Citrus Sinensis ID: 047943

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
MSSKLHIDQSLEYLPEELRYLHWYEYPLKTLPSNFEPENLLELNLPYSKIETIWEVKKEAPKLKYINLHNSQYLTGMPDLSETPNLERLNILNCTNLAYIPSCIHNFNNLRSVIGLCLRNTAIEEVPSSIESLTKLEKLDLSYCTRLKGLCKLDLGYCSKFECFPEIIEKMERLRSVDLQSTEVEELPSSMENLEGLKDLPDSLPNLKSLQFLNVERLFSIADLDKLEDLSISGRRGLILPPLLSGLSSLTKLVLTCCDVIEIPQDIGCLSSLELLFLCGNNFSKFTCKYQSTFTAEKTLLELLQYATVITRASSSSTLFSCNELQAAPVFARASIMSTRIRRIHIETIRIWRGQNREYDEPPGISNCLPGSQIPDWFRNQCSGSSITIQLPDYYCNENLIGIALCAIISFEEDSDAHDEYFNVVCNYSFKIKSRSQTKQVDDYCCLVSNVSMDVEHVILGFEPSRNVKLPDSDHHTAA
ccccEEEccccccccccccEEEEcccccccccccccccccEEEEccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccHHHHHccccccccccccccccccccccEEEcccccccccccEEEcccccccEEccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEcccccccccccccccccEEEEEcccccccccccEEEEEEEEEEccccccccccEEEEEEEEEEEccccccccccccEEEcccccccccEEEEEEEcccccccccccccccc
ccccEEcccccccccHHcEEEEEcccccccccccccHHHHEEEccccHHHHHHHccccccccccEEEcccccHcccccccccccccHEEEccccccHcccccHHHHHHHHHEEEccccccccccEccccHHcHHHccEEccccccHHccccEEEcccccHHHHcHHHHccHHHHHEEEccccccccccccHHcHHHccEcccccccccccccccccccccHcccccccEEEcccccccccccccccccccEEEEccccccEcccccHcccccccEEEcccccccccccHHHHHHHHHHccccccccccccccccccEEEEccHcHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccHHHcccccccEEEEEccccccccccccEEEEEEEEcccccccccccEEEEEEEEEEccccccEccccccccccccccccccEEEEEEccccccccccccccccc
MSSKLHIDQSLEYLPEELRYLHWYeyplktlpsnfepenllelnlpyskiETIWEVKkeapklkyinlhnsqyltgmpdlsetpnlerlnilnctnlayipscihNFNNLRSVIGLCLrntaieevpssIESLTKLEKLDLSYCTRLKGlckldlgycskfecFPEIIEKMERLRsvdlqsteveelpssmenleglkdlpdslpnlkslqflnVERLFSIAdldkledlsisgrrglilppllsglsslTKLVLTCCdvieipqdigclSSLELLFLcgnnfskftckyqSTFTAEKTLLELLQYATVITrasssstlfscnelqaapvFARASIMSTRIRRIHIETIRIWrgqnreydeppgisnclpgsqipdwfrnqcsgssitiqlpdyycneNLIGIALCAIIsfeedsdahdeYFNVVCNYSfkiksrsqtkqvddycclvsnvsmdVEHVilgfepsrnvklpdsdhhtaa
MSSKLHIDQSLEYLPEELRYLHWYEYPLKTLPSNFEPENLLELNLPYSKIETIWEVKKEAPKLKYINLHNSQYLTGMPDLSETPNLERLNILNCTNLAYIPSCIHNFNNLRSVIGLCLRNTAIEEVPSSIESLTKLEKLDLSYCTRLKGLCKLDLGYCSKFECFPEIIEKMERLRSVDLQSTEVEELPSSMENLEGLKDLPDSLPNLKSLQFLNVERLFSIADLDKLEDLSISGRRGLILPPLLSGLSSLTKLVLTCCDVIEIPQDIGCLSSLELLFLCGNNFSKFTCKYQSTFTAEKTLLELLQYATVITRASSSSTLFSCNELQAAPVFarasimstrirrIHIETIRIWRGQNREYDEPPGISNCLPGSQIPDWFRNQCSGSSITIQLPDYYCNENLIGIALCAIISFEEDSDAHDEYFNVVCNYSFKiksrsqtkqVDDYCCLVSNVSMDVEHVILGfepsrnvklpdsdhhtaa
MSSKLHIDQSLEYLPEELRYLHWYEYPLKTlpsnfepenllelnlpYSKIETIWEVKKEAPKLKYINLHNSQYLTGMPDLSETPNLERLNILNCTNLAYIPSCIHNFNNLRSVIGLCLRNTAIEEVPSSIESLTKLEKLDLSYCTRLKGLCKLDLGYCSKFECFPEIIEKMERLRSVDLQSTEVEELPSSMENLEGLKDLPDSLPNLKSLQFLNVERLFSIADLDKLEDLSIsgrrglilppllsglsslTKLVLTCCDVIEIPQDIGCLSSLELLFLCGNNFSKFTCKYQSTFTAEKTLLELLQYATVITRASSSSTLFSCNELQAAPVFARASIMSTrirrihietiriwrGQNREYDEPPGISNCLPGSQIPDWFRNQCSGSSITIQLPDYYCNENLIGIALCAIISFEEDSDAHDEYFNVVCNYSFKIKSRSQTKQVDDYCCLVSNVSMDVEHVILGFEPSRNVKLPDSDHHTAA
*********SLEYLPEELRYLHWYEYPLKTLPSNFEPENLLELNLPYSKIETIWEVKKEAPKLKYINLHNSQYLTGMPDLSETPNLERLNILNCTNLAYIPSCIHNFNNLRSVIGLCLRNTAIEEVPSSIESLTKLEKLDLSYCTRLKGLCKLDLGYCSKFECFPEIIEKMER*********************************LKSLQFLNVERLFSIADLDKLEDLSISGRRGLILPPLLSGLSSLTKLVLTCCDVIEIPQDIGCLSSLELLFLCGNNFSKFTCKYQSTFTAEKTLLELLQYATVITRASSSSTLFSCNELQAAPVFARASIMSTRIRRIHIETIRIWRGQNREYDEPPGISNCLPGSQIPDWFRNQCSGSSITIQLPDYYCNENLIGIALCAIISFEEDSDAHDEYFNVVCNYSFKIKSRSQTKQVDDYCCLVSNVSMDVEHVILGFE****************
MSSKLHIDQSLEYLPEELRYLHWYEYPLKTLPSNFEPENLLELNLPYSKIETIWEVKKEAPKLKYINLHNSQYLTGMPDLSETPNLERLNILNCTNLAYIPSCIHNFNNLRSVIGLCLRNTAIEEVPSSIESLTKLEKLDLSYCTRLKGLCKLDLGYCSKFECFPEIIEKMERLRSVDLQSTEVEELPSSMENLEGLKDLPDSLPNLKSLQFLNVERLFSIADLDKLEDLSISGRRGLILPPLLSGLSSLTKLVLTCCDVIEIPQDIGCLSSLELLFLCGNNFSKFTCKYQSTFTAEKTLLELLQYATVITRASSSSTLFSCNELQAAPV***ASIMSTRIRRIHIETIRIWRGQNREYDEPPGISNCLPGSQIPDWFRNQCSGSSITIQLPDYYCNENLIGIALCAIISFEEDSDAHDEYFNVVCNYSFKIKSRSQTKQVDDYCCLVSNVSMDVEHVILGFEPSRNVK**********
MSSKLHIDQSLEYLPEELRYLHWYEYPLKTLPSNFEPENLLELNLPYSKIETIWEVKKEAPKLKYINLHNSQYLTGMPDLSETPNLERLNILNCTNLAYIPSCIHNFNNLRSVIGLCLRNTAIEEVPSSIESLTKLEKLDLSYCTRLKGLCKLDLGYCSKFECFPEIIEKMERLRSVDLQSTEVEELPSSMENLEGLKDLPDSLPNLKSLQFLNVERLFSIADLDKLEDLSISGRRGLILPPLLSGLSSLTKLVLTCCDVIEIPQDIGCLSSLELLFLCGNNFSKFTCKYQSTFTAEKTLLELLQYATVITRASSSSTLFSCNELQAAPVFARASIMSTRIRRIHIETIRIWRGQNREYDEPPGISNCLPGSQIPDWFRNQCSGSSITIQLPDYYCNENLIGIALCAIISFEEDSDAHDEYFNVVCNYSFKIKSRSQTKQVDDYCCLVSNVSMDVEHVILGFEPSRNVKL*********
**SKLHIDQSLEYLPEELRYLHWYEYPLKTLPSNFEPENLLELNLPYSKIETIWEVKKEAPKLKYINLHNSQYLTGMPDLSETPNLERLNILNCTNLAYIPSCIHNFNNLRSVIGLCLRNTAIEEVPSSIESLTKLEKLDLSYCTRLKGLCKLDLGYCSKFECFPEIIEKMERLRSVDLQSTEVEELPSSMENLEGLKDLPDSLPNLKSLQFLNVERLFSIADLDKLEDLSISGRRGLILPPLLSGLSSLTKLVLTCCDVIEIPQDIGCLSSLELLFLCGNNFSKFTCKYQSTFTAEKTLLELLQYATVITRASSSSTLFSCNELQAAPVFARASIMSTRIRRIHIETIRIWRGQNREYDEPPGISNCLPGSQIPDWFRNQCSGSSITIQLPDYYCNENLIGIALCAIISFEEDSDAHDEYFNVVCNYSFKIKSRSQTKQVDDYCCLVSNVSMDVEHVILGFEPSRNV***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSKLHIDQSLEYLPEELRYLHWYEYPLKTLPSNFEPENLLELNLPYSKIETIWEVKKEAPKLKYINLHNSQYLTGMPDLSETPNLERLNILNCTNLAYIPSCIHNFNNLRSVIGLCLRNTAIEEVPSSIESLTKLEKLDLSYCTRLKGLCKLDLGYCSKFECFPEIIEKMERLRSVDLQSTEVEELPSSMENLEGLKDLPDSLPNLKSLQFLNVERLFSIADLDKLEDLSISGRRGLILPPLLSGLSSLTKLVLTCCDVIEIPQDIGCLSSLELLFLCGNNFSKFTCKYQSTFTAEKTLLELLQYATVITRASSSSTLFSCNELQAAPVFARASIMSTRIRRIHIETIRIWRGQNREYDEPPGISNCLPGSQIPDWFRNQCSGSSITIQLPDYYCNENLIGIALCAIISFEEDSDAHDEYFNVVCNYSFKIKSRSQTKQVDDYCCLVSNVSMDVEHVILGFEPSRNVKLPDSDHHTAA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query479 2.2.26 [Sep-21-2011]
Q9SZ67 1895 Probable WRKY transcripti no no 0.400 0.101 0.362 1e-26
Q403921144 TMV resistance protein N N/A no 0.801 0.335 0.265 4e-26
Q9FH83 1288 Probable WRKY transcripti no no 0.753 0.280 0.260 6e-23
O23530 1301 Protein SUPPRESSOR OF npr no no 0.530 0.195 0.347 2e-21
O82500 1095 Putative disease resistan no no 0.661 0.289 0.272 4e-21
Q9FL92 1372 Probable WRKY transcripti no no 0.862 0.301 0.258 2e-19
Q5M8G4605 Leucine-rich repeat-conta yes no 0.505 0.4 0.298 3e-14
Q6GPJ5605 Leucine-rich repeat-conta N/A no 0.496 0.393 0.297 1e-13
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.432 0.128 0.279 2e-12
Q5ZLN0603 Leucine-rich repeat-conta yes no 0.496 0.394 0.282 1e-09
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function desciption
 Score =  121 bits (303), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 91/251 (36%), Positives = 122/251 (48%), Gaps = 59/251 (23%)

Query: 9    QSLEYLPEELRYLHWYEYPLKTLPSNFEPENLLELNLPYSKIETIWEVKKEA-------- 60
            Q LEYLP +LR LHW  YPL +LP +F PENL+ELNLP S  + +W+ KK          
Sbjct: 1198 QGLEYLPSKLRLLHWEYYPLSSLPKSFNPENLVELNLPSSCAKKLWKGKKARFCTTNSSL 1257

Query: 61   PKLKYINLHNSQYLTGMPDLSETPNLER------------------------LNILNCTN 96
             KLK + L  S  LT +P LS   NLE                         LN+  C+ 
Sbjct: 1258 EKLKKMRLSYSDQLTKIPRLSSATNLEHIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSK 1317

Query: 97   LAYIPSCI----------------HNFNNLR-SVIGLCLRNTAIEEVPSSIESLTKLEKL 139
            L  IPS +                 NF  +  +V  L +  T I+E+PSSI++L  LEKL
Sbjct: 1318 LENIPSMVDLESLEVLNLSGCSKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKL 1377

Query: 140  DL----------SYCTRLKGLCKLDLGYCSKFECFPEIIEKMERLRSVDLQSTEVEELPS 189
            DL          +   +LK L  L+L  C   E FP+   +M+ LR +DL  T+++ELPS
Sbjct: 1378 DLENSRHLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIKELPS 1437

Query: 190  SMENLEGLKDL 200
            S+  L  L +L
Sbjct: 1438 SISYLTALDEL 1448
Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. May act also as a disease resistance protein with a serine/threonine-protein kinase activity.
Arabidopsis thaliana (taxid: 3702)
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query479
296090591 771 unnamed protein product [Vitis vinifera] 0.832 0.517 0.333 2e-47
255537139 1137 leucine-rich repeat-containing protein, 0.895 0.377 0.317 2e-47
359496026 1250 PREDICTED: TMV resistance protein N-like 0.784 0.300 0.345 7e-45
359493487 1162 PREDICTED: TMV resistance protein N-like 0.828 0.341 0.299 2e-43
359493273 1233 PREDICTED: TMV resistance protein N-like 0.778 0.302 0.343 2e-43
296081002 599 unnamed protein product [Vitis vinifera] 0.787 0.629 0.353 4e-43
224145016 1254 tir-nbs-lrr resistance protein [Populus 0.941 0.359 0.276 5e-43
297813715 1212 hypothetical protein ARALYDRAFT_327329 [ 0.903 0.357 0.286 1e-42
15234388 1219 TIR-NBS-LRR class disease resistance pro 0.889 0.349 0.289 1e-42
359493483 1274 PREDICTED: TMV resistance protein N-like 0.828 0.311 0.300 2e-42
>gi|296090591|emb|CBI40960.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  196 bits (499), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 181/542 (33%), Positives = 240/542 (44%), Gaps = 143/542 (26%)

Query: 4   KLHIDQSLEYLPEELRYLHWYEYPLKTLPSNFEPENLLELNLPYSKIETIWEVKKEAPKL 63
           K    Q  E+   +LRYL+W+ YPLK+LPSNF P+NL+ELNL    +E +W+  K   KL
Sbjct: 28  KRPFSQDFEFPSNKLRYLYWHRYPLKSLPSNFHPKNLVELNLCCCYVEELWKGVKHMEKL 87

Query: 64  KYINLHNSQYLTGMPDLSETPNLER------------------------LNILNCTNLAY 99
           + I+L +SQYL   PD S  PNLER                        LN+ +C NL  
Sbjct: 88  ECIDLSHSQYLVRTPDFSGIPNLERLIFEGCTDLREVHQSLGVLSKLIFLNLKDCKNLQC 147

Query: 100 IPSCIH-------------NFNNLRSVIG-------LCLRNTAIEEVPSSIESLTKLEKL 139
            PS I                +    ++G       L L  TAI E+PSSI   T+L  L
Sbjct: 148 FPSSIELESLKVLILSGCSKLDKFPEILGYLPNLLELHLNGTAITELPSSIGYATQLVSL 207

Query: 140 DLSYCTRLKGL----------CKLDLGYCSKFECFPEIIEKMERLRSVDLQSTEVEELPS 189
           D+  C R K L            L L  C+KFE FPEI+E ME LR + L  T ++ELP 
Sbjct: 208 DMEDCKRFKSLPCCIYKLKSLKILKLSGCAKFESFPEILENMEGLRELFLDGTAIKELPL 267

Query: 190 SMENLEGLK-----------DLPDSLPNLKSLQFL----------------NVERLF--- 219
           S+E+L GL             LP S+ NLKSL  L                N+E L    
Sbjct: 268 SVEHLNGLVLLNLRNCERLITLPSSICNLKSLSTLTLSGCSQLEKLPENLGNLECLVELV 327

Query: 220 -----------SIADLDKLEDLSISG-------------------RR-----GLILPPLL 244
                      SI  L  L+ LS  G                   RR     G  LP  L
Sbjct: 328 ADGSAVIQPPSSIVLLRNLKVLSFQGCNGSPSSRWNSRFWSMLCLRRISDSTGFRLPS-L 386

Query: 245 SGLSSLTKLVLTCCDVIE--IPQDIGC-LSSLELLFLCGNNFSKFT------CKYQSTFT 295
           SGL SL +L L+ C++ E  +P D+G  LSSLE L L GN+F          C  ++ + 
Sbjct: 387 SGLCSLKQLNLSDCNIKEGALPNDLGGYLSSLEYLNLKGNDFVTLPTGISKLCNLKALYL 446

Query: 296 A-EKTLLELLQYATVITRASSSSTLFSCNELQAAPVFARASIMSTRIRRIHIETIRIWRG 354
              K L EL      I R ++     +C  L+        S +S         + R   G
Sbjct: 447 GCCKRLQELPMLPPNINRINAQ----NCTSLET------LSGLSAPCWLAFTNSFRQNWG 496

Query: 355 QN---REYDEPPGISNCLPGSQIPDWFRNQCSGSSITIQLPDYYCNENLIGIALCAIISF 411
           Q     E    P  +  LPG+ IP+WFRNQC G SI +QLP ++ N+N +G A+C + + 
Sbjct: 497 QETYLAEVSRIPKFNTYLPGNGIPEWFRNQCMGDSIMVQLPSHWYNDNFLGFAMCIVFAL 556

Query: 412 EE 413
           +E
Sbjct: 557 KE 558

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359496026|ref|XP_002277166.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493487|ref|XP_003634612.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493273|ref|XP_002272034.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296081002|emb|CBI18506.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224145016|ref|XP_002325496.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862371|gb|EEE99877.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297813715|ref|XP_002874741.1| hypothetical protein ARALYDRAFT_327329 [Arabidopsis lyrata subsp. lyrata] gi|297320578|gb|EFH51000.1| hypothetical protein ARALYDRAFT_327329 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15234388|ref|NP_192938.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana] gi|4586106|emb|CAB40942.1| putative disease resistance protein (TMV N-like) [Arabidopsis thaliana] gi|7267902|emb|CAB78244.1| putative disease resistance protein (TMV N-like) [Arabidopsis thaliana] gi|332657683|gb|AEE83083.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359493483|ref|XP_003634610.1| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query479
TAIR|locus:2153363 1261 AT5G45200 [Arabidopsis thalian 0.565 0.214 0.289 4.5e-26
TAIR|locus:2081810 1226 AT3G51570 [Arabidopsis thalian 0.473 0.185 0.281 7.6e-26
TAIR|locus:2153328 1231 AT5G45230 [Arabidopsis thalian 0.922 0.359 0.252 3.9e-25
TAIR|locus:21553221170 LAZ5 "LAZARUS 5" [Arabidopsis 0.379 0.155 0.321 3.6e-24
TAIR|locus:2170333 1197 CSA1 "constitutive shade-avoid 0.793 0.317 0.275 6.8e-24
TAIR|locus:2158475 1217 RPS4 "RESISTANT TO P. SYRINGAE 0.434 0.170 0.283 8e-24
TAIR|locus:21732931059 AT5G38340 [Arabidopsis thalian 0.622 0.281 0.290 9.1e-24
TAIR|locus:2122209 1179 AT4G36150 [Arabidopsis thalian 0.542 0.220 0.264 1.6e-23
TAIR|locus:2122965 1210 AT4G19510 [Arabidopsis thalian 0.432 0.171 0.305 2.1e-23
TAIR|locus:21532071165 AT5G45060 [Arabidopsis thalian 0.440 0.181 0.267 1.1e-22
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 248 (92.4 bits), Expect = 4.5e-26, Sum P(2) = 4.5e-26
 Identities = 84/290 (28%), Positives = 143/290 (49%)

Query:     3 SKLHIDQSLEYLPEELRYLHWYEYPLKTXXXXXXXXXXXXXXXXYSKIETIWEVKKEAPK 62
             SKL+  + LE+LP+ELRYL+W +YP K                 YS+IE IWE +K+   
Sbjct:   604 SKLNFPEGLEFLPQELRYLNWLKYPEKNLPINFDPKNLIDLKLPYSQIEQIWEEEKDTSN 663

Query:    63 LKYINLHNSQYLTGMPDLSETPNLERLNILNCTNLAYIPSCIHNFNNLRSVIGLCLRN-T 121
             L++++L++S  L  +  LS    L+ +N+  CT L  +P  + N   + S++ L LR  T
Sbjct:   664 LQWLDLNHSSKLHSLSGLSRAQKLQSINLEGCTGLKTLPQVLQN---MESLMFLNLRGCT 720

Query:   122 AIEEVPSSIESLTKLEKLDLSYCTRLKG---LCK-LDLGYC--SKFECFPEIIEKMERLR 175
             ++E +P    +L  L  L LS C+R K    + K L+  Y   +  +  P  I  +++L 
Sbjct:   721 SLESLPDI--TLVGLRTLILSNCSRFKEFKLIAKNLEELYLDGTAIKELPSTIGDLQKLI 778

Query:   176 SVDLQSTE-VEELPSSMENLEGLKDLPDS-LPNLKSLQFLNVERLFSIADLDKLEDLSIX 233
             S+ L+  + +  LP S+ NL+ ++++  S   +L+S   +N + L  +  L  L+  +I 
Sbjct:   779 SLKLKDCKNLLSLPDSIGNLKAIQEIILSGCSSLESFPEVN-QNLKHLKTL-LLDGTAIK 836

Query:   234 XXXXXXXXXXXXXXXXXTKLVLTCCDVIEIPQDIGCLSSLELLFLCGNNF 283
                              ++   + C + E P+ I  LSS+  L L  N F
Sbjct:   837 KIPDILHHLSPDQGLTSSQ---SNCHLCEWPRGIYGLSSVRRLSLSSNEF 883
GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155322 LAZ5 "LAZARUS 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158475 RPS4 "RESISTANT TO P. SYRINGAE 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173293 AT5G38340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122209 AT4G36150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153207 AT5G45060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query479
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-35
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-06
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 8e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-04
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score =  140 bits (353), Expect = 2e-35
 Identities = 128/491 (26%), Positives = 203/491 (41%), Gaps = 116/491 (23%)

Query: 6    HIDQSLEYLPEELRYLHWYEYPLKTLPSNFEPENLLELNLPYSKIETIWEVKKEAPKLKY 65
            H+ +  +YLP +LR L W +YPL+ +PSNF PENL++L +  SK+E +W+       L+ 
Sbjct: 579  HLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRN 638

Query: 66   INLHNSQYLTGMPDLSETPNLERLNILNCTNLAYIPSCIHNFNNLRSVIGLCLRNTAIEE 125
            I+L  S+ L  +PDLS   NLE L + +C++L                           E
Sbjct: 639  IDLRGSKNLKEIPDLSMATNLETLKLSDCSSLV--------------------------E 672

Query: 126  VPSSIESLTKLEKLDLSYC---------TRLKGLCKLDLGYCSKFECFPEIIEKMERLRS 176
            +PSSI+ L KLE LD+S C           LK L +L+L  CS+ + FP+I   +  L  
Sbjct: 673  LPSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPDISTNISWL-- 730

Query: 177  VDLQSTEVEELPSS--MENLEGLK------------------------------------ 198
             DL  T +EE PS+  +ENL+ L                                     
Sbjct: 731  -DLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIP 789

Query: 199  ---DLPDSLPNLKSLQFL------NVERLFSIADLDKLEDLSISGRRGLILPPLLSGLSS 249
               +LP S+ NL  L+ L      N+E L +  +L+ LE L +SG   L   P +S  ++
Sbjct: 790  SLVELPSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGCSRLRTFPDIS--TN 847

Query: 250  LTKLVLTCCDVIEIPQDIGCLSSLELLFLCGNNFSKFTCKYQSTFTAEKTLLELLQYATV 309
            ++ L L+   + E+P  I   S+L   FL  N  +       +    +   LE + ++  
Sbjct: 848  ISDLNLSRTGIEEVPWWIEKFSNLS--FLDMNGCNNLQRVSLNISKLKH--LETVDFS-- 901

Query: 310  ITRASSSSTLFSCNELQAAPVFARASIMSTRIRRIHI---ETIRIWRGQNREYDEPPGIS 366
                        C  L  A      S ++     IH     T+ I        D+   + 
Sbjct: 902  -----------DCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNLDQEALLQ 950

Query: 367  N-------CLPGSQIPDWFRNQCSGSSIT-IQLPDYYCNENLIGIALCAIISFEE-DSDA 417
                     L G ++P +F ++ +G+S+T I L      +       CA++  E     +
Sbjct: 951  QQSIFKQLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVDSESFFIIS 1010

Query: 418  HDEYFNVVCNY 428
                  V C +
Sbjct: 1011 VSFDIQVCCRF 1021

syringae 6; Provisional. Length = 1153
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 479
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.83
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.82
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.76
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.72
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.69
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.68
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.68
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.67
KOG4237498 consensus Extracellular matrix protein slit, conta 99.54
KOG0617264 consensus Ras suppressor protein (contains leucine 99.53
KOG0617264 consensus Ras suppressor protein (contains leucine 99.53
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.45
KOG4237498 consensus Extracellular matrix protein slit, conta 99.32
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.32
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.19
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.02
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.98
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.98
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.94
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.92
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.78
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.73
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.73
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.71
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.7
KOG4341483 consensus F-box protein containing LRR [General fu 98.57
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.57
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.54
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.38
PLN03150623 hypothetical protein; Provisional 98.28
KOG4341483 consensus F-box protein containing LRR [General fu 98.2
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.18
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.17
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.17
PRK15386426 type III secretion protein GogB; Provisional 98.12
PRK15386426 type III secretion protein GogB; Provisional 98.11
PLN03150623 hypothetical protein; Provisional 98.1
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.1
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.06
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.05
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.97
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.87
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.73
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.7
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.55
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.42
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.23
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.0
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.91
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.78
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.75
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.74
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.69
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.69
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.62
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.12
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.96
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.95
PF0772520 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le 95.9
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.49
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.73
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.43
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.41
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.24
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.81
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.39
KOG2123 388 consensus Uncharacterized conserved protein [Funct 91.33
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.98
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.1
smart0037026 LRR Leucine-rich repeats, outliers. 89.1
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.89
smart0037026 LRR Leucine-rich repeats, outliers. 83.42
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.42
KOG0473326 consensus Leucine-rich repeat protein [Function un 80.44
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=5e-43  Score=397.51  Aligned_cols=399  Identities=28%  Similarity=0.465  Sum_probs=311.6

Q ss_pred             CceecCCccCCCccCceEEEecCCCCCCCCCCCCCCCceEEECCCCCCcccccccCCCCCCcEEEccCCCCCCCCCCCCC
Q 047943            3 SKLHIDQSLEYLPEELRYLHWYEYPLKTLPSNFEPENLLELNLPYSKIETIWEVKKEAPKLKYINLHNSQYLTGMPDLSE   82 (479)
Q Consensus         3 ~~~~~~~~~~~l~~~Lr~L~~~~~~l~~lp~~~~~~~L~~L~L~~s~i~~l~~~~~~l~~L~~L~Ls~~~~l~~~p~l~~   82 (479)
                      .++++|++++++|++||+|+|++|+++++|..|.+++|++|+|++++++.+|++++.+++|+.|+|+++..++.+|+++.
T Consensus       576 ~~~~lp~~~~~lp~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~  655 (1153)
T PLN03210        576 VRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSM  655 (1153)
T ss_pred             ceeecCcchhhcCcccEEEEecCCCCCCCCCcCCccCCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCCcccc
Confidence            35789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcEEeecCCCCCCCCCccccccCCccccceeeccCC-CceecCccccCCCCCCEEeccCCCCC-------CCCCEEe
Q 047943           83 TPNLERLNILNCTNLAYIPSCIHNFNNLRSVIGLCLRNT-AIEEVPSSIESLTKLEKLDLSYCTRL-------KGLCKLD  154 (479)
Q Consensus        83 l~~L~~L~L~~c~~l~~~p~~l~~l~~L~~L~~L~L~~~-~i~~lp~~i~~l~~L~~L~L~~c~~L-------~~L~~L~  154 (479)
                      +++|++|++++|..+..+|..++++.+   |+.|++++| .+..+|..+ ++++|+.|++++|..+       .+|+.|+
T Consensus       656 l~~Le~L~L~~c~~L~~lp~si~~L~~---L~~L~L~~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~~~nL~~L~  731 (1153)
T PLN03210        656 ATNLETLKLSDCSSLVELPSSIQYLNK---LEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDISTNISWLD  731 (1153)
T ss_pred             CCcccEEEecCCCCccccchhhhccCC---CCEEeCCCCCCcCccCCcC-CCCCCCEEeCCCCCCccccccccCCcCeee
Confidence            999999999999999999988776655   555999886 567888766 7889999999988654       3567888


Q ss_pred             cCCCCCCCccchhhhccccCCeeeccCccccccC--------------cc-----cccccCCCCCCCCCCCCCCCCeeec
Q 047943          155 LGYCSKFECFPEIIEKMERLRSVDLQSTEVEELP--------------SS-----MENLEGLKDLPDSLPNLKSLQFLNV  215 (479)
Q Consensus       155 L~~c~~l~~~p~~~~~l~~L~~L~L~~~~i~~lp--------------~~-----i~~l~~L~~lp~~l~~l~~L~~L~l  215 (479)
                      ++++. +..+|..+ .+++|++|.+.++....+.              .+     +.++..+..+|..++++++|+.|++
T Consensus       732 L~~n~-i~~lP~~~-~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~L  809 (1153)
T PLN03210        732 LDETA-IEEFPSNL-RLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEI  809 (1153)
T ss_pred             cCCCc-cccccccc-cccccccccccccchhhccccccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEEC
Confidence            88765 45666544 4667777777653322111              11     1222334447777888888888888


Q ss_pred             CCC------ccccccCCCceeecCCCC-CCCCCcccCCCCCCCEEEcCCCCCccCCccCCCCCCCCEEeCCCCc-CCccC
Q 047943          216 ERL------FSIADLDKLEDLSISGRR-GLILPPLLSGLSSLTKLVLTCCDVIEIPQDIGCLSSLELLFLCGNN-FSKFT  287 (479)
Q Consensus       216 ~~l------~~l~~l~~L~~L~l~~~~-~~~lp~~~~~l~~L~~L~L~~~~l~~lp~~l~~l~~L~~L~Ls~n~-l~~lp  287 (479)
                      +++      +...++++|+.|++++|. ...+|..   .++|+.|+|++|.+.++|.++..+++|+.|++++|+ ++.+|
T Consensus       810 s~C~~L~~LP~~~~L~sL~~L~Ls~c~~L~~~p~~---~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~  886 (1153)
T PLN03210        810 ENCINLETLPTGINLESLESLDLSGCSRLRTFPDI---STNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVS  886 (1153)
T ss_pred             CCCCCcCeeCCCCCccccCEEECCCCCcccccccc---ccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccC
Confidence            763      222356788888888887 3455542   367888899988888888888889999999998876 88888


Q ss_pred             hhhhcCCCchhHHHHHhhhhhhhhccCCccccCCCccccccC--C---------------CCc--cccccCCccccchhh
Q 047943          288 CKYQSTFTAEKTLLELLQYATVITRASSSSTLFSCNELQAAP--V---------------FAR--ASIMSTRIRRIHIET  348 (479)
Q Consensus       288 ~~~i~~l~~L~~L~~~L~~n~~~~~~~~~~~l~~C~~L~~lp--~---------------lp~--~~~~~~C~~L~~~~~  348 (479)
                       ..+..+++|+.+                 .+.+|.+|+.++  .               +|+  ...|.||++|+....
T Consensus       887 -~~~~~L~~L~~L-----------------~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~~~l~f~nC~~L~~~a~  948 (1153)
T PLN03210        887 -LNISKLKHLETV-----------------DFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNLDQEAL  948 (1153)
T ss_pred             -cccccccCCCee-----------------ecCCCcccccccCCCCchhhhhhcccccccCCchhccccccccCCCchhh
Confidence             778888888888                 556666665432  1               221  245889999974332


Q ss_pred             HHHHHhhcccCCCCCCeeeecCCCCCCCccccCCCCceEE-EECCCCCCCCccceeeEEEEEeecCCCccCCCceeEEEE
Q 047943          349 IRIWRGQNREYDEPPGISNCLPGSQIPDWFRNQCSGSSIT-IQLPDYYCNENLIGIALCAIISFEEDSDAHDEYFNVVCN  427 (479)
Q Consensus       349 i~~~~~~~~~~~~~~~~~~~~pg~~iP~wf~~~~~g~s~~-i~lp~~~~~~~~~g~~~c~v~~~~~~~~~~~~~~~~~c~  427 (479)
                      +   +.+      .....+++||.++|+||.||+.|++++ |.+|+.|.+..|.||++|+|+++....+. ...+.+.|.
T Consensus       949 l---~~~------~~~~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~~~~~~~~~f~~c~v~~~~~~~~~-~~~~~~~~~ 1018 (1153)
T PLN03210        949 L---QQQ------SIFKQLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVDSESFFII-SVSFDIQVC 1018 (1153)
T ss_pred             h---ccc------ccceEEECCCccCchhccCCcccceeeeeccCCcccCCCccceEEEEEEecCccccC-CCceeEEEE
Confidence            2   111      123457899999999999999999998 99999999888999999999998876443 346899999


Q ss_pred             EEEeecCCccc
Q 047943          428 YSFKIKSRSQT  438 (479)
Q Consensus       428 ~~~~~~~~~~~  438 (479)
                      |+|++++|.+.
T Consensus      1019 c~~~~~~~~~~ 1029 (1153)
T PLN03210       1019 CRFIDRLGNHF 1029 (1153)
T ss_pred             EEEECCCCCcc
Confidence            99998877654

syringae 6; Provisional
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query479
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 6e-06
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 6e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (48%), Gaps = 15/121 (12%)
Query: 85  NLERLNILNCTNLAYIPSCIHNFNNLRSVIGLCLRNTAIEEVPSSIESLTKLEKLDLSYC 144
           NL+ L  L  T +  +P+ I N  NL+S   L +RN+ +  +  +I  L KLE+LDL  C
Sbjct: 184 NLQSLR-LEWTGIRSLPASIANLQNLKS---LKIRNSPLSALGPAIHHLPKLEELDLRGC 239
Query: 145 TRLKG----------LCKLDLGYCSKFECFPEIIEKMERLRSVDLQS-TEVEELPSSMEN 193
           T L+           L +L L  CS     P  I ++ +L  +DL+    +  LPS +  
Sbjct: 240 TALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQ 299
Query: 194 L 194
           L
Sbjct: 300 L 300
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query479
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-13
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-16
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-07
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 8e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  120 bits (303), Expect = 1e-30
 Identities = 55/298 (18%), Positives = 106/298 (35%), Gaps = 36/298 (12%)

Query: 10  SLEYLPEELRYLHWYEYPLKTLPSNF-EPENLLELNLPYSKIETIWEVKKE-----APKL 63
           +L    + L     +    +    +     N     +       +            P  
Sbjct: 24  ALRPYHDVLSQWQRHYNADRNRWHSAWRQANSNNPQIETRTGRALKATADLLEDATQPGR 83

Query: 64  KYINLHNSQYLTGMPD-LSETPNLERLNILNCTNLAYIPSCIHNFNNLRSVIGLCLRNTA 122
             + L +   L   PD      +L+ +  ++   L  +P  +  F  L +   L L    
Sbjct: 84  VALELRSVP-LPQFPDQAFRLSHLQHMT-IDAAGLMELPDTMQQFAGLET---LTLARNP 138

Query: 123 IEEVPSSIESLTKLEKLDLSYCTRLKGLCKLDLGYCSKFECFPEIIEKMERLRSVDLQST 182
           +  +P+SI SL +L +L +  C  L  L +  L             + +  L+S+ L+ T
Sbjct: 139 LRALPASIASLNRLRELSIRACPELTELPE-PLASTD----ASGEHQGLVNLQSLRLEWT 193

Query: 183 EVEELPSSMENLEGLKDL----------PDSLPNLKSLQFLNVERL-------FSIADLD 225
            +  LP+S+ NL+ LK L            ++ +L  L+ L++                 
Sbjct: 194 GIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRA 253

Query: 226 KLEDLSISGRRGLI-LPPLLSGLSSLTKLVLTCCDVIE-IPQDIGCLSSLELLFLCGN 281
            L+ L +     L+ LP  +  L+ L KL L  C  +  +P  I  L +  ++ +  +
Sbjct: 254 PLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANCIILVPPH 311
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query479
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.95
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.95
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.93
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.89
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.88
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.87
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.87
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.87
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.86
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.86
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.86
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.85
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.84
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.84
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.84
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.79
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.78
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.78
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.77
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.77
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.77
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.76
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.76
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.76
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.76
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.75
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.75
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.73
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.72
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.71
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.71
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.7
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.68
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.68
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.68
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.66
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.66
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.66
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.66
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.65
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.65
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.64
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.64
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.63
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.62
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.62
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.62
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.61
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.61
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.57
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.53
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.53
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.52
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.52
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.52
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.51
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.51
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.5
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.49
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.46
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.46
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.46
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.44
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.42
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.42
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.38
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.35
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.34
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.3
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.3
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.28
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.28
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.27
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.27
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.25
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.23
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.16
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.11
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.02
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.0
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.97
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.94
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.89
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.89
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.88
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.83
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.8
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.78
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.67
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.64
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.56
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.55
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.44
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.34
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.24
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.18
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.12
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.98
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.97
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.6
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.55
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.49
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.45
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.16
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.85
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.56
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 90.74
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
Probab=99.96  E-value=6.1e-30  Score=274.93  Aligned_cols=275  Identities=15%  Similarity=0.154  Sum_probs=217.6

Q ss_pred             CCCCCC-CCCCceEEECCCCCCcc------------------cccccC--CCCCCcEEEccCCCCCCCCC-CCCCCCCCc
Q 047943           30 TLPSNF-EPENLLELNLPYSKIET------------------IWEVKK--EAPKLKYINLHNSQYLTGMP-DLSETPNLE   87 (479)
Q Consensus        30 ~lp~~~-~~~~L~~L~L~~s~i~~------------------l~~~~~--~l~~L~~L~Ls~~~~l~~~p-~l~~l~~L~   87 (479)
                      .+|..+ ++++|++|+|++|.++.                  +|..++  ++++|+.|++++|.....+| .++++++|+
T Consensus       197 ~ip~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~~~~~ip~~l~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~  276 (636)
T 4eco_A          197 FVSKAVMRLTKLRQFYMGNSPFVAENICEAWENENSEYAQQYKTEDLKWDNLKDLTDVEVYNCPNLTKLPTFLKALPEMQ  276 (636)
T ss_dssp             EECGGGGGCTTCCEEEEESCCCCGGGBSSSCSCTTSHHHHHHTTSCCCGGGCTTCCEEEEECCTTCSSCCTTTTTCSSCC
T ss_pred             cCCHHHhcccCCCEEECcCCccccccccccccccccchhcccCchhhhhcccCCCCEEEecCCcCCccChHHHhcCCCCC
Confidence            367766 88999999999999998                  899988  99999999999998888888 589999999


Q ss_pred             EEeecCCC-CCC-CCCcccccc---CCccccceeeccCCCceecCc--cccCCCCCCEEeccCCC---------CCCCCC
Q 047943           88 RLNILNCT-NLA-YIPSCIHNF---NNLRSVIGLCLRNTAIEEVPS--SIESLTKLEKLDLSYCT---------RLKGLC  151 (479)
Q Consensus        88 ~L~L~~c~-~l~-~~p~~l~~l---~~L~~L~~L~L~~~~i~~lp~--~i~~l~~L~~L~L~~c~---------~L~~L~  151 (479)
                      +|++++|. ..+ .+|..++++   ..+++|++|++++|.+..+|.  .++.+++|+.|++++|.         ++++|+
T Consensus       277 ~L~Ls~n~~l~~~~lp~~~~~L~~~~~l~~L~~L~L~~n~l~~ip~~~~l~~l~~L~~L~L~~N~l~g~ip~~~~l~~L~  356 (636)
T 4eco_A          277 LINVACNRGISGEQLKDDWQALADAPVGEKIQIIYIGYNNLKTFPVETSLQKMKKLGMLECLYNQLEGKLPAFGSEIKLA  356 (636)
T ss_dssp             EEECTTCTTSCHHHHHHHHHHHHHSGGGGTCCEEECCSSCCSSCCCHHHHTTCTTCCEEECCSCCCEEECCCCEEEEEES
T ss_pred             EEECcCCCCCccccchHHHHhhhccccCCCCCEEECCCCcCCccCchhhhccCCCCCEEeCcCCcCccchhhhCCCCCCC
Confidence            99999987 434 588877765   455677889999999999998  89999999999998864         335678


Q ss_pred             EEecCCCCCCCccchhhhcccc-CCeeeccCccccccCccccccc--CCCC-----------CCCCCC-------CCCCC
Q 047943          152 KLDLGYCSKFECFPEIIEKMER-LRSVDLQSTEVEELPSSMENLE--GLKD-----------LPDSLP-------NLKSL  210 (479)
Q Consensus       152 ~L~L~~c~~l~~~p~~~~~l~~-L~~L~L~~~~i~~lp~~i~~l~--~L~~-----------lp~~l~-------~l~~L  210 (479)
                      +|++++|... .+|..+.++++ |++|++++|.+.++|..+..+.  +|+.           +|..+.       .+.+|
T Consensus       357 ~L~L~~N~l~-~lp~~l~~l~~~L~~L~Ls~N~l~~lp~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~~~~~~~~~~~L  435 (636)
T 4eco_A          357 SLNLAYNQIT-EIPANFCGFTEQVENLSFAHNKLKYIPNIFDAKSVSVMSAIDFSYNEIGSVDGKNFDPLDPTPFKGINV  435 (636)
T ss_dssp             EEECCSSEEE-ECCTTSEEECTTCCEEECCSSCCSSCCSCCCTTCSSCEEEEECCSSCTTTTTTCSSCTTCSSCCCCCCE
T ss_pred             EEECCCCccc-cccHhhhhhcccCcEEEccCCcCcccchhhhhcccCccCEEECcCCcCCCcchhhhcccccccccCCCC
Confidence            9999987654 88888889998 9999999999998888765543  3333           455566       66788


Q ss_pred             CeeecCC--Ccc-----ccccCCCceeecCCCCCCCCCcccCCC--------CCCCEEEcCCCCCccCCccCC--CCCCC
Q 047943          211 QFLNVER--LFS-----IADLDKLEDLSISGRRGLILPPLLSGL--------SSLTKLVLTCCDVIEIPQDIG--CLSSL  273 (479)
Q Consensus       211 ~~L~l~~--l~~-----l~~l~~L~~L~l~~~~~~~lp~~~~~l--------~~L~~L~L~~~~l~~lp~~l~--~l~~L  273 (479)
                      ++|++++  +..     +..+++|++|++++|....+|......        ++|+.|++++|.+.++|..+.  .+++|
T Consensus       436 ~~L~Ls~N~l~~lp~~~~~~l~~L~~L~Ls~N~l~~i~~~~~~~~~~~~~~l~~L~~L~Ls~N~l~~lp~~~~~~~l~~L  515 (636)
T 4eco_A          436 SSINLSNNQISKFPKELFSTGSPLSSINLMGNMLTEIPKNSLKDENENFKNTYLLTSIDLRFNKLTKLSDDFRATTLPYL  515 (636)
T ss_dssp             EEEECCSSCCCSCCTHHHHTTCCCSEEECCSSCCSBCCSSSSEETTEECTTGGGCCEEECCSSCCCBCCGGGSTTTCTTC
T ss_pred             CEEECcCCccCcCCHHHHccCCCCCEEECCCCCCCCcCHHHhccccccccccCCccEEECcCCcCCccChhhhhccCCCc
Confidence            8888877  222     234778888888888866776643322        278888888888888888776  88888


Q ss_pred             CEEeCCCCcCCccChhhhcCCCchhHHHHHhhhhh
Q 047943          274 ELLFLCGNNFSKFTCKYQSTFTAEKTLLELLQYAT  308 (479)
Q Consensus       274 ~~L~Ls~n~l~~lp~~~i~~l~~L~~L~~~L~~n~  308 (479)
                      +.|+|++|.++.+| ..+..+++|+.|  ++++|+
T Consensus       516 ~~L~Ls~N~l~~ip-~~~~~l~~L~~L--~Ls~N~  547 (636)
T 4eco_A          516 VGIDLSYNSFSKFP-TQPLNSSTLKGF--GIRNQR  547 (636)
T ss_dssp             CEEECCSSCCSSCC-CGGGGCSSCCEE--ECCSCB
T ss_pred             CEEECCCCCCCCcC-hhhhcCCCCCEE--ECCCCc
Confidence            88888888888888 778888888888  665544
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 479
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 45.0 bits (105), Expect = 1e-05
 Identities = 40/189 (21%), Positives = 70/189 (37%), Gaps = 14/189 (7%)

Query: 69  HNSQYLTGMPDLSETPNLERLNILNCTNLAYIPSCIHNFNNLRSVIGLCLRNTAIEEVPS 128
             +  ++ +  L    NL+ L++            I    +L ++  L L N  I  +  
Sbjct: 204 ATNNQISDITPLGILTNLDELSLNGNQ-----LKDIGTLASLTNLTDLDLANNQISNLAP 258

Query: 129 SIESLTKLEKLDLSYCTRLKGLCKLDLGYCSKFECFPEIIEKMERLRSVDLQSTEVEELP 188
            +  LTKL +L L        +  +            E+ E      S       +  L 
Sbjct: 259 -LSGLTKLTELKLGAN----QISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLT 313

Query: 189 SSMENLEGLKDLPDSLPNLKSLQFLN--VERLFSIADLDKLEDLSISGRRGLILPPLLSG 246
               N+  +  +  SL  L+ L F N  V  + S+A+L  +  LS    +   L P L+ 
Sbjct: 314 LYFNNISDISPV-SSLTKLQRLFFANNKVSDVSSLANLTNINWLSAGHNQISDLTP-LAN 371

Query: 247 LSSLTKLVL 255
           L+ +T+L L
Sbjct: 372 LTRITQLGL 380
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query479
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.89
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.86
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.85
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.81
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.79
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.76
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.72
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.71
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.41
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.39
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.38
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.29
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.28
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.27
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.24
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.2
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.15
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.1
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.07
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.05
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.96
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.85
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.85
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.73
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.65
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.68
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.58
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.65
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.64
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.77
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.86
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.89  E-value=3e-22  Score=198.55  Aligned_cols=267  Identities=21%  Similarity=0.265  Sum_probs=159.3

Q ss_pred             CceEEEecCCCCCCCCCCCCCCCceEEECCCCCCcccccccCCCCCCcEEEccCCCCCCCCCCCCCCCCCcEEeecCCCC
Q 047943           17 ELRYLHWYEYPLKTLPSNFEPENLLELNLPYSKIETIWEVKKEAPKLKYINLHNSQYLTGMPDLSETPNLERLNILNCTN   96 (479)
Q Consensus        17 ~Lr~L~~~~~~l~~lp~~~~~~~L~~L~L~~s~i~~l~~~~~~l~~L~~L~Ls~~~~l~~~p~l~~l~~L~~L~L~~c~~   96 (479)
                      +|+.|+++++.++++...-.+++|++|++++|+++.++. ++.+++|+.|++++|. +..++.++++++|+.|++.++..
T Consensus        45 ~l~~L~l~~~~I~~l~gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n~-i~~i~~l~~l~~L~~L~~~~~~~  122 (384)
T d2omza2          45 QVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNNQ-IADITPLANLTNLTGLTLFNNQI  122 (384)
T ss_dssp             TCCEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSSC-CCCCGGGTTCTTCCEEECCSSCC
T ss_pred             CCCEEECCCCCCCCccccccCCCCCEEeCcCCcCCCCcc-ccCCcccccccccccc-ccccccccccccccccccccccc
Confidence            799999999999998643389999999999999999874 8999999999999986 45667789999999999987654


Q ss_pred             CCCCCccccccCCc----------------------------------------cccceeeccCCCceecCccccCCCCC
Q 047943           97 LAYIPSCIHNFNNL----------------------------------------RSVIGLCLRNTAIEEVPSSIESLTKL  136 (479)
Q Consensus        97 l~~~p~~l~~l~~L----------------------------------------~~L~~L~L~~~~i~~lp~~i~~l~~L  136 (479)
                      ... +.... ....                                        ..........+. .........++++
T Consensus       123 ~~~-~~~~~-~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~  199 (384)
T d2omza2         123 TDI-DPLKN-LTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNK-VSDISVLAKLTNL  199 (384)
T ss_dssp             CCC-GGGTT-CTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSC-CCCCGGGGGCTTC
T ss_pred             ccc-ccccc-cccccccccccccccccccccccccccccccccccchhhhhccccccccccccccc-ccccccccccccc
Confidence            321 11100 0000                                        000001111111 1122345566677


Q ss_pred             CEEeccCCC--------CCCCCCEEecCCCCCCCccchhhhccccCCeeeccCccccccCcccccccCCCCCCCCCCCCC
Q 047943          137 EKLDLSYCT--------RLKGLCKLDLGYCSKFECFPEIIEKMERLRSVDLQSTEVEELPSSMENLEGLKDLPDSLPNLK  208 (479)
Q Consensus       137 ~~L~L~~c~--------~L~~L~~L~L~~c~~l~~~p~~~~~l~~L~~L~L~~~~i~~lp~~i~~l~~L~~lp~~l~~l~  208 (479)
                      +.++++++.        ..++|++|++++|.. ..++ .+..+++|+.|++++|.+.+++. ++             .++
T Consensus       200 ~~l~l~~n~i~~~~~~~~~~~L~~L~l~~n~l-~~~~-~l~~l~~L~~L~l~~n~l~~~~~-~~-------------~~~  263 (384)
T d2omza2         200 ESLIATNNQISDITPLGILTNLDELSLNGNQL-KDIG-TLASLTNLTDLDLANNQISNLAP-LS-------------GLT  263 (384)
T ss_dssp             SEEECCSSCCCCCGGGGGCTTCCEEECCSSCC-CCCG-GGGGCTTCSEEECCSSCCCCCGG-GT-------------TCT
T ss_pred             ceeeccCCccCCCCcccccCCCCEEECCCCCC-CCcc-hhhcccccchhccccCccCCCCc-cc-------------ccc
Confidence            777776542        345677777777643 3333 46677788888888877776543 22             334


Q ss_pred             CCCeeecCC-----CccccccCCCceeecCCCCCCCCCcccCCCCCCCEEEcCCCCCccCCccCCCCCCCCEEeCCCCcC
Q 047943          209 SLQFLNVER-----LFSIADLDKLEDLSISGRRGLILPPLLSGLSSLTKLVLTCCDVIEIPQDIGCLSSLELLFLCGNNF  283 (479)
Q Consensus       209 ~L~~L~l~~-----l~~l~~l~~L~~L~l~~~~~~~lp~~~~~l~~L~~L~L~~~~l~~lp~~l~~l~~L~~L~Ls~n~l  283 (479)
                      +|++|++++     +..+..++.++.+.+.+|....++. +..+++++.|++++|++.+++. +..+++|++|++++|++
T Consensus       264 ~L~~L~l~~~~l~~~~~~~~~~~l~~l~~~~n~l~~~~~-~~~~~~l~~L~ls~n~l~~l~~-l~~l~~L~~L~L~~n~l  341 (384)
T d2omza2         264 KLTELKLGANQISNISPLAGLTALTNLELNENQLEDISP-ISNLKNLTYLTLYFNNISDISP-VSSLTKLQRLFFANNKV  341 (384)
T ss_dssp             TCSEEECCSSCCCCCGGGTTCTTCSEEECCSSCCSCCGG-GGGCTTCSEEECCSSCCSCCGG-GGGCTTCCEEECCSSCC
T ss_pred             cCCEeeccCcccCCCCccccccccccccccccccccccc-cchhcccCeEECCCCCCCCCcc-cccCCCCCEEECCCCCC
Confidence            444554443     2334444555555555554433332 4445555555555555555432 44555555555555555


Q ss_pred             CccChhhhcCCCchhHHHHHhhhhhhh
Q 047943          284 SKFTCKYQSTFTAEKTLLELLQYATVI  310 (479)
Q Consensus       284 ~~lp~~~i~~l~~L~~L~~~L~~n~~~  310 (479)
                      +.++  .++.+++|++|  ++++|++.
T Consensus       342 ~~l~--~l~~l~~L~~L--~l~~N~l~  364 (384)
T d2omza2         342 SDVS--SLANLTNINWL--SAGHNQIS  364 (384)
T ss_dssp             CCCG--GGGGCTTCCEE--ECCSSCCC
T ss_pred             CCCh--hHcCCCCCCEE--ECCCCcCC
Confidence            5554  35555555555  55555543
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure