Citrus Sinensis ID: 047934


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----
MRSSQGGIFIKLITNWKLHQSHPISISSALLRRFCSIRDFNTKNCDNDNRNDQNPPEPIPDRPLRGERPFTNQNQNRRSFQPRFNNYQQQQRPQQQSFQSPNGPRPKSPDGVQSDENFLDQFKLAIDKKPGNPQQNESLGQRQEQKPNRNEPISEPPQEADEIFKKMKETGLIPNAVAMLDGLCKDGLIQEAMKLFGLMREKGTIPEVVIYTAVVDGFCKAQKFDDAKRIFRKMQSNGIAPNAFSYNLLIQGLYKCNKLEEAVEYCIEMLEAGHSPNVTTFVGLVDGLCRERGVEKAQSVIATLKEKGFLVNDKAVREFLDKKAPFSSSVWEAIFGKKTLQKPF
cccccccHHHHHHHHHHHccccccccHHHHHHHHHccccccccccccccccccccccccccHHccccccccccccHHHHHHHHHHHHHcccccccEEEHHHHcccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccHHHHHccccccccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccEEEHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHcccccccHHHHHHHHcHHHcccc
ccccccEEEEEHccccccccccHHHHHHHHHHcccccccHcHHHHHHHccccccHHHHHHHHHHHcccHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHEHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccc
mrssqggiFIKLITnwklhqshpisiSSALLRRFCsirdfntkncdndnrndqnppepipdrplrgerpftnqnqnrrsfqprfnnyqqqqrpqqqsfqspngprpkspdgvqsdenFLDQFKLAidkkpgnpqqneslgqrqeqkpnrnepiseppqEADEIFKKMKETGLIPNAVAMLDGLCKDGLIQEAMKLFGLmrekgtipeVVIYTAVVDGFCKAQKFDDAKRIFRKMqsngiapnafsYNLLIQGLYKCNKLEEAVEYCIEMLeaghspnvttFVGLVDGLCRERGVEKAQSVIATLKEKGFLVNDKAVREFldkkapfsssVWEAIFgkktlqkpf
MRSSQGGIFIKLitnwklhqsHPISISSALLRRFCSIRDfntkncdndnrndqnppepipdrplrgerPFTNQNQNRRSFQPRFNNYQQQQRPQQQSFQSPNGPRPKSPDGVQSDENFLDQFKLAIDKKPGNPQQNeslgqrqeqkpnrnepiseppQEADEIFKKMKETGLIPNAVAMLDGLCKDGLIQEAMKLFGLMREKGTIPEVVIYTAVVDGFCKAQKFDDAKRIFRKMQsngiapnaFSYNLLIQGLYKCNKLEEAVEYCIEMLEAGHSPNVTTFVGLVDGLCRERGVEKAQSViatlkekgflvnDKAVREFldkkapfsssvweaifgkktlqkpf
MRSSQGGIFIKLITNWKLHQSHPISISSALLRRFCSIRDFNTKNCDNDNRNDQNPPEPIPDRPLRGERPFTNQNQNRRSfqprfnnyqqqqrpqqqsfqspnGPRPKSPDGVQSDENFLDQFKLAIDKKPGNPQQNESLGQRQEQKPNRNEPISEPPQEADEIFKKMKETGLIPNAVAMLDGLCKDGLIQEAMKLFGLMREKGTIPEVVIYTAVVDGFCKAQKFDDAKRIFRKMQSNGIAPNAFSYNLLIQGLYKCNKLEEAVEYCIEMLEAGHSPNVTTFVGLVDGLCRERGVEKAQSVIATLKEKGFLVNDKAVREFLDKKAPFSSSVWEAIFGKKTLQKPF
******GIFIKLITNWKLHQSHPISISSALLRRFCSIRDFNT******************************************************************************************************************************ETGLIPNAVAMLDGLCKDGLIQEAMKLFGLMREKGTIPEVVIYTAVVDGFCKAQKFDDAKRIFRKMQSNGIAPNAFSYNLLIQGLYKCNKLEEAVEYCIEMLEAGHSPNVTTFVGLVDGLCRERGVEKAQSVIATLKEKGFLVNDKAVREFLDKKAPFSSSVWEAIFG********
******G****LITN***********SSALLRRFCSIRDFNTKNCD******QNPPEPIPDRPLRGERPFTNQNQNRRSFQPRFNNYQQQQRPQQQSFQSPNGPRPKSPDGVQSDENFLDQFKLAIDKKPGNPQQNESLGQRQEQKPNRNEPISEPPQEADEIFKKMKETGLIPNAVAMLDGLCKDGLIQEAMKLFGLMREKGTIPEVVIYTAVVDGFCKAQKFDDAKRIFRKMQSNGIAPNAFSYNLLIQGLYKCNKLEEAVEYCIEMLEAGHSPNVTTFVGLVDGLCRERGVEKAQSVIATLKEKGFLVNDKAVREFLDKKAPFSSSVWEAIFGKKTLQKPF
MRSSQGGIFIKLITNWKLHQSHPISISSALLRRFCSIRDFNTKNCDNDNRNDQNPPEPIPDRPLRGERPFTNQNQNRRSFQPRFN***************************QSDENFLDQFKLAIDKKPGN************************PQEADEIFKKMKETGLIPNAVAMLDGLCKDGLIQEAMKLFGLMREKGTIPEVVIYTAVVDGFCKAQKFDDAKRIFRKMQSNGIAPNAFSYNLLIQGLYKCNKLEEAVEYCIEMLEAGHSPNVTTFVGLVDGLCRERGVEKAQSVIATLKEKGFLVNDKAVREFLDKKAPFSSSVWEAIFGKKTLQKPF
**SSQGGIFIKLITNWKLHQSHPISISSALLRRFCSIRDFNTKNCDNDNRNDQNPPEPIPDRPLRGERPFTNQNQNRRSFQPRFNNYQQQQRPQQQSFQSPNGPRPKSPDGVQSDENFLDQFKLAIDKKPGNPQQNESLGQRQEQKPNRNEPISEPPQEADEIFKKMKETGLIPNAVAMLDGLCKDGLIQEAMKLFGLMREKGTIPEVVIYTAVVDGFCKAQKFDDAKRIFRKMQSNGIAPNAFSYNLLIQGLYKCNKLEEAVEYCIEMLEAGHSPNVTTFVGLVDGLCRERGVEKAQSVIATLKEKGFLVNDKAVREFLDKKAPFSSSVWEAIFGKKTLQK**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSSQGGIFIKLITNWKLHQSHPISISSALLRRFCSIRDFNTKNCDNDNRNDQNPPEPIPDRPLRGERPFTNQNQNRRSFQPRFNNYQQQQRPQQQSFQSPNGPRPKSPDGVQSDENFLDQFKLAIDKKPGNPQQNESLGQRQEQKPNRNEPISEPPQEADEIFKKMKETGLIPNAVAMLDGLCKDGLIQEAMKLFGLMREKGTIPEVVIYTAVVDGFCKAQKFDDAKRIFRKMQSNGIAPNAFSYNLLIQGLYKCNKLEEAVEYCIEMLEAGHSPNVTTFVGLVDGLCRERGVEKAQSVIATLKEKGFLVNDKAVREFLDKKAPFSSSVWEAIFGKKTLQKPF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query344 2.2.26 [Sep-21-2011]
Q9SZL5302 Pentatricopeptide repeat- yes no 0.755 0.860 0.602 2e-92
Q6NQ83619 Pentatricopeptide repeat- no no 0.412 0.229 0.365 1e-23
Q0WVK7 741 Pentatricopeptide repeat- no no 0.438 0.203 0.337 6e-23
Q9LPX2 644 Pentatricopeptide repeat- no no 0.433 0.231 0.328 1e-22
Q9FIT7 974 Pentatricopeptide repeat- no no 0.436 0.154 0.366 2e-22
Q9ASZ8 621 Pentatricopeptide repeat- no no 0.433 0.239 0.368 2e-22
Q9T0D6 566 Pentatricopeptide repeat- no no 0.427 0.259 0.34 2e-22
Q0WPZ6 874 Pentatricopeptide repeat- no no 0.436 0.171 0.326 5e-22
Q9FLJ4 654 Pentatricopeptide repeat- no no 0.430 0.226 0.370 7e-22
Q0WKV3 637 Pentatricopeptide repeat- no no 0.433 0.233 0.348 1e-21
>sp|Q9SZL5|PP356_ARATH Pentatricopeptide repeat-containing protein At4g38150 OS=Arabidopsis thaliana GN=At4g38150 PE=2 SV=1 Back     alignment and function desciption
 Score =  339 bits (869), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 176/292 (60%), Positives = 211/292 (72%), Gaps = 32/292 (10%)

Query: 53  QNPPEPIPDRPLRGERPFTNQNQNRRSFQPRFNNYQQQQRPQQQSFQSPNGPRPKSPDGV 112
           QNPPEP+P+RPLRGER   + N +R     + +N  +                    D  
Sbjct: 43  QNPPEPLPNRPLRGER---SSNSHREPPARQAHNLGKS-------------------DTT 80

Query: 113 QSDENFLDQFKLAIDKKPGNPQQNESLGQRQEQKPNRNEPISEPPQEADEIFKKMKETGL 172
            SD+ FL+QFKL ++       Q+     + EQ P   EP+  PP+++DEIFKKMKE GL
Sbjct: 81  LSDDGFLEQFKLGVN-------QDSRETPKPEQYPQ--EPLP-PPEDSDEIFKKMKEGGL 130

Query: 173 IPNAVAMLDGLCKDGLIQEAMKLFGLMREKGTIPEVVIYTAVVDGFCKAQKFDDAKRIFR 232
           IPNAVAMLDGLCKDGL+QEAMKLFGLMR+KGTIPEVVIYTAVV+ FCKA K +DAKRIFR
Sbjct: 131 IPNAVAMLDGLCKDGLVQEAMKLFGLMRDKGTIPEVVIYTAVVEAFCKAHKIEDAKRIFR 190

Query: 233 KMQSNGIAPNAFSYNLLIQGLYKCNKLEEAVEYCIEMLEAGHSPNVTTFVGLVDGLCRER 292
           KMQ+NGIAPNAFSY +L+QGLY CN L++AV +C EMLE+GHSPNV TFV LVD LCR +
Sbjct: 191 KMQNNGIAPNAFSYGVLVQGLYNCNMLDDAVAFCSEMLESGHSPNVPTFVELVDALCRVK 250

Query: 293 GVEKAQSVIATLKEKGFLVNDKAVREFLDKKAPFSSSVWEAIFGKKTLQKPF 344
           GVE+AQS I TL +KGF VN KAV+EF+DK+APF S  WEAIF KK  +KPF
Sbjct: 251 GVEQAQSAIDTLNQKGFAVNVKAVKEFMDKRAPFPSLAWEAIFKKKPTEKPF 302





Arabidopsis thaliana (taxid: 3702)
>sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 Back     alignment and function description
>sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 Back     alignment and function description
>sp|Q9LPX2|PPR39_ARATH Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 Back     alignment and function description
>sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 Back     alignment and function description
>sp|Q9T0D6|PP306_ARATH Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana GN=At4g11690 PE=2 SV=1 Back     alignment and function description
>sp|Q0WPZ6|PP158_ARATH Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLJ4|PP440_ARATH Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 Back     alignment and function description
>sp|Q0WKV3|PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query344
356538160388 PREDICTED: pentatricopeptide repeat-cont 0.857 0.760 0.600 2e-99
356495421397 PREDICTED: pentatricopeptide repeat-cont 0.901 0.780 0.576 9e-98
224131960347 predicted protein [Populus trichocarpa] 0.898 0.890 0.556 2e-97
388496610372 unknown [Lotus japonicus] 0.813 0.752 0.589 8e-91
15233698302 pentatricopeptide repeat-containing prot 0.755 0.860 0.602 1e-90
18700180302 AT4g38150/F20D10_270 [Arabidopsis thalia 0.755 0.860 0.599 3e-90
297801902301 pentatricopeptide repeat-containing prot 0.776 0.887 0.585 8e-90
255546664313 pentatricopeptide repeat-containing prot 0.880 0.968 0.546 9e-90
147854551381 hypothetical protein VITISV_020581 [Viti 0.697 0.629 0.641 1e-85
225428364380 PREDICTED: pentatricopeptide repeat-cont 0.697 0.631 0.637 5e-85
>gi|356538160|ref|XP_003537572.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Glycine max] Back     alignment and taxonomy information
 Score =  368 bits (945), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 191/318 (60%), Positives = 233/318 (73%), Gaps = 23/318 (7%)

Query: 47  NDNRNDQNPPEPIPDRPLRGERP-------FTNQNQNRRSFQPRFNNYQQQQRPQQQ--- 96
           ++  +DQ+  EPIP RPLR  +P       F   ++   SF PRF  Y     P +    
Sbjct: 74  DNGESDQSLSEPIPSRPLRSRKPVNQPPPRFQEYDRGSHSFPPRF--YDNHGGPDELDQT 131

Query: 97  --------SFQSPNGPRPKSPDGVQSDENFLDQFKLAIDKKPGNPQQNESLGQRQEQK-P 147
                   +FQ+ N  +    D  QS ++FL++FKL  D K  N  +  +  Q +E K  
Sbjct: 132 NKSSKIDLAFQNTNVAKTNR-DAGQSGDSFLNKFKLGFDDKTVNLSEVAASKQSEEAKRS 190

Query: 148 NRNEPISEP-PQEADEIFKKMKETGLIPNAVAMLDGLCKDGLIQEAMKLFGLMREKGTIP 206
           N N+P  E  PQ+ADEIFKKMKETGLIPNAVAMLDGLCKDGL+QEA+KLFGLMREKGTIP
Sbjct: 191 NPNQPAQESMPQDADEIFKKMKETGLIPNAVAMLDGLCKDGLVQEALKLFGLMREKGTIP 250

Query: 207 EVVIYTAVVDGFCKAQKFDDAKRIFRKMQSNGIAPNAFSYNLLIQGLYKCNKLEEAVEYC 266
           E+VIYTAVV+G+ KA K DDAKRIFRKMQS+G++PNAFSY +LIQGLYKC++L +A E+C
Sbjct: 251 EIVIYTAVVEGYTKAHKADDAKRIFRKMQSSGVSPNAFSYMVLIQGLYKCSRLHDAFEFC 310

Query: 267 IEMLEAGHSPNVTTFVGLVDGLCRERGVEKAQSVIATLKEKGFLVNDKAVREFLDKKAPF 326
           +EMLEAGHSPNVTTFVGLVDG C E+GVE+A+S I TL +KGF+VN+KAVR+FLDKKAPF
Sbjct: 311 VEMLEAGHSPNVTTFVGLVDGFCNEKGVEEAKSAIKTLTDKGFVVNEKAVRQFLDKKAPF 370

Query: 327 SSSVWEAIFGKKTLQKPF 344
           S SVWEAIFGKK  Q+PF
Sbjct: 371 SPSVWEAIFGKKAPQRPF 388




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356495421|ref|XP_003516576.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Glycine max] Back     alignment and taxonomy information
>gi|224131960|ref|XP_002328150.1| predicted protein [Populus trichocarpa] gi|222837665|gb|EEE76030.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388496610|gb|AFK36371.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|15233698|ref|NP_195528.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|79326453|ref|NP_001031806.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75266764|sp|Q9SZL5.1|PP356_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g38150 gi|4467121|emb|CAB37555.1| putative protein [Arabidopsis thaliana] gi|7270799|emb|CAB80480.1| putative protein [Arabidopsis thaliana] gi|26453272|dbj|BAC43709.1| unknown protein [Arabidopsis thaliana] gi|332661484|gb|AEE86884.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332661485|gb|AEE86885.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18700180|gb|AAL77701.1| AT4g38150/F20D10_270 [Arabidopsis thaliana] gi|23505863|gb|AAN28791.1| At4g38150/F20D10_270 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297801902|ref|XP_002868835.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297314671|gb|EFH45094.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255546664|ref|XP_002514391.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546488|gb|EEF47987.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147854551|emb|CAN78573.1| hypothetical protein VITISV_020581 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225428364|ref|XP_002283311.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query344
TAIR|locus:2120983302 AT4G38150 "AT4G38150" [Arabido 0.654 0.745 0.680 9.1e-88
TAIR|locus:2831869363 AT5G03560 [Arabidopsis thalian 0.555 0.526 0.364 6.9e-31
TAIR|locus:2077061619 AT3G22470 "AT3G22470" [Arabido 0.430 0.239 0.350 4.2e-24
TAIR|locus:1009023134 644 AT1G12775 [Arabidopsis thalian 0.433 0.231 0.328 9.7e-24
TAIR|locus:2174008 974 AT5G61990 "AT5G61990" [Arabido 0.444 0.157 0.365 9.6e-23
TAIR|locus:2195047 621 AT1G12620 [Arabidopsis thalian 0.433 0.239 0.368 1.1e-22
TAIR|locus:2139732 566 AT4G11690 [Arabidopsis thalian 0.427 0.259 0.34 1.4e-22
TAIR|locus:2163041527 AT5G41170 [Arabidopsis thalian 0.433 0.282 0.342 3.1e-22
TAIR|locus:2161408 472 AT5G46100 "AT5G46100" [Arabido 0.427 0.311 0.36 4.4e-22
TAIR|locus:2026207548 AT1G62680 [Arabidopsis thalian 0.433 0.271 0.342 4.4e-22
TAIR|locus:2120983 AT4G38150 "AT4G38150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 810 (290.2 bits), Expect = 9.1e-88, Sum P(2) = 9.1e-88
 Identities = 160/235 (68%), Positives = 187/235 (79%)

Query:   110 DGVQSDENFLDQFKLAIDKKPGNPQQNESLGQRQEQKPNRNEPISEPPQEADEIFKKMKE 169
             D   SD+ FL+QFKL +     N    E+   + EQ P   EP+  PP+++DEIFKKMKE
Sbjct:    78 DTTLSDDGFLEQFKLGV-----NQDSRET--PKPEQYPQ--EPLP-PPEDSDEIFKKMKE 127

Query:   170 TGLIPNAVAMLDGLCKDGLIQEAMKLFGLMREKGTIPEVVIYTAVVDGFCKAQKFDDAKR 229
              GLIPNAVAMLDGLCKDGL+QEAMKLFGLMR+KGTIPEVVIYTAVV+ FCKA K +DAKR
Sbjct:   128 GGLIPNAVAMLDGLCKDGLVQEAMKLFGLMRDKGTIPEVVIYTAVVEAFCKAHKIEDAKR 187

Query:   230 IFRKMQSNGIAPNAFSYNLLIQGLYKCNKLEEAVEYCIEMLEAGHSPNVTTFVGLVDGLC 289
             IFRKMQ+NGIAPNAFSY +L+QGLY CN L++AV +C EMLE+GHSPNV TFV LVD LC
Sbjct:   188 IFRKMQNNGIAPNAFSYGVLVQGLYNCNMLDDAVAFCSEMLESGHSPNVPTFVELVDALC 247

Query:   290 RERGVEKAQSVIATLKEKGFLVNDKAVREFLDKKAPFSSSVWEAIFGKKTLQKPF 344
             R +GVE+AQS I TL +KGF VN KAV+EF+DK+APF S  WEAIF KK  +KPF
Sbjct:   248 RVKGVEQAQSAIDTLNQKGFAVNVKAVKEFMDKRAPFPSLAWEAIFKKKPTEKPF 302


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2831869 AT5G03560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077061 AT3G22470 "AT3G22470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023134 AT1G12775 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174008 AT5G61990 "AT5G61990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195047 AT1G12620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139732 AT4G11690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163041 AT5G41170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161408 AT5G46100 "AT5G46100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026207 AT1G62680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SZL5PP356_ARATHNo assigned EC number0.60270.75580.8609yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-11
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-10
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-09
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-09
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-08
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-08
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-08
pfam1285434 pfam12854, PPR_1, PPR repeat 6e-07
pfam0153531 pfam01535, PPR, PPR repeat 9e-07
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-06
pfam0153531 pfam01535, PPR, PPR repeat 4e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-05
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-05
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-05
pfam0153531 pfam01535, PPR, PPR repeat 5e-05
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-04
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-04
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 0.001
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 0.002
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
 Score = 71.3 bits (176), Expect = 4e-16
 Identities = 22/50 (44%), Positives = 36/50 (72%)

Query: 206 PEVVIYTAVVDGFCKAQKFDDAKRIFRKMQSNGIAPNAFSYNLLIQGLYK 255
           P+VV Y  ++DG+CK  K ++A ++F +M+  GI PN ++Y++LI GL K
Sbjct: 1   PDVVTYNTLIDGYCKKGKVEEALKLFNEMKKRGIKPNVYTYSILIDGLCK 50


This repeat has no known function. It is about 35 amino acids long and is found in up to 18 copies in some proteins. The family appears to be greatly expanded in plants and fungi. The repeat has been called PPR. Length = 50

>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 344
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.98
PLN03218 1060 maturation of RBCL 1; Provisional 99.97
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.97
PLN03218 1060 maturation of RBCL 1; Provisional 99.97
PLN03077 857 Protein ECB2; Provisional 99.96
PLN03077 857 Protein ECB2; Provisional 99.96
PF1304150 PPR_2: PPR repeat family 99.43
PF1304150 PPR_2: PPR repeat family 99.41
PRK11788389 tetratricopeptide repeat protein; Provisional 99.17
PRK11788389 tetratricopeptide repeat protein; Provisional 99.15
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.11
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.05
PF1285434 PPR_1: PPR repeat 98.8
PF1285434 PPR_1: PPR repeat 98.77
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.75
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.71
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.57
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.42
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.35
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.3
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.28
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.26
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.24
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.21
PRK12370553 invasion protein regulator; Provisional 98.18
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.12
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.07
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 98.04
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 98.04
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.02
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.97
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.97
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.93
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.87
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.87
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.85
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.84
PRK14574 822 hmsH outer membrane protein; Provisional 97.82
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.81
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.78
PRK14574 822 hmsH outer membrane protein; Provisional 97.78
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.77
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.76
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.76
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.75
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.71
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.71
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.66
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.66
PRK12370553 invasion protein regulator; Provisional 97.65
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.65
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.61
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.58
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 97.57
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.56
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.53
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 97.5
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.4
KOG2003 840 consensus TPR repeat-containing protein [General f 97.39
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.37
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 97.26
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.26
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.24
PRK11189296 lipoprotein NlpI; Provisional 97.22
PRK11189296 lipoprotein NlpI; Provisional 97.2
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 97.2
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.15
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.13
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.11
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.06
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 97.04
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.02
PRK15359144 type III secretion system chaperone protein SscB; 96.99
KOG1126638 consensus DNA-binding cell division cycle control 96.99
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 96.97
PRK15359144 type III secretion system chaperone protein SscB; 96.97
PRK10370198 formate-dependent nitrite reductase complex subuni 96.97
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 96.96
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.95
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 96.94
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.93
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.89
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 96.87
KOG1129478 consensus TPR repeat-containing protein [General f 96.86
KOG1126638 consensus DNA-binding cell division cycle control 96.75
COG4783484 Putative Zn-dependent protease, contains TPR repea 96.74
KOG2003840 consensus TPR repeat-containing protein [General f 96.72
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.71
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.7
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.66
PRK10370198 formate-dependent nitrite reductase complex subuni 96.56
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.53
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 96.49
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.45
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.41
KOG1915 677 consensus Cell cycle control protein (crooked neck 96.4
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 96.4
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.37
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 96.35
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.33
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.33
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 96.31
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 96.29
COG4783484 Putative Zn-dependent protease, contains TPR repea 96.29
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 96.23
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 96.23
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.21
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.19
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.16
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 96.13
KOG3941 406 consensus Intermediate in Toll signal transduction 96.04
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.03
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.01
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 95.99
cd05804355 StaR_like StaR_like; a well-conserved protein foun 95.97
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 95.97
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.96
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.84
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.81
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 95.8
KOG2076 895 consensus RNA polymerase III transcription factor 95.8
KOG3941 406 consensus Intermediate in Toll signal transduction 95.77
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 95.65
KOG1129478 consensus TPR repeat-containing protein [General f 95.63
PF12688120 TPR_5: Tetratrico peptide repeat 95.51
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 95.41
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.38
smart00299140 CLH Clathrin heavy chain repeat homology. 95.28
KOG0547606 consensus Translocase of outer mitochondrial membr 95.27
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.25
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 95.25
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 95.21
PRK02603172 photosystem I assembly protein Ycf3; Provisional 95.17
KOG1915 677 consensus Cell cycle control protein (crooked neck 94.97
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 94.89
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.86
KOG2076 895 consensus RNA polymerase III transcription factor 94.75
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 94.74
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 94.72
PLN02789320 farnesyltranstransferase 94.71
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 94.58
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 94.57
KOG3785557 consensus Uncharacterized conserved protein [Funct 94.47
PRK10803263 tol-pal system protein YbgF; Provisional 94.44
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 94.4
KOG3616 1636 consensus Selective LIM binding factor [Transcript 94.35
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 94.14
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 94.02
KOG0547606 consensus Translocase of outer mitochondrial membr 94.02
KOG2047 835 consensus mRNA splicing factor [RNA processing and 93.87
PRK04841 903 transcriptional regulator MalT; Provisional 93.81
PF12688120 TPR_5: Tetratrico peptide repeat 93.75
KOG1128 777 consensus Uncharacterized conserved protein, conta 93.61
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 93.56
KOG4340459 consensus Uncharacterized conserved protein [Funct 93.51
KOG3785557 consensus Uncharacterized conserved protein [Funct 93.48
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 93.43
KOG2376 652 consensus Signal recognition particle, subunit Srp 93.28
KOG3616 1636 consensus Selective LIM binding factor [Transcript 93.2
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 93.05
PLN02789320 farnesyltranstransferase 93.01
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 92.97
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 92.95
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 92.94
PRK14720 906 transcript cleavage factor/unknown domain fusion p 92.94
KOG3060289 consensus Uncharacterized conserved protein [Funct 92.93
PRK10153517 DNA-binding transcriptional activator CadC; Provis 92.88
KOG4340 459 consensus Uncharacterized conserved protein [Funct 92.79
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 92.7
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 92.67
PF1337173 TPR_9: Tetratricopeptide repeat 92.67
KOG0495 913 consensus HAT repeat protein [RNA processing and m 92.41
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 92.27
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 92.16
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 92.12
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 92.11
PRK14720 906 transcript cleavage factor/unknown domain fusion p 91.61
PRK10803263 tol-pal system protein YbgF; Provisional 91.51
KOG3060289 consensus Uncharacterized conserved protein [Funct 91.49
PRK10153517 DNA-binding transcriptional activator CadC; Provis 91.44
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.57
PF1337173 TPR_9: Tetratricopeptide repeat 90.43
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 90.28
COG3629280 DnrI DNA-binding transcriptional activator of the 90.07
PRK04841 903 transcriptional regulator MalT; Provisional 90.03
KOG2796366 consensus Uncharacterized conserved protein [Funct 89.92
KOG0495 913 consensus HAT repeat protein [RNA processing and m 89.69
COG4105254 ComL DNA uptake lipoprotein [General function pred 89.57
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 89.4
KOG1125579 consensus TPR repeat-containing protein [General f 89.25
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 89.24
PF13762145 MNE1: Mitochondrial splicing apparatus component 89.1
KOG0553304 consensus TPR repeat-containing protein [General f 89.05
smart00299140 CLH Clathrin heavy chain repeat homology. 88.88
COG3629280 DnrI DNA-binding transcriptional activator of the 88.83
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 88.83
KOG2047 835 consensus mRNA splicing factor [RNA processing and 88.61
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 88.22
KOG2376 652 consensus Signal recognition particle, subunit Srp 88.16
KOG1128 777 consensus Uncharacterized conserved protein, conta 88.02
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 87.73
PF13929292 mRNA_stabil: mRNA stabilisation 87.66
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 87.47
KOG2391365 consensus Vacuolar sorting protein/ubiquitin recep 86.99
KOG0553304 consensus TPR repeat-containing protein [General f 86.87
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 86.8
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 86.78
PF13512142 TPR_18: Tetratricopeptide repeat 86.55
KOG4570 418 consensus Uncharacterized conserved protein [Funct 85.72
COG4700251 Uncharacterized protein conserved in bacteria cont 85.67
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 85.63
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 85.27
KOG4570 418 consensus Uncharacterized conserved protein [Funct 85.27
PRK15331165 chaperone protein SicA; Provisional 85.26
PF13512142 TPR_18: Tetratricopeptide repeat 85.03
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 84.59
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 84.38
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 84.27
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 84.1
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 83.61
PF13281374 DUF4071: Domain of unknown function (DUF4071) 83.49
PF13929292 mRNA_stabil: mRNA stabilisation 83.22
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 82.99
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 82.45
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 81.84
COG1729262 Uncharacterized protein conserved in bacteria [Fun 81.77
PRK15331165 chaperone protein SicA; Provisional 80.66
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 80.45
PF13762145 MNE1: Mitochondrial splicing apparatus component 80.21
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 80.04
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=99.98  E-value=7.9e-32  Score=282.15  Aligned_cols=223  Identities=18%  Similarity=0.212  Sum_probs=165.9

Q ss_pred             ccCchhHHhhhhhcCCCCCCCCCcccccchhcccccCC------------------------CCCCCCCHHHHHHHHHHH
Q 047934          112 VQSDENFLDQFKLAIDKKPGNPQQNESLGQRQEQKPNR------------------------NEPISEPPQEADEIFKKM  167 (344)
Q Consensus       112 ~~~~h~~~~k~gl~~~~~v~~~l~~~~~~~~~y~~~~~------------------------~~~~sg~~~~A~~lf~~M  167 (344)
                      +.++|+.+++.|+..+.++.++|+      ..|.++.+                        .|...|++++|.++|++|
T Consensus       243 ~~~l~~~~~~~g~~~d~~~~n~Li------~~y~k~g~~~~A~~vf~~m~~~~~vt~n~li~~y~~~g~~~eA~~lf~~M  316 (697)
T PLN03081        243 GQQLHCCVLKTGVVGDTFVSCALI------DMYSKCGDIEDARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEM  316 (697)
T ss_pred             HHHHHHHHHHhCCCccceeHHHHH------HHHHHCCCHHHHHHHHHhCCCCChhHHHHHHHHHHhCCCHHHHHHHHHHH
Confidence            467899999999999999999988      55555432                        122244555555555555


Q ss_pred             HHCCCCCCHH---HHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHH
Q 047934          168 KETGLIPNAV---AMLDGLCKDGLIQEAMKLFGLMREKGTIPEVVIYTAVVDGFCKAQKFDDAKRIFRKMQSNGIAPNAF  244 (344)
Q Consensus       168 ~~~gi~p~~~---tli~~~~k~g~~~~A~~lf~~M~~~g~~pd~~tyn~LI~ay~k~g~~e~A~~vf~~M~~~gi~pd~~  244 (344)
                      .+.|+.|+..   ++|.+|++.|++++|.+++.+|.+.|+.||..+||+||++|+++|++++|+++|++|.    +||++
T Consensus       317 ~~~g~~pd~~t~~~ll~a~~~~g~~~~a~~i~~~m~~~g~~~d~~~~~~Li~~y~k~G~~~~A~~vf~~m~----~~d~~  392 (697)
T PLN03081        317 RDSGVSIDQFTFSIMIRIFSRLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFDRMP----RKNLI  392 (697)
T ss_pred             HHcCCCCCHHHHHHHHHHHHhccchHHHHHHHHHHHHhCCCCCeeehHHHHHHHHHCCCHHHHHHHHHhCC----CCCee
Confidence            5555544432   3455555555555555555555555555555555566666666666666666666664    35788


Q ss_pred             HHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH-CCCcccHHHHHHHHhcc
Q 047934          245 SYNLLIQGLYKCNKLEEAVEYCIEMLEAGHSPNVTTFVGLVDGLCRERGVEKAQSVIATLKE-KGFLVNDKAVREFLDKK  323 (344)
Q Consensus       245 tyn~LI~ay~k~g~~~~A~~lf~~M~~~gv~pd~~ty~~lL~a~~~~G~~e~a~~l~~~M~~-~Gi~p~~~~~~~Ll~~y  323 (344)
                      |||+||.+|++.|+.++|+++|++|.+.|+.||..||+++|.+|++.|.+++|.++|+.|.+ .|+.|+..+|++++++|
T Consensus       393 t~n~lI~~y~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~~~~a~~~f~~m~~~~g~~p~~~~y~~li~~l  472 (697)
T PLN03081        393 SWNALIAGYGNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSACRYSGLSEQGWEIFQSMSENHRIKPRAMHYACMIELL  472 (697)
T ss_pred             eHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHhcCCcHHHHHHHHHHHHHhcCCCCCccchHhHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999986 69999999999999999


Q ss_pred             CCCChHH-----------------HHHHhcCccCCCCC
Q 047934          324 APFSSSV-----------------WEAIFGKKTLQKPF  344 (344)
Q Consensus       324 ak~g~~~-----------------W~all~~~~~~~~~  344 (344)
                      ++.|...                 |+++++.|+.++.+
T Consensus       473 ~r~G~~~eA~~~~~~~~~~p~~~~~~~Ll~a~~~~g~~  510 (697)
T PLN03081        473 GREGLLDEAYAMIRRAPFKPTVNMWAALLTACRIHKNL  510 (697)
T ss_pred             HhcCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCc
Confidence            9988542                 99999999888753



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 87.2 bits (214), Expect = 6e-19
 Identities = 37/275 (13%), Positives = 83/275 (30%), Gaps = 8/275 (2%)

Query: 54  NPPEPIPDRPLRGERPFTNQNQNRRSFQPRFNNYQQQQRPQQQSFQSPNGPRPKSPDGVQ 113
           +    +     +   P       +   + +     + QR + +          K+     
Sbjct: 6   HHHRKVQMGA-KDATPVPCGRWAKILEKDKRTQQMRMQRLKAKLQMPFQSGEFKALTRRL 64

Query: 114 SDENFLDQFKLAIDKKPGNPQQNESLGQRQEQKPNRNEPISEPPQEADEIFKKMKET--- 170
             E  L   ++A   +    Q  ES  + Q  +  +  P             +  +    
Sbjct: 65  QVEPRLLSKQMAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLS 124

Query: 171 GLIPNAVAMLDGLCKDGLIQEAMKLFGLMRE---KGTIPEVVIYTAVVDGFCKAQKFDDA 227
           G     +A          +  A  L  +      K  +  + +Y AV+ G+ +   F + 
Sbjct: 125 GQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKEL 184

Query: 228 KRIFRKMQSNGIAPNAFSYNLLIQGLYKCNKLEEAVEYCI-EMLEAGHSPNVTTFVGLVD 286
             +   ++  G+ P+  SY   +Q + + ++    +E C+ +M + G          L+ 
Sbjct: 185 VYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLS 244

Query: 287 GLCRERGVEKAQSVIATLKEKGFLVNDKAVREFLD 321
              R   ++    V  T      L       + L 
Sbjct: 245 EEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLR 279


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query344
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.98
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.84
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.83
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.51
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.47
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.93
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.93
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.9
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 98.9
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.88
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.87
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 98.85
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.85
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.83
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.83
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.8
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.8
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.75
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.75
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.74
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.73
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.73
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.71
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.7
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 98.69
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.68
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.68
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.66
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.66
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.66
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.63
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.62
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.6
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.59
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.58
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.56
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.54
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.51
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.51
3u4t_A272 TPR repeat-containing protein; structural genomics 98.49
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.47
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.47
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.47
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.46
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.46
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.41
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.41
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.4
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.39
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.37
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.35
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 98.3
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.29
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.27
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.27
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.18
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.17
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.16
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.14
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.14
3u4t_A272 TPR repeat-containing protein; structural genomics 98.1
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.06
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.05
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.05
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.02
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.02
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.99
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.96
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.96
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.96
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 97.94
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 97.92
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 97.9
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 97.9
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 97.9
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.89
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.88
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.87
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.87
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.86
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 97.84
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.84
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.82
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.78
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.75
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.74
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.74
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.73
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.7
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.69
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.68
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.68
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 97.67
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.66
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.65
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.65
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.64
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.63
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.61
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.61
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.59
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.58
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 97.58
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.58
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.57
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.56
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.54
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.53
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.53
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.52
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.52
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.52
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.5
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.49
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.49
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.49
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 97.48
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.47
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 97.46
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.46
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.46
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.45
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.45
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.44
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 97.44
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.43
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.42
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 97.41
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.39
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.38
3k9i_A117 BH0479 protein; putative protein binding protein, 97.37
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.37
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.35
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.35
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.34
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.32
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 97.31
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.31
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.29
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.29
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.28
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.25
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.25
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.23
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.23
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.23
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.23
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.2
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.17
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.16
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.15
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.15
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.14
3k9i_A117 BH0479 protein; putative protein binding protein, 97.13
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.13
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.09
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.06
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.03
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.03
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.02
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.99
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.92
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.88
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 96.79
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 96.76
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 96.7
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 96.67
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.66
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.66
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.65
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 96.59
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 96.57
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.54
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.53
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 96.45
4g1t_A472 Interferon-induced protein with tetratricopeptide 96.39
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 96.31
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.29
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 96.29
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 96.03
2kat_A115 Uncharacterized protein; NESG, structure, structur 95.97
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.93
4g1t_A472 Interferon-induced protein with tetratricopeptide 95.92
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 95.91
2kat_A115 Uncharacterized protein; NESG, structure, structur 95.87
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 95.86
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 95.76
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 95.75
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 95.59
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 95.56
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 95.48
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.32
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 95.31
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 95.12
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.11
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 95.05
3qww_A433 SET and MYND domain-containing protein 2; methyltr 94.92
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 94.89
3qww_A433 SET and MYND domain-containing protein 2; methyltr 94.72
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.68
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 94.41
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.29
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 94.23
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 94.21
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 93.9
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 93.73
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 93.33
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 93.19
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 92.7
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 92.56
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 92.46
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 92.22
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 91.43
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 91.35
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 91.08
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 90.47
1pc2_A152 Mitochondria fission protein; unknown function; NM 89.84
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 88.24
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 87.92
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 87.56
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 87.44
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 86.2
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 85.44
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 85.41
1pc2_A152 Mitochondria fission protein; unknown function; NM 85.31
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 85.3
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 84.61
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 81.61
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 80.69
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=99.98  E-value=2.4e-31  Score=267.14  Aligned_cols=180  Identities=14%  Similarity=0.137  Sum_probs=171.5

Q ss_pred             cCCCCCCCCCHHHHHHHHHHHHHCCCCCCH---HHHHHHHHHcCC---------HHHHHHHHHHHHHcCCCCCHHHHHHH
Q 047934          147 PNRNEPISEPPQEADEIFKKMKETGLIPNA---VAMLDGLCKDGL---------IQEAMKLFGLMREKGTIPEVVIYTAV  214 (344)
Q Consensus       147 ~~~~~~~sg~~~~A~~lf~~M~~~gi~p~~---~tli~~~~k~g~---------~~~A~~lf~~M~~~g~~pd~~tyn~L  214 (344)
                      .++.|.+.|++++|+++|++|.+.|+.|+.   ++||.+|++.+.         +++|+++|++|.+.|+.||..|||+|
T Consensus        32 ~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l~~A~~lf~~M~~~G~~Pd~~tyn~l  111 (501)
T 4g26_A           32 KLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLSRGFDIFKQMIVDKVVPNEATFTNG  111 (501)
T ss_dssp             HHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHHHHHHHHHHHHHHTTCCCCHHHHHHH
T ss_pred             HHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchHHHHHHHHHHHHHhCCCCCHHHHHHH
Confidence            345778899999999999999999999985   469999998764         78999999999999999999999999


Q ss_pred             HHHHHHcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCCH
Q 047934          215 VDGFCKAQKFDDAKRIFRKMQSNGIAPNAFSYNLLIQGLYKCNKLEEAVEYCIEMLEAGHSPNVTTFVGLVDGLCRERGV  294 (344)
Q Consensus       215 I~ay~k~g~~e~A~~vf~~M~~~gi~pd~~tyn~LI~ay~k~g~~~~A~~lf~~M~~~gv~pd~~ty~~lL~a~~~~G~~  294 (344)
                      |.+|++.|++++|+++|++|.+.|+.||..|||+||.+|++.|++++|.++|++|.+.|+.||..||++||.+|++.|++
T Consensus       112 I~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~G~~Pd~~ty~~Li~~~~~~g~~  191 (501)
T 4g26_A          112 ARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVESEVVPEEPELAALLKVSMDTKNA  191 (501)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCH
T ss_pred             HHHHHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHhhCCCH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHCCCcccHHHHHHHHhccCCC
Q 047934          295 EKAQSVIATLKEKGFLVNDKAVREFLDKKAPF  326 (344)
Q Consensus       295 e~a~~l~~~M~~~Gi~p~~~~~~~Ll~~yak~  326 (344)
                      ++|.+++++|.+.|+.|+..||+.|++.|+..
T Consensus       192 d~A~~ll~~Mr~~g~~ps~~T~~~l~~~F~s~  223 (501)
T 4g26_A          192 DKVYKTLQRLRDLVRQVSKSTFDMIEEWFKSE  223 (501)
T ss_dssp             HHHHHHHHHHHHHTSSBCHHHHHHHHHHHHSH
T ss_pred             HHHHHHHHHHHHhCCCcCHHHHHHHHHHHhcC
Confidence            99999999999999999999999999988753



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query344
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.56
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.32
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.32
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.27
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.12
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.08
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.74
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.54
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.52
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 97.49
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.49
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.36
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.35
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.33
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.27
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.24
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.22
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.19
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.17
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.07
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.05
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.99
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 96.98
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 96.78
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 96.78
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 96.64
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.63
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.48
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.45
d1hz4a_366 Transcription factor MalT domain III {Escherichia 96.24
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.13
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.12
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.08
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 95.92
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 95.85
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 95.84
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 95.66
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 95.37
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 95.18
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 94.6
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 94.57
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 94.55
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 94.09
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 94.08
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 93.39
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 92.31
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 91.58
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 90.2
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 89.73
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 89.04
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 87.25
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 86.64
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 85.59
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 85.11
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.56  E-value=2.4e-06  Score=76.29  Aligned_cols=170  Identities=14%  Similarity=0.028  Sum_probs=122.1

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCC--HHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCCHHHHH
Q 047934          151 EPISEPPQEADEIFKKMKETGLIPN--AVAMLDGLCKDGLIQEAMKLFGLMREKGTIPEVVIYTAVVDGFCKAQKFDDAK  228 (344)
Q Consensus       151 ~~~sg~~~~A~~lf~~M~~~gi~p~--~~tli~~~~k~g~~~~A~~lf~~M~~~g~~pd~~tyn~LI~ay~k~g~~e~A~  228 (344)
                      +...|++++|...|+.....+....  +..+-..+.+.|++++|.+.|+...+.. +-+..++..+-..|...|++++|.
T Consensus       213 ~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~  291 (388)
T d1w3ba_         213 LKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAE  291 (388)
T ss_dssp             HHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHH
T ss_pred             hhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHH
Confidence            3446778888888888776543321  1235677778888888888888877642 235678888888888888888888


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCC-CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHC
Q 047934          229 RIFRKMQSNGIAPNAFSYNLLIQGLYKCNKLEEAVEYCIEMLEAGHSP-NVTTFVGLVDGLCRERGVEKAQSVIATLKEK  307 (344)
Q Consensus       229 ~vf~~M~~~gi~pd~~tyn~LI~ay~k~g~~~~A~~lf~~M~~~gv~p-d~~ty~~lL~a~~~~G~~e~a~~l~~~M~~~  307 (344)
                      ..|+..... ...+...+..+...|.+.|++++|++.|++..+.  .| +..++..+-..|...|++++|.+.+++..+.
T Consensus       292 ~~~~~~~~~-~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l  368 (388)
T d1w3ba_         292 DCYNTALRL-CPTHADSLNNLANIKREQGNIEEAVRLYRKALEV--FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRI  368 (388)
T ss_dssp             HHHHHHHHH-CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTS--CTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTT
T ss_pred             HHHHhhhcc-CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh
Confidence            888877664 2446778888888888888888888888887653  34 4666777888888888888888888887753


Q ss_pred             CCccc-HHHHHHHHhccCCC
Q 047934          308 GFLVN-DKAVREFLDKKAPF  326 (344)
Q Consensus       308 Gi~p~-~~~~~~Ll~~yak~  326 (344)
                        .|+ ...+..|-..|.+.
T Consensus       369 --~P~~~~a~~~lg~~~~~~  386 (388)
T d1w3ba_         369 --SPTFADAYSNMGNTLKEM  386 (388)
T ss_dssp             --CTTCHHHHHHHHHHHHHT
T ss_pred             --CCCCHHHHHHHHHHHHHc
Confidence              443 44555555554433



>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure