Citrus Sinensis ID: 047948


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
FSLDVSSNSIEEGHALVKWKASLKVHSRSLLHSWFLSSVNVTKISPCAWSGIHCNHAGRVVGINLTSMSLNGTLLEFPFSSFPHLAYLVLYNNELFYIILPQITNKLSGQIPSEIGLLTHLTVLHISRNQLNGSIPQEVGQLTFLNHLILDLIFLIFWMVQSLVLLAIWPT
cccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEcccccEEEEEEcccccEEEEccccccccccccEEEccccccccccccccccccEEcccHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccc
cccEEcccccHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEcccccEEEEEcccccccccccHHHHcccccccEEEEccccccccccHHHcccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccccccccccccc
fsldvssnsieEGHALVKWKASLKVHSRSLLHSWFLSSvnvtkispcawsgihcnhagrvVGINLTsmslngtllefpfssfphlaYLVLYNNELFYIILPQItnklsgqipseiglLTHLTVLHISrnqlngsipqevgQLTFLNHLILDLIFLIFWMVQSLVLLAIWPT
fsldvssnsieEGHALVKWKASLKVHSRSLLHSWFLSSVNVTKISPCAWSGIHCNHAGRVVGINLTSMSLNGTLLEFPFSSFPHLAYLVLYNNELFYIILPQITNKLSGQIPSEIGLLTHLTVLHISRNQLNGSIPQEVGQLTFLNHLILDLIFLIFWMVQSLVLLAIWPT
FSLDVSSNSIEEGHALVKWKASLKVHSRSLLHSWFLSSVNVTKISPCAWSGIHCNHAGRVVGINLTSMSLNGTLLEFPFSSFPHLAYLVLYNNELFYIILPQITNKLSGQIPSEIGLLTHLTVLHISRNQLNGSIPQEVGQLTFLNHLILDLIFLIFWMVQSLVLLAIWPT
*************HALVKWKASLKVHSRSLLHSWFLSSVNVTKISPCAWSGIHCNHAGRVVGINLTSMSLNGTLLEFPFSSFPHLAYLVLYNNELFYIILPQITNKLSGQIPSEIGLLTHLTVLHISRNQLNGSIPQEVGQLTFLNHLILDLIFLIFWMVQSLVLLAIW**
FSLD***NSIEEGHALVKWKASLKVHSRSLLHSWFLSSVNVTKISPCAWSGIHCNHAGRVVGINLTSMSLNGTLLEFPFSSFPHLAYLVLYNNELFYIILPQITNKLSGQIPSEIGLLTHLTVLHISRNQLNGSIPQEVGQLTFLNHLILDLIFLIFWMVQSLVLLAIW**
FSLDVSSNSIEEGHALVKWKASLKVHSRSLLHSWFLSSVNVTKISPCAWSGIHCNHAGRVVGINLTSMSLNGTLLEFPFSSFPHLAYLVLYNNELFYIILPQITNKLSGQIPSEIGLLTHLTVLHISRNQLNGSIPQEVGQLTFLNHLILDLIFLIFWMVQSLVLLAIWPT
FSLDVSSNSIEEGHALVKWKASLKVHSRSLLHSWFLSSVNVTKISPCAWSGIHCNHAGRVVGINLTSMSLNGTLLEFPFSSFPHLAYLVLYNNELFYIILPQITNKLSGQIPSEIGLLTHLTVLHISRNQLNGSIPQEVGQLTFLNHLILDLIFLIFWMVQSL********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHii
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FSLDVSSNSIEEGHALVKWKASLKVHSRSLLHSWFLSSVNVTKISPCAWSGIHCNHAGRVVGINLTSMSLNGTLLEFPFSSFPHLAYLVLYNNELFYIILPQITNKLSGQIPSEIGLLTHLTVLHISRNQLNGSIPQEVGQLTFLNHLILDLIFLIFWMVQSLVLLAIWPT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query171 2.2.26 [Sep-21-2011]
Q8VZG8 1045 Probable LRR receptor-lik yes no 0.812 0.133 0.373 3e-19
Q9LP24 1120 Probable leucine-rich rep no no 0.818 0.125 0.357 3e-17
Q94F62 615 BRASSINOSTEROID INSENSITI no no 0.812 0.226 0.333 3e-12
C0LGR3 1091 Probable LRR receptor-lik no no 0.777 0.121 0.314 4e-12
Q9LVP0 1102 Probable leucine-rich rep no no 0.695 0.107 0.342 3e-11
Q8LPS5 601 Somatic embryogenesis rec no no 0.760 0.216 0.320 3e-11
C0LGF4 591 LRR receptor-like serine/ no no 0.859 0.248 0.311 4e-11
C0LGQ5 1249 LRR receptor-like serine/ no no 0.643 0.088 0.336 6e-11
Q9SKG5 620 Somatic embryogenesis rec no no 0.713 0.196 0.309 9e-11
Q9C9N5 685 Probable inactive leucine no no 0.695 0.173 0.343 1e-10
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function desciption
 Score = 94.4 bits (233), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 89/158 (56%), Gaps = 19/158 (12%)

Query: 7   SNSIEEGHALVKWKASLKVH-SRSLLHSWFLSSVNVTKISPC-AWSGIHCNHAGRVVGIN 64
           S ++EE +AL+KWK++     S S L SW    VN    S C +W G+ C+  G ++ +N
Sbjct: 45  SATVEEANALLKWKSTFTNQTSSSKLSSW----VNPNTSSFCTSWYGVACS-LGSIIRLN 99

Query: 65  LTSMSLNGTLLEFPFSSFPHLAYLVLYNNELFYIILPQ------------ITNKLSGQIP 112
           LT+  + GT  +FPFSS P+L ++ L  N     I P               N+L G+IP
Sbjct: 100 LTNTGIEGTFEDFPFSSLPNLTFVDLSMNRFSGTISPLWGRFSKLEYFDLSINQLVGEIP 159

Query: 113 SEIGLLTHLTVLHISRNQLNGSIPQEVGQLTFLNHLIL 150
            E+G L++L  LH+  N+LNGSIP E+G+LT +  + +
Sbjct: 160 PELGDLSNLDTLHLVENKLNGSIPSEIGRLTKVTEIAI 197





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 OS=Arabidopsis thaliana GN=BAK1 PE=1 SV=2 Back     alignment and function description
>sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q8LPS5|SERK5_ARATH Somatic embryogenesis receptor kinase 5 OS=Arabidopsis thaliana GN=SERK5 PE=1 SV=2 Back     alignment and function description
>sp|C0LGF4|FEI1_ARATH LRR receptor-like serine/threonine-protein kinase FEI 1 OS=Arabidopsis thaliana GN=FEI1 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SKG5|SERK4_ARATH Somatic embryogenesis receptor kinase 4 OS=Arabidopsis thaliana GN=SERK4 PE=1 SV=2 Back     alignment and function description
>sp|Q9C9N5|Y1668_ARATH Probable inactive leucine-rich repeat receptor-like protein kinase At1g66830 OS=Arabidopsis thaliana GN=At1g66830 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
225456159 1038 PREDICTED: probable LRR receptor-like se 0.853 0.140 0.536 3e-34
225456161 1037 PREDICTED: probable LRR receptor-like se 0.853 0.140 0.524 2e-32
359491509 1032 PREDICTED: probable LRR receptor-like se 0.847 0.140 0.5 2e-27
359491512 1078 PREDICTED: probable LRR receptor-like se 0.859 0.136 0.470 2e-27
147767326 1032 hypothetical protein VITISV_008862 [Viti 0.847 0.140 0.5 2e-27
224136674 945 predicted protein [Populus trichocarpa] 0.801 0.144 0.424 1e-22
224108397 968 predicted protein [Populus trichocarpa] 0.812 0.143 0.446 5e-22
60327226 487 Hcr2-p7.7 [Solanum pimpinellifolium] 0.824 0.289 0.440 5e-22
223452528 1052 leucine-rich repeat family protein / pro 0.847 0.137 0.414 6e-22
356568066 1074 PREDICTED: probable LRR receptor-like se 0.801 0.127 0.429 7e-22
>gi|225456159|ref|XP_002278561.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 89/166 (53%), Positives = 103/166 (62%), Gaps = 20/166 (12%)

Query: 5   VSSNSIEEGHALVKWKASLKVHSRSLLHSWFLSSVNVTK--------ISPCAWSGIHCNH 56
           VSS S EE  AL+KWKASL+ H+ S L SW L   N T          SPC W GI CNH
Sbjct: 27  VSSYSNEETQALLKWKASLQNHNHSSLLSWDLYPNNSTNSSTHLGTATSPCKWYGISCNH 86

Query: 57  AGRVVGINLTSMSLNGTLLEFPFSSFPHLAYLVLYNNELFYIILPQIT------------ 104
           AG V+ INLT   LNGTL++F FSSFP+LAY+ +  N L   I PQI             
Sbjct: 87  AGSVIKINLTESGLNGTLMDFSFSSFPNLAYVDISMNNLSGPIPPQIGLLFELKYLDLSI 146

Query: 105 NKLSGQIPSEIGLLTHLTVLHISRNQLNGSIPQEVGQLTFLNHLIL 150
           N+ SG IPSEIGLLT+L VLH+ +NQLNGSIP E+GQL  L  L L
Sbjct: 147 NQFSGGIPSEIGLLTNLEVLHLVQNQLNGSIPHEIGQLASLYELAL 192




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225456161|ref|XP_002278590.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491509|ref|XP_002278522.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491512|ref|XP_002278614.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147767326|emb|CAN68996.1| hypothetical protein VITISV_008862 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224136674|ref|XP_002322387.1| predicted protein [Populus trichocarpa] gi|222869383|gb|EEF06514.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224108397|ref|XP_002333400.1| predicted protein [Populus trichocarpa] gi|222836440|gb|EEE74847.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|60327226|gb|AAX19036.1| Hcr2-p7.7 [Solanum pimpinellifolium] Back     alignment and taxonomy information
>gi|223452528|gb|ACM89591.1| leucine-rich repeat family protein / protein kinase family protein [Glycine max] Back     alignment and taxonomy information
>gi|356568066|ref|XP_003552234.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 0.812 0.133 0.373 9.6e-19
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.836 0.127 0.356 4.2e-17
TAIR|locus:2171973 614 AT5G45780 [Arabidopsis thalian 0.766 0.213 0.348 2.5e-15
TAIR|locus:2131518 1091 AT4G26540 [Arabidopsis thalian 0.807 0.126 0.358 2.2e-13
TAIR|locus:2170668 604 AT5G62710 [Arabidopsis thalian 0.795 0.225 0.352 1.4e-12
TAIR|locus:2040471 601 SERK5 "somatic embryogenesis r 0.754 0.214 0.328 2.3e-12
TAIR|locus:2161825 1090 AT5G56040 [Arabidopsis thalian 0.783 0.122 0.355 1.8e-11
TAIR|locus:2206179 592 FEI1 "FEI 1" [Arabidopsis thal 0.865 0.25 0.319 2.7e-11
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.643 0.088 0.352 2.8e-11
TAIR|locus:2040461 620 SERK4 "somatic embryogenesis r 0.824 0.227 0.319 3.7e-11
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 238 (88.8 bits), Expect = 9.6e-19, P = 9.6e-19
 Identities = 59/158 (37%), Positives = 91/158 (57%)

Query:     7 SNSIEEGHALVKWKASLKVH-SRSLLHSWFLSSVNVTKISPC-AWSGIHCNHAGRVVGIN 64
             S ++EE +AL+KWK++     S S L SW    VN    S C +W G+ C+  G ++ +N
Sbjct:    45 SATVEEANALLKWKSTFTNQTSSSKLSSW----VNPNTSSFCTSWYGVACS-LGSIIRLN 99

Query:    65 LTSMSLNGTLLEFPFSSFPHLAYLVLYNNELFYIILP-----------QIT-NKLSGQIP 112
             LT+  + GT  +FPFSS P+L ++ L  N     I P            ++ N+L G+IP
Sbjct:   100 LTNTGIEGTFEDFPFSSLPNLTFVDLSMNRFSGTISPLWGRFSKLEYFDLSINQLVGEIP 159

Query:   113 SEIGLLTHLTVLHISRNQLNGSIPQEVGQLTFLNHLIL 150
              E+G L++L  LH+  N+LNGSIP E+G+LT +  + +
Sbjct:   160 PELGDLSNLDTLHLVENKLNGSIPSEIGRLTKVTEIAI 197


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0016020 "membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0006857 "oligopeptide transport" evidence=RCA
GO:0006995 "cellular response to nitrogen starvation" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0031347 "regulation of defense response" evidence=RCA
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171973 AT5G45780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131518 AT4G26540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170668 AT5G62710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040471 SERK5 "somatic embryogenesis receptor-like kinase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206179 FEI1 "FEI 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040461 SERK4 "somatic embryogenesis receptor-like kinase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 2e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.003
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.003
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
 Score = 56.7 bits (137), Expect = 6e-10
 Identities = 39/120 (32%), Positives = 53/120 (44%), Gaps = 23/120 (19%)

Query: 46  PCA-----WSGIHC---NHAGR--VVGINLTSMSLNGTLLEFPFSSFPHLAYLVLYNNEL 95
           PC      WSG  C   +  G+  + G+ L +  L G +     S   HL  + L  N  
Sbjct: 396 PCVPQQHPWSGADCQFDSTKGKWFIDGLGLDNQGLRGFIPN-DISKLRHLQSINLSGN-- 452

Query: 96  FYIILPQITNKLSGQIPSEIGLLTHLTVLHISRNQLNGSIPQEVGQLTFLNHLILDLIFL 155
                      + G IP  +G +T L VL +S N  NGSIP+ +GQLT L  L L+   L
Sbjct: 453 ----------SIRGNIPPSLGSITSLEVLDLSYNSFNGSIPESLGQLTSLRILNLNGNSL 502


Length = 623

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 171
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.85
PLN03150 623 hypothetical protein; Provisional 99.75
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.35
KOG0617 264 consensus Ras suppressor protein (contains leucine 99.12
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.03
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.92
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.92
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.9
PLN03150623 hypothetical protein; Provisional 98.9
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.9
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.86
KOG0617264 consensus Ras suppressor protein (contains leucine 98.82
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.77
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.74
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.68
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.67
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.66
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.63
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.62
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.4
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.39
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.39
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.39
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.27
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.18
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.17
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.13
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.12
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.05
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.04
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.02
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.01
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.98
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.84
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.79
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.72
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 97.68
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.58
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.57
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.46
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.45
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.35
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.3
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.22
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.07
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 96.91
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 96.82
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 96.75
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 96.74
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 96.67
KOG1644 233 consensus U2-associated snRNP A' protein [RNA proc 96.58
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.4
KOG0473 326 consensus Leucine-rich repeat protein [Function un 96.35
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.1
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 95.81
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.41
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.87
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.65
smart0037026 LRR Leucine-rich repeats, outliers. 94.65
PRK15386 426 type III secretion protein GogB; Provisional 94.63
PRK15386 426 type III secretion protein GogB; Provisional 94.19
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 93.62
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 92.67
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 91.73
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.09
KOG2982 418 consensus Uncharacterized conserved protein [Funct 90.17
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.17
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 89.72
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 88.57
KOG2123 388 consensus Uncharacterized conserved protein [Funct 86.65
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 86.64
KOG2120 419 consensus SCF ubiquitin ligase, Skp2 component [Po 84.96
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 83.32
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 82.62
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 80.56
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.85  E-value=3.5e-21  Score=170.73  Aligned_cols=140  Identities=34%  Similarity=0.563  Sum_probs=102.6

Q ss_pred             ChHHHHHHHHHHHhcccCCCCCCCCCCCccCCCCCCCCCcccceeeCCCCCEEEEEcCCCccceecCCCCCCCCCCCcEE
Q 047948            9 SIEEGHALVKWKASLKVHSRSLLHSWFLSSVNVTKISPCAWSGIHCNHAGRVVGINLTSMSLNGTLLEFPFSSFPHLAYL   88 (171)
Q Consensus         9 ~~~~~~~l~~~~~~l~~~~~~~~~~W~~~~~~~~~~~~c~w~gv~c~~~~~v~~L~l~~~~l~~~~p~~~l~~L~~L~~L   88 (171)
                      .+.|..||++||+.+.+ +...+.+|+      ...++|.|.||+|+..++|+.|+++++.+++.++. .+..++.|+.|
T Consensus        27 ~~~~~~~l~~~~~~~~~-~~~~~~~w~------~~~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~~~-~~~~l~~L~~L   98 (968)
T PLN00113         27 HAEELELLLSFKSSIND-PLKYLSNWN------SSADVCLWQGITCNNSSRVVSIDLSGKNISGKISS-AIFRLPYIQTI   98 (968)
T ss_pred             CHHHHHHHHHHHHhCCC-CcccCCCCC------CCCCCCcCcceecCCCCcEEEEEecCCCccccCCh-HHhCCCCCCEE
Confidence            55799999999999965 666678997      56789999999999777999999999988887777 77778888888


Q ss_pred             EeecCcccccccccc-----------------------------------cccccccCCccccCCcCCCEEecccCcccc
Q 047948           89 VLYNNELFYIILPQI-----------------------------------TNKLSGQIPSEIGLLTHLTVLHISRNQLNG  133 (171)
Q Consensus        89 ~l~~n~l~g~~p~~~-----------------------------------~n~l~g~~p~~~~~l~~L~~L~ls~N~l~g  133 (171)
                      ++++|.+.|.+|..+                                   .|.+.+.+|..++.+++|++|++++|.+.+
T Consensus        99 ~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~  178 (968)
T PLN00113         99 NLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVG  178 (968)
T ss_pred             ECCCCccCCcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccc
Confidence            888877777666532                                   344444555555666666666666666666


Q ss_pred             cCChhhhCccccCceeccccccc
Q 047948          134 SIPQEVGQLTFLNHLILDLIFLI  156 (171)
Q Consensus       134 ~~P~~~~~l~~L~~L~Ls~N~l~  156 (171)
                      .+|..++++++|++|++++|.+.
T Consensus       179 ~~p~~~~~l~~L~~L~L~~n~l~  201 (968)
T PLN00113        179 KIPNSLTNLTSLEFLTLASNQLV  201 (968)
T ss_pred             cCChhhhhCcCCCeeeccCCCCc
Confidence            66666666666666666666554



>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-06
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-06
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 48.9 bits (115), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 2/62 (3%) Query: 91 YNNELFYIILPQITNKLSGQIPSEIGLLTHLTVLHISRNQLNGSIPQEVGQLTFLNHLIL 150 ++N + L N LSG IP EIG + +L +L++ N ++GSIP EVG L LN IL Sbjct: 628 FDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLN--IL 685 Query: 151 DL 152 DL Sbjct: 686 DL 687
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-24
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-06
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-04
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-05
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 7e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score = 93.8 bits (234), Expect = 8e-24
 Identities = 37/158 (23%), Positives = 64/158 (40%), Gaps = 23/158 (14%)

Query: 11  EEGHALVKWKASLKVHSRSLLHSWFLSSVNVTKISPCAWSGIHCN---HAGRVVGINLTS 67
           ++  AL++ K  L   + + L SW  +    T      W G+ C+      RV  ++L+ 
Sbjct: 6   QDKQALLQIKKDL--GNPTTLSSWLPT----TDCCNRTWLGVLCDTDTQTYRVNNLDLSG 59

Query: 68  MSLNGTLLEFP-FSSFPHLAYLVLYN-NELFYIILPQIT------------NKLSGQIPS 113
           ++L          ++ P+L +L +   N L   I P I               +SG IP 
Sbjct: 60  LNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPD 119

Query: 114 EIGLLTHLTVLHISRNQLNGSIPQEVGQLTFLNHLILD 151
            +  +  L  L  S N L+G++P  +  L  L  +  D
Sbjct: 120 FLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFD 157


>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.9
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.9
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.87
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.66
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.65
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.64
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.6
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 99.6
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.6
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.53
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.53
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.52
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.52
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.51
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.51
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.49
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.49
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.48
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.47
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.47
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.46
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.46
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.46
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.45
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.45
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.44
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.43
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.42
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.42
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.42
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.42
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.42
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.42
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.41
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.41
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.41
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.41
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.4
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.39
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.38
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.38
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.38
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.37
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.37
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.37
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.37
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.36
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.36
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.36
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.35
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.35
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.34
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.34
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.34
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.33
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.32
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.32
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.32
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.32
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.32
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.32
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.31
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.31
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.31
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.31
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.31
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.31
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.3
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.29
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.29
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.29
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.28
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.27
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.27
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.27
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.25
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.24
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.22
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.22
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.21
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.21
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.21
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.2
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.2
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.18
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.17
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.16
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.15
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.06
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 99.05
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 99.05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.04
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.03
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 99.03
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.02
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.02
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.95
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.93
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.93
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.93
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 98.92
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.91
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.9
1o6v_A 466 Internalin A; bacterial infection, extracellular r 98.87
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.87
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.86
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.82
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.82
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.81
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.81
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.76
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.74
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.6
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.59
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.55
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.35
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.33
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.24
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.21
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.0
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.74
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.73
3sb4_A 329 Hypothetical leucine rich repeat protein; LRR, rig 97.61
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.59
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 97.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.43
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.14
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.96
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.82
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 96.81
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.6
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.35
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.62
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.33
4gt6_A394 Cell surface protein; leucine rich repeats, putati 94.58
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.83
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 93.6
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 91.21
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 91.15
4gt6_A394 Cell surface protein; leucine rich repeats, putati 90.54
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 89.35
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=99.93  E-value=2e-25  Score=174.06  Aligned_cols=154  Identities=25%  Similarity=0.414  Sum_probs=132.1

Q ss_pred             CCChHHHHHHHHHHHhcccCCCCCCCCCCCccCCCCCCCCCc--ccceeeCCC---CCEEEEEcCCCccce--ecCCCCC
Q 047948            7 SNSIEEGHALVKWKASLKVHSRSLLHSWFLSSVNVTKISPCA--WSGIHCNHA---GRVVGINLTSMSLNG--TLLEFPF   79 (171)
Q Consensus         7 ~~~~~~~~~l~~~~~~l~~~~~~~~~~W~~~~~~~~~~~~c~--w~gv~c~~~---~~v~~L~l~~~~l~~--~~p~~~l   79 (171)
                      .|.+.|++||++||+.+.+ +. .+.+|.      .+.+||.  |.||+|+..   ++|+.|+++++.+.+  .+|. .+
T Consensus         2 ~c~~~~~~aL~~~k~~~~~-~~-~l~~W~------~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~~~-~l   72 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGN-PT-TLSSWL------PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPS-SL   72 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTC-CG-GGTTCC------TTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCG-GG
T ss_pred             CCCHHHHHHHHHHHHhcCC-cc-cccCCC------CCCCCCcCCCcceEeCCCCCCceEEEEECCCCCccCCcccCh-hH
Confidence            5788999999999999965 44 688997      5678998  999999864   799999999999998  8898 99


Q ss_pred             CCCCCCcEEEeec-Ccccccccccc------------cccccccCCccccCCcCCCEEecccCcccccCChhhhCccccC
Q 047948           80 SSFPHLAYLVLYN-NELFYIILPQI------------TNKLSGQIPSEIGLLTHLTVLHISRNQLNGSIPQEVGQLTFLN  146 (171)
Q Consensus        80 ~~L~~L~~L~l~~-n~l~g~~p~~~------------~n~l~g~~p~~~~~l~~L~~L~ls~N~l~g~~P~~~~~l~~L~  146 (171)
                      ..++.|++|++++ |.+.+.+|..+            .|++++.+|..+..+++|++|++++|.+++.+|..+..+++|+
T Consensus        73 ~~l~~L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~  152 (313)
T 1ogq_A           73 ANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLV  152 (313)
T ss_dssp             GGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCC
T ss_pred             hCCCCCCeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCC
Confidence            9999999999995 99999998876            6888888898899999999999999999988999999999999


Q ss_pred             ceeccccccccccch-------hhhccccc
Q 047948          147 HLILDLIFLIFWMVQ-------SLVLLAIW  169 (171)
Q Consensus       147 ~L~Ls~N~l~~~~~~-------~L~~L~l~  169 (171)
                      +|++++|++++.++.       .|++|++.
T Consensus       153 ~L~L~~N~l~~~~p~~l~~l~~~L~~L~L~  182 (313)
T 1ogq_A          153 GITFDGNRISGAIPDSYGSFSKLFTSMTIS  182 (313)
T ss_dssp             EEECCSSCCEEECCGGGGCCCTTCCEEECC
T ss_pred             eEECcCCcccCcCCHHHhhhhhcCcEEECc
Confidence            999999988743332       56666653



>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 171
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-07
d1ogqa_ 313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-05
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 47.1 bits (110), Expect = 2e-07
 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 105 NKLSGQIPSEIGLLTHLTVLHISRNQLNGSIPQEVGQLTFLNHLILD 151
           N++ G +P  +  L  L  L++S N L G IP + G L   +     
Sbjct: 254 NRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQRFDVSAYA 299


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.57
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.41
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.41
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.34
d1ozna_ 284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.28
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.27
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.27
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.26
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.26
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.25
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.18
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.07
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.06
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.06
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.02
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.02
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.95
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 98.93
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.85
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.83
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.83
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.73
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.69
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.52
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.47
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.29
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.28
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.16
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 98.0
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.87
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.77
d2astb2 284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.7
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.61
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.56
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.42
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.4
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.38
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.99
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.26
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.92  E-value=2.7e-25  Score=170.98  Aligned_cols=145  Identities=26%  Similarity=0.452  Sum_probs=118.5

Q ss_pred             CChHHHHHHHHHHHhcccCCCCCCCCCCCccCCCCCCCCC--cccceeeCCCC---CEEEEEcCCCccce--ecCCCCCC
Q 047948            8 NSIEEGHALVKWKASLKVHSRSLLHSWFLSSVNVTKISPC--AWSGIHCNHAG---RVVGINLTSMSLNG--TLLEFPFS   80 (171)
Q Consensus         8 ~~~~~~~~l~~~~~~l~~~~~~~~~~W~~~~~~~~~~~~c--~w~gv~c~~~~---~v~~L~l~~~~l~~--~~p~~~l~   80 (171)
                      |.++|++||++||+.+.+ + ..+++|.      .+.|||  .|.||+|+..+   +|+.|+|+++.+.|  .+|+ ++.
T Consensus         3 c~~~e~~aLl~~k~~~~~-~-~~l~sW~------~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~-~l~   73 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGN-P-TTLSSWL------PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPS-SLA   73 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTC-C-GGGTTCC------TTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCG-GGG
T ss_pred             CCHHHHHHHHHHHHHCCC-C-CcCCCCC------CCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCCh-HHh
Confidence            778999999999999976 3 4588998      678999  49999998643   79999999999987  5778 999


Q ss_pred             CCCCCcEEEeec-Ccccccccccc------------cccccccCCccccCCcCCCEEecccCcccccCChhhhCccccCc
Q 047948           81 SFPHLAYLVLYN-NELFYIILPQI------------TNKLSGQIPSEIGLLTHLTVLHISRNQLNGSIPQEVGQLTFLNH  147 (171)
Q Consensus        81 ~L~~L~~L~l~~-n~l~g~~p~~~------------~n~l~g~~p~~~~~l~~L~~L~ls~N~l~g~~P~~~~~l~~L~~  147 (171)
                      .|++|++|++++ |.+.|.+|..+            +|++.+..|..+..+..|+.++++.|.+.+.+|..+.+++.+++
T Consensus        74 ~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~  153 (313)
T d1ogqa_          74 NLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVG  153 (313)
T ss_dssp             GCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCE
T ss_pred             cCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccce
Confidence            999999999986 89999999877            67777777777777777777777777777777777777777777


Q ss_pred             eeccccccccccch
Q 047948          148 LILDLIFLIFWMVQ  161 (171)
Q Consensus       148 L~Ls~N~l~~~~~~  161 (171)
                      +++++|.+.+.++.
T Consensus       154 l~l~~n~l~~~ip~  167 (313)
T d1ogqa_         154 ITFDGNRISGAIPD  167 (313)
T ss_dssp             EECCSSCCEEECCG
T ss_pred             eecccccccccccc
Confidence            77777777654443



>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure