--~~l~~L~~L~Ls~n~l------------------------~~~~~~-l~~l~~L~  226 (768)
T 3rgz_A          174 SDGCGELKHLAISGNKISGDVDV--SRCVNLEFLDVSSNNF------------------------STGIPF-LGDCSALQ  226 (768)
T ss_dssp             TTCCTTCCEEECCSSEEESCCBC--TTCTTCCEEECCSSCC------------------------CSCCCB-CTTCCSCC
T ss_pred             hccCCCCCEEECCCCcccccCCc--ccCCcCCEEECcCCcC------------------------CCCCcc-cccCCCCC
Confidence            56666666666666666654432  5556666666665543                        222222 34444444


Q ss_pred             EEeecCCccCCCCCccCCCCCCCcEEECcCCcCccCCCcccccCcccEEECCCCcCcCCCCcccccccccccEEEcCCCc
Q 047927          313 RVEFYLCNFNGPIPTSMSDLSQLVYLDMSFNHFSGPIPSLHMFRNLAYLDLSYNIFTGGISSIGWEQLLNLFHVDLSHNN  392 (1005)
Q Consensus       313 ~L~l~~n~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~  392 (1005)
                      +|++++|.+.+.+|..++.+++|++|++++|.+.+.++.. .+++|++|++++|.+++.+|......+++|++|++++|.
T Consensus       227 ~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~-~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~  305 (768)
T 3rgz_A          227 HLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL-PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNH  305 (768)
T ss_dssp             EEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC-CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSE
T ss_pred             EEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc-ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCc
Confidence            4444444444444444444444444444444444433333 334555555555555555554422234667777777777


Q ss_pred             CCCccCccCCCCCCCCEEeCcCcccccccccccccccccCCEEeCCCCccCCCCCcc-ccCcCCCcEEECCCCcceeccc
Q 047927          393 LGGSIPQSLFELPMVQHLLLADNQFDGHVTEISNASSSLLDTLDLSDNNLEGPIPLS-FFELKNLKILLLSSNKFVGTIE  471 (1005)
Q Consensus       393 l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~-l~~l~~L~~L~L~~n~l~~~~~  471 (1005)
                      +++.+|..+..+++|++|++++|.+.+                         .+|.. +..+++|++|++++|++.+.++
T Consensus       306 l~~~~p~~~~~l~~L~~L~L~~n~l~~-------------------------~ip~~~l~~l~~L~~L~Ls~n~l~~~~p  360 (768)
T 3rgz_A          306 FYGAVPPFFGSCSLLESLALSSNNFSG-------------------------ELPMDTLLKMRGLKVLDLSFNEFSGELP  360 (768)
T ss_dssp             EEECCCGGGGGCTTCCEEECCSSEEEE-------------------------ECCHHHHTTCTTCCEEECCSSEEEECCC
T ss_pred             CCCccchHHhcCCCccEEECCCCcccC-------------------------cCCHHHHhcCCCCCEEeCcCCccCcccc
Confidence            666666666666666666666555443                         33332 4445555555555555554444


Q ss_pred             hhHHHhcC-CCCeEeccCCeeeEecCCcccccCcccceEEcCCccCcCCCCCCCCCceeEEECcCCcCCCCCChhhhhhc
Q 047927          472 LDAIQRLR-NLFRLDLSYNRLAVVAGSSVYCFPPLLTTLSLASCKLSAIPNLRKQTKLYHLDLSDNQISGEIPNWLWKIG  550 (1005)
Q Consensus       472 ~~~l~~l~-~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~l~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~~~  550 (1005)
                      . .+..++ +|++|++++|.+.......+.                     ...+++|++|++++|.+++.+|..+..  
T Consensus       361 ~-~l~~l~~~L~~L~Ls~N~l~~~~~~~~~---------------------~~~~~~L~~L~L~~n~l~~~~p~~l~~--  416 (768)
T 3rgz_A          361 E-SLTNLSASLLTLDLSSNNFSGPILPNLC---------------------QNPKNTLQELYLQNNGFTGKIPPTLSN--  416 (768)
T ss_dssp             T-THHHHTTTCSEEECCSSEEEEECCTTTT---------------------CSTTCCCCEEECCSSEEEEECCGGGGG--
T ss_pred             H-HHHhhhcCCcEEEccCCCcCCCcChhhh---------------------hcccCCccEEECCCCccccccCHHHhc--
Confidence            2 233443 555555555544432111100                     011345566666666655555544322  


Q ss_pred             CCcccEEeCCCCcccCCCCCCccccCCcccEEEeccCcccccCCCCCCCcceeeCcCCcCccCCCcchhcccCceEEEEe
Q 047927          551 KDSFNHLNLSHNLLVSLEQPYSISDLTSLSVLDLHSNQIQGKIPPLPPNAAYVDYSGNNFTSSIPVDIGSFMSLSIFFSF  630 (1005)
Q Consensus       551 ~~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~ls~n~~~~~~p~~~~~~~~~L~~L~l  630 (1005)
                                               +++|++|++++|++++.+|                     ..+. .++.|++|++
T Consensus       417 -------------------------l~~L~~L~Ls~N~l~~~~p---------------------~~l~-~l~~L~~L~L  449 (768)
T 3rgz_A          417 -------------------------CSELVSLHLSFNYLSGTIP---------------------SSLG-SLSKLRDLKL  449 (768)
T ss_dssp             -------------------------CTTCCEEECCSSEEESCCC---------------------GGGG-GCTTCCEEEC
T ss_pred             -------------------------CCCCCEEECcCCcccCccc---------------------HHHh-cCCCCCEEEC
Confidence                                     3445555555555544333                     1222 2445555666


Q ss_pred             cCCcccccCChhhhccCCCCeEEccCccccccCCchhhhcCcccccEEECCCCcCCccccCccCCCCCccEEeCCCCeec
Q 047927          631 SKNSLTGVIPESICNATNLLVLDLSYNYLSGMIPTCLINMSDSQLGVLNLRRNNLNGTVSATFPANCSLRTLDLNGNQLE  710 (1005)
Q Consensus       631 ~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N~l~  710 (1005)
                      ++|.+++.+|..+..+++|++|++++|++++.+|..+..++  +|++|++++|++++.+|..+..+++|++|+|++|+++
T Consensus       450 ~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~--~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~  527 (768)
T 3rgz_A          450 WLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCT--NLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFS  527 (768)
T ss_dssp             CSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCT--TCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCE
T ss_pred             CCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCC--CCCEEEccCCccCCcCChHHhcCCCCCEEECCCCccc
Confidence            66666666666677777777777777777777777777766  6777777777777777777777777777777777777


Q ss_pred             ccCcccccCCCCCCEEECCCCcCCCCcchhhhcCCCCcEEecCCCc----------------------CCcccCCCCCCC
Q 047927          711 GMVPKSLANCSVLEILDLGNNQFDDTFPCWVKNASRLHVLILRSNN----------------------FFGNISCPRYNV  768 (1005)
Q Consensus       711 ~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~----------------------l~~~~~~~~~~~  768 (1005)
                      +.+|..+..+++|++|++++|+++|.+|.++.....+..+++..+.                      +.+..  +..+.
T Consensus       528 ~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~  605 (768)
T 3rgz_A          528 GNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIR--SEQLN  605 (768)
T ss_dssp             EECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCC--GGGGG
T ss_pred             CcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccccccccccccccccccccccccc--chhhh
Confidence            7777777777777777777777777777776665555444333210                      11111  22333


Q ss_pred             CCCCccEEEccCCcccccCChHHHhhhhhhhhccCCchhhhchhhheecccccccccccEEEEEcchHHHHHHhcccceE
Q 047927          769 SWPMLQIIDLASNKFSGRLPQKWLLNLEAMMVDEGRSQSELKHLQYRFLNLSQAYYQDAITVTIKGLEMKLAKILNIFTS  848 (1005)
Q Consensus       769 ~l~~L~~L~ls~N~~~~~~p~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~  848 (1005)
                      .++.++.++++.|.+.|.+|..                                                 +..++.|+.
T Consensus       606 ~l~~~~~~~l~~~~~~g~~~~~-------------------------------------------------~~~l~~L~~  636 (768)
T 3rgz_A          606 RLSTRNPCNITSRVYGGHTSPT-------------------------------------------------FDNNGSMMF  636 (768)
T ss_dssp             GGGGTCCSCTTSCEEEEECCCS-------------------------------------------------CSSSBCCCE
T ss_pred             ccccccccccccceecccCchh-------------------------------------------------hhccccccE
Confidence            3444445555555555555532                                                 124678999


Q ss_pred             EECCCCeeeccCcccccCCCCCCEEECCCCcCcccCchhhhcCCCCCEEeCCCCcCcccCcccccCCCCCCeEEccCCcc
Q 047927          849 IDFSRNNFEGPIPEEMGLLQSLCALNLSHNALTGSIPSLIGNLREIESLDLSMNNLSGTIPAQLASLNFLSVLNLSYNHL  928 (1005)
Q Consensus       849 L~Ls~N~l~g~ip~~~~~l~~L~~L~Ls~N~l~g~ip~~~~~l~~L~~LdLs~N~l~~~ip~~l~~l~~L~~L~ls~N~l  928 (1005)
                      ||||+|+++|.+|++|+++++|++|||++|+++|.||+.++++++|++||||+|+++|.||..++++++|++||+|+|+|
T Consensus       637 LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l  716 (768)
T 3rgz_A          637 LDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNL  716 (768)
T ss_dssp             EECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEE
T ss_pred             EECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCCCCcccccccccccCCCCCCCCCCCCCCCC
Q 047927          929 VGRIPTSTQLQSFLATSFEGNDRLWGPPLNVCPTN  963 (1005)
Q Consensus       929 ~g~ip~~~~~~~~~~~~~~gn~~lc~~~~~~c~~~  963 (1005)
                      +|.||..+||.+|...+|.||++|||+|+..|...
T Consensus       717 ~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~~~  751 (768)
T 3rgz_A          717 SGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPS  751 (768)
T ss_dssp             EEECCSSSSGGGSCGGGGCSCTEEESTTSCCCCSC
T ss_pred             cccCCCchhhccCCHHHhcCCchhcCCCCcCCCCC
Confidence            99999999999999999999999999998889653



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1005
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-09
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-11
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 7e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 3e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 6e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 6e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 86.6 bits (213), Expect = 2e-18
 Identities = 77/401 (19%), Positives = 139/401 (34%), Gaps = 31/401 (7%)

Query: 291 ILSATNFSGILPDSIKNLKNLSRVEFYLCNFNGPIPTSMSDLSQLVYLDMSFNHFSGPIP 350
           I   T  + I  D+   L    +      N    +  S +DL Q+  L          I 
Sbjct: 6   ITQDTPINQIFTDT--ALAEKMKTVLGKTNVTDTV--SQTDLDQVTTLQADRLGIKS-ID 60

Query: 351 SLHMFRNLAYLDLSYNIFTGGISSIGWEQLLNLFHVDLSHNNLGGSIPQSLFELPMVQHL 410
            +    NL  ++ S N  T         +L+++   +    ++      +      + + 
Sbjct: 61  GVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNN 120

Query: 411 LLADNQFDGHVTEISNASSSLLDTLDLSDNNLEGPI--------PLSFFELKNLKILLLS 462
            + D     ++T ++    S     D+S  +    +              L NL  L   
Sbjct: 121 QITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERL 180

Query: 463 SNKFVGTIELDAIQRLRNLFRLDLSYNRLAVVAGSSVYCFPPLLTTLSLASCKLSAIPNL 522
                   ++  + +L NL  L  + N+++     +       L  LSL   +L  I  L
Sbjct: 181 DISSNKVSDISVLAKLTNLESLIATNNQIS---DITPLGILTNLDELSLNGNQLKDIGTL 237

Query: 523 RKQTKLYHLDLSDNQISGEIPNWLWKIGKDSFNHLNLSHNLLVSLEQPYSISDLTSLSVL 582
              T L  LDL++NQIS   P             L L  N + ++     ++ LT+L + 
Sbjct: 238 ASLTNLTDLDLANNQISNLAPLSGLT----KLTELKLGANQISNISPLAGLTALTNLELN 293

Query: 583 DLHSNQIQGKIPPLPPNAAYVDYSGNNFTSSIPVDIGSFMSLSIFFSFSKNSLTGVIPES 642
           +     I            Y+    NN +   P  + S   L   F F+ N ++     S
Sbjct: 294 ENQLEDISPISNLKNLT--YLTLYFNNISDISP--VSSLTKLQRLF-FANNKVSD--VSS 346

Query: 643 ICNATNLLVLDLSYNYLSGMIPTCLINMSDSQLGVLNLRRN 683
           + N TN+  L   +N +S + P  L N+  +++  L L   
Sbjct: 347 LANLTNINWLSAGHNQISDLTP--LANL--TRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1005
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.64
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.63
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.48
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.41
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.41
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.37
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.37
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.36
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.16
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.12
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.09
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.06
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.1
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.96
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.51
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.51
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.93
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.72
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=5.1e-37  Score=332.50  Aligned_cols=292  Identities=28%  Similarity=0.391  Sum_probs=176.7

Q ss_pred             CcHHHHHHHHHHhhhCCCCCCCcccccCCCCCCCCc--ccceeEECCC---CCEEEEEcCCCCcccccCCCccccccccc
Q 047927            8 CQSDQQSLLLQMKSRLTFDSSVSFRMVQWSQSNDCC--TWSGVDCDEA---GRVIGLDLSEESISAGIDNSSSLFSLKYL   82 (1005)
Q Consensus         8 ~~~~~~~~ll~~k~~~~~~~~~~~~~~~w~~~~~~c--~w~gv~c~~~---~~v~~L~L~~~~l~~~~~~~~~l~~l~~L   82 (1005)
                      |.++||+||++||+++.+++    .+++|..+.|||  .|.||+|+..   +||++|||+++++.+....++.++++++|
T Consensus         3 c~~~e~~aLl~~k~~~~~~~----~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L   78 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNPT----TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYL   78 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCCG----GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTC
T ss_pred             CCHHHHHHHHHHHHHCCCCC----cCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCccc
Confidence            99999999999999997642    689999889999  4999999865   48999999999998754336778888888


Q ss_pred             ceeecCC-ccCCCCCCCCcccCCCCCcEEEcccCCCcCCCcccccCCCCCcEEeCCCcccccCccccCCCChhhhhhcCc
Q 047927           83 QSLNLAF-NMFNATEIPSGLGNLTNLTTLNLSNAGFAGQIPIQVSGMTRLVTLDLSGMYFVRAPLKLENPNLSGLLQNLA  161 (1005)
Q Consensus        83 ~~L~Ls~-~~~~~~~lp~~l~~l~~L~~L~Ls~n~~~~~lp~~l~~l~~L~~L~ls~n~~~~~~~~~~~~~~~~~l~~l~  161 (1005)
                      |+|+|++ |.+.+. +|..|+++++|++|+|++|++.+..|..+..+.+|++++++.|.+.....        ..+.++ 
T Consensus        79 ~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p--------~~l~~l-  148 (313)
T d1ogqa_          79 NFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLP--------PSISSL-  148 (313)
T ss_dssp             SEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCC--------GGGGGC-
T ss_pred             cccccccccccccc-cccccccccccchhhhccccccccccccccchhhhcccccccccccccCc--------hhhccC-
Confidence            8888875 667665 78888888888888888888877777777777777777777765422110        001111 


Q ss_pred             cCceeecCCccCCCchhhHHHHHhccCCCccEEEccCCCCCCCCCccccCCCCC-cEEECCCCCCCCCcchhccCCCCCc
Q 047927          162 ELRELYLDGVNISAPGIEWCQALSSLVPKLQVLSLSGCFLSGPVDPSLSNLRSL-SVIRLDMNDLYSPVPEFLADFSNLT  240 (1005)
Q Consensus       162 ~L~~L~l~~~~~~~~~~~~~~~l~~l~~~L~~L~L~~n~~~~~~~~~l~~l~~L-~~L~l~~n~~~~~~p~~l~~l~~L~  240 (1005)
                                                 ++++++++++|.+.+.+|..+..+..+ +.+++++|.+.+..|..+..+..+ 
T Consensus       149 ---------------------------~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-  200 (313)
T d1ogqa_         149 ---------------------------PNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-  200 (313)
T ss_dssp             ---------------------------TTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-
T ss_pred             ---------------------------cccceeeccccccccccccccccccccccccccccccccccccccccccccc-
Confidence                                       344444444445555555555555443 455555555555555544444332 


Q ss_pred             EEEccCCCCCccCccccCCCCCCCEEeCCCCCCCCCCCCcccCCCCCcEEEcccccccccCchhhccCCCCCEEeecCCc
Q 047927          241 SLYLSSCGLHGAFPEKILQLPTLETLDLSYNELLQGSLPDFHQNLSLETLILSATNFSGILPDSIKNLKNLSRVEFYLCN  320 (1005)
Q Consensus       241 ~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~l~~n~  320 (1005)
                      +++++.+...+.+|..+..+++++.+++++|.+ ...++.+..+++|+.|++++|++++.+|+.|+++++|++|++++|+
T Consensus       201 ~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l-~~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~  279 (313)
T d1ogqa_         201 FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSL-AFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNN  279 (313)
T ss_dssp             EEECCSSEEEECCGGGCCTTSCCSEEECCSSEE-CCBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSE
T ss_pred             ccccccccccccccccccccccccccccccccc-cccccccccccccccccCccCeecccCChHHhCCCCCCEEECcCCc
Confidence            455555555555555555555555555555543 2223333334444444444444444444444444444444444444


Q ss_pred             cCCCCCccCCCCCCCcEEECcCC
Q 047927          321 FNGPIPTSMSDLSQLVYLDMSFN  343 (1005)
Q Consensus       321 ~~~~~~~~l~~l~~L~~L~L~~n  343 (1005)
                      ++|.+|. ++++++|+.+++++|
T Consensus       280 l~g~iP~-~~~L~~L~~l~l~~N  301 (313)
T d1ogqa_         280 LCGEIPQ-GGNLQRFDVSAYANN  301 (313)
T ss_dssp             EEEECCC-STTGGGSCGGGTCSS
T ss_pred             ccccCCC-cccCCCCCHHHhCCC
Confidence            4443332 233344444444444



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure