Citrus Sinensis ID: 047959


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
WRQIFSVMELPFHLKVCCIYLCAFPPSIEISTEQLYQLWVAEGFIPYNSEETAKHYLKELIHRGFIQVSKRRSGGTIKACYVPSIAYTSLALMARKTEFVSSIFSEEESLSNVKRSKSDHLALIHCENFCKKFKHLRVLNLGSAVLDQYPPGLENLFYLKYLKLNIPSLKCLPSLLCTLLNLQTLEMPSSYIDHSPEDIWMMQKLMHLNFGSITLPAPPKNNSSPLKNLIFISALHPSSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGKMRQLSRMILSEYKFPPSLTQLSLSNTELVEDPMPTLEELPHLEVLKLKQNSYLERKLACVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEEQWCIKSLCKLELHWPQPELRQLLRAFEDMEWRKSQMVEASYIAAIWLSISTVISALIRSILFISAAFWGHYFEADLPPVMPW
cEEEcccccccccHHHHHHHcccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHcccEEEEEcccccEEEEEEEcHHHHHHHHHHHcccccEEEEcccccEEccEEEccEEEEEEEEEEcccccccEEEEEEEcccccccccccccccccccEEEccccccccccHHccccccccEEEEcccccccccHHHHccccccEEEEccccccccccccccccccccEEEEEccccccHHHHcccccccEEEEEccccccHHHHHHHHcccccccEEEEEcccccccccccccccccccccccEEEEEcEEccccccccccccccccEEEEEEcEEcccEEEEEcccccccccEEEEEcccccccEEEcccccccccccEEEcccccccccccccccccccEEEEEcccHHHHHHHHHccccccccccEEEEEEEcEEEEEEEHHHHHHHHHHEEEccccccccccccccccccc
cccEEcHHcccccccccEEEEEcccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHccEEEEEEccccccEEEEEHHHHHHHHHHHHHHHHccEEEEccccccccccEEEEEEEccHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHcEEcccccccHHccHHHHHHHHHHHEEccccccccccccccccHHHHHHEEEcccccHHHHHHHHHHHHHHEEEccccHccHHHHHHHHHHcHHHcEEEEcccccccccccccccccccccccEEEEEEccccccccHHHHHHcccccEEEEEcccccccEEEEEccccccccEEEEEcccccccEEEEcccccccccEEEEcccHHHHHcccHHHHHHHHHEEEEccccHHHHHHHcccccccEEEEEEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHccHccccccccccc
wrqifsvmelpfHLKVCCIYlcafppsieisTEQLYQLWVAegfipynseeTAKHYLKELIHRGFIqvskrrsggtikacyvpsiAYTSLALMARKTEFVSSIFSEeeslsnvkrsksdhLALIHCENFCKKFKHLRVLNLGsavldqyppglenlFYLKYLKlnipslkclpSLLCTLLnlqtlempssyidhspeDIWMMQKLMHlnfgsitlpappknnssplknLIFIsalhpssctpdilgrlpnvqtlrisgdlsyyhsgvskslcqlhKLECLKLVNEGKMRQLSRMILseykfppsltqlslsntelvedpmptleelphleVLKLKQNSYLERKlacvgcssfpqlkILHLKSMLWLEewtmgagampkleslilnpcaylrklpeeQWCIKSLCklelhwpqpELRQLLRAFEDMEWRKSQMVEASYIAAIWLSISTVISALIRSILFISAAFWghyfeadlppvmpw
WRQIFSVMELPFHLKVCCIYLCAFPPSIEISTEQLYQLWVAEGFIPYNSEETAKHYLKELIHRGFiqvskrrsggtikaCYVPSIAYTSLALMARKTEFVSSIFSEEESLSNVKRSKSDHLALIHCENFCKKFKHLRVLNLGSAVLDQYPPGLENLFYLKYLKLNIPSLKCLPSLLCTLLNLQTLEMPSSYIDHSPEDIWMMQKLMHLNFGSITLPAPPKNNSSPLKNLIFISALHPSSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGKMRQLSRMILSEYKFPPSLTQLSLSNTELVEDPMPTLEELPHLEVLKLKQNSYLERKLACVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEEQWCIKSLCKLELHWPQPELRQLLRAFEDMEWRKSQMVEASYIAAIWLSISTVISALIRSILFISAAFWGHYFEADLPPVMPW
WRQIFSVMELPFHLKVCCIYLCAFPPSIEISTEQLYQLWVAEGFIPYNSEETAKHYLKELIHRGFIQVSKRRSGGTIKACYVPSIAYTSLALMARKTefvssifseeeslsNVKRSKSDHLALIHCENFCKKFKHLRVLNLGSAVLDQYPPGLENLFYLKYLKLNIpslkclpsllctllnlqtlEMPSSYIDHSPEDIWMMQKLMHLNFGSITLPAPPKNNSSPLKNLIFISALHPSSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGKMRQLSRMILSEYKFPPSLTQLSLSNTELVEDPMPTLEELPHLEVLKLKQNSYLERKLACVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEEQWCIKSLCKLELHWPQPELRQLLRAFEDMEWRKSQMVEASYIAAIWLSISTVISALIRSILFISAAFWGHYFEADLPPVMPW
***IFSVMELPFHLKVCCIYLCAFPPSIEISTEQLYQLWVAEGFIPYNSEETAKHYLKELIHRGFIQVSKRRSGGTIKACYVPSIAYTSLALMARKTEFVSSIF**************DHLALIHCENFCKKFKHLRVLNLGSAVLDQYPPGLENLFYLKYLKLNIPSLKCLPSLLCTLLNLQTLEMPSSYIDHSPEDIWMMQKLMHLNFGSITL**********LKNLIFISALHPSSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGKMRQLSRMILSEYKFPPSLT****************LEELPHLEVLKLKQNSYLERKLACVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEEQWCIKSLCKLELHWPQPELRQLLRAFEDMEWRKSQMVEASYIAAIWLSISTVISALIRSILFISAAFWGHYFEADL******
WRQIFSVMELPFHLKVCCIYLCAFPPSIEISTEQLYQLWVAEGFIPYNSEETAKHYLKELIHRGFIQVSKRRSGGTIKACYVPSIAYTSLALMARKTEFVSSIF****************LALIHCENFCKKFKHLRVLNLGSAVLDQYPPGLENLFYLKYLKLNIPSLKCLPSLLCTLLNLQTLEMPSSYIDHSPEDIWMMQKLMHLNFGSITLPA******SPLKNLIFISALHPSSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGKMRQLSRMILSEYKFPPSLTQLSLSNTELVEDPMPTLEELPHLEVLKLKQNSYLERKLACVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEEQWCIKSLCKLELHWPQPEL***********WRKSQMVEASYIAAIWLSISTVISALIRSILFISAAFWGHYFEADLPPVMP*
WRQIFSVMELPFHLKVCCIYLCAFPPSIEISTEQLYQLWVAEGFIPYNSEETAKHYLKELIHRGFIQVSKRRSGGTIKACYVPSIAYTSLALMARKTEFVSS****************DHLALIHCENFCKKFKHLRVLNLGSAVLDQYPPGLENLFYLKYLKLNIPSLKCLPSLLCTLLNLQTLEMPSSYIDHSPEDIWMMQKLMHLNFGSITLPAPPKNNSSPLKNLIFISALHPSSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGKMRQLSRMILSEYKFPPSLTQLSLSNTELVEDPMPTLEELPHLEVLKLKQNSYLERKLACVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEEQWCIKSLCKLELHWPQPELRQLLRAFEDMEWRKSQMVEASYIAAIWLSISTVISALIRSILFISAAFWGHYFEADLPPVMPW
WRQIFSVMELPFHLKVCCIYLCAFPPSIEISTEQLYQLWVAEGFIPYNSEETAKHYLKELIHRGFIQVSKRRSGGTIKACYVPSIAYTSLALMARKTEFVSSIFSEEESLSNVKRSKSDHLALIHCENFCKKFKHLRVLNLGSAVLDQYPPGLENLFYLKYLKLNIPSLKCLPSLLCTLLNLQTLEMPSSYIDHSPEDIWMMQKLMHLNFGSITLPAPPKNNSSPLKNLIFISALHPSSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGKMRQLSRMILSEYKFPPSLTQLSLSNTELVEDPMPTLEELPHLEVLKLKQNSYLERKLACVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEEQWCIKSLCKLELHWPQPELRQLLRAFEDMEWRKSQMVEASYIAAIWLSISTVISALIRSILFISAAFWGHYFEADLPPVMPW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
WRQIFSVMELPFHLKVCCIYLCAFPPSIEISTEQLYQLWVAEGFIPYNSEETAKHYLKELIHRGFIQVSKRRSGGTIKACYVPSIAYTSLALMARKTEFVSSIFSEEESLSNVKRSKSDHLALIHCENFCKKFKHLRVLNLGSAVLDQYPPGLENLFYLKYLKLNIPSLKCLPSLLCTLLNLQTLEMPSSYIDHSPEDIWMMQKLMHLNFGSITLPAPPKNNSSPLKNLIFISALHPSSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGKMRQLSRMILSEYKFPPSLTQLSLSNTELVEDPMPTLEELPHLEVLKLKQNSYLERKLACVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEEQWCIKSLCKLELHWPQPELRQLLRAFEDMEWRKSQMVEASYIAAIWLSISTVISALIRSILFISAAFWGHYFEADLPPVMPW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query478 2.2.26 [Sep-21-2011]
Q8W474907 Probable disease resistan yes no 0.815 0.429 0.286 5e-26
Q9FJB5901 Disease resistance RPP8-l no no 0.859 0.456 0.251 9e-26
Q6L3Z71317 Putative late blight resi N/A no 0.845 0.306 0.290 7e-25
Q9XIF0906 Putative disease resistan no no 0.822 0.433 0.294 1e-24
P59584910 Disease resistance protei no no 0.861 0.452 0.238 1e-23
Q6L4031312 Putative late blight resi N/A no 0.845 0.307 0.292 1e-23
P0C8S1906 Probable disease resistan no no 0.809 0.427 0.261 1e-22
Q6L3X31202 Putative late blight resi N/A no 0.763 0.303 0.282 2e-22
Q8W4J9908 Disease resistance protei no no 0.853 0.449 0.256 8e-22
Q9FJK8908 Probable disease resistan no no 0.841 0.442 0.257 2e-21
>sp|Q8W474|DRL7_ARATH Probable disease resistance protein At1g58390 OS=Arabidopsis thaliana GN=At1g58390 PE=2 SV=4 Back     alignment and function desciption
 Score =  119 bits (298), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 134/467 (28%), Positives = 203/467 (43%), Gaps = 77/467 (16%)

Query: 6   SVMELPFHLKVCCIYLCAFPPSIEISTEQLYQLWVAEGFI---PYNSEET----AKHYLK 58
           S  ELP +LK C +YL  FP   +I+ E+L   W AEG      Y++ ET     + YL+
Sbjct: 412 SFEELPSYLKHCFLYLAHFPEDHKINVEKLSYCWAAEGISTAEDYHNGETIQDVGQSYLE 471

Query: 59  ELIHRGFIQVSKRRSGGTIKACYVPSIAYTSLALMARKTEF----VSSIFSEEESLSNVK 114
           EL+ R  I   +  +      C++  +        A++  F    V S+     S  N +
Sbjct: 472 ELVRRNMIIWERDATASRFGTCHLHDMMREVCLFKAKEENFLQIAVKSVGVTSSSTGNSQ 531

Query: 115 RSKSDHLALIHC---------------------------ENF------CKKFKHLRVLNL 141
                   +  C                           EN+        + K LRVL+L
Sbjct: 532 SPCRSRRLVYQCPTTLHVERDINNPKLRSLVVLWHDLWVENWKLLGTSFTRLKLLRVLDL 591

Query: 142 GSAVLD--QYPPGLENLFYLKYLKLNIPSLKCLPSLLCTLLNL--QTLEMPSSYIDHSPE 197
                +  + P G+ NL +L+YL L    +  LPS L  L+ L    L++ + +I   P 
Sbjct: 592 FYVDFEGMKLPFGIGNLIHLRYLSLQDAKVSHLPSSLGNLMLLIYLNLDVDTEFI-FVP- 649

Query: 198 DIWMMQKLMHLNFGSITLPAPPKN-----NSSPLKNLIFISALHPSSCTPDILGRLPNVQ 252
           D++M  ++  L +  + L    K      N   L+ L++ S  H SS   D+ G +  + 
Sbjct: 650 DVFM--RMHELRYLKLPLHMHKKTRLSLRNLVKLETLVYFSTWHSSS--KDLCG-MTRLM 704

Query: 253 TLRISGDLSYYHSGVSKSLCQLHKLECLKLVN--EGKMRQ---------LSRMILSEY-- 299
           TL I          +S S+  L  LE L +V     KMR+         L  ++L  Y  
Sbjct: 705 TLAIRLTRVTSTETLSASISGLRNLEYLYIVGTHSKKMREEGIVLDFIHLKHLLLDLYMP 764

Query: 300 ---KFPPSLTQLSLSNTELVEDPMPTLEELPHLEVLKLKQNSYLERKLACVGCSSFPQLK 356
               FP  LT + LS   L EDPMP LE+L HL+ + L + SY  R++ C G   FPQLK
Sbjct: 765 RQQHFPSRLTFVKLSECGLEEDPMPILEKLLHLKGVILLKGSYCGRRMVCSG-GGFPQLK 823

Query: 357 ILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEEQWCIKSL 403
            L +  +   EEW +  G+MP LE+L +  C  L+++P+    I SL
Sbjct: 824 KLEIVGLNKWEEWLVEEGSMPLLETLSILDCEELKEIPDGLRFIYSL 870




Possible disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FJB5|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=Arabidopsis thaliana GN=RPP8L3 PE=2 SV=1 Back     alignment and function description
>sp|Q6L3Z7|R1B14_SOLDE Putative late blight resistance protein homolog R1B-14 OS=Solanum demissum GN=R1B-14 PE=3 SV=1 Back     alignment and function description
>sp|Q9XIF0|DRL13_ARATH Putative disease resistance protein At1g59780 OS=Arabidopsis thaliana GN=At1g59780 PE=2 SV=1 Back     alignment and function description
>sp|P59584|RP8HA_ARATH Disease resistance protein RPH8A OS=Arabidopsis thaliana GN=RPH8A PE=3 SV=1 Back     alignment and function description
>sp|Q6L403|R1B17_SOLDE Putative late blight resistance protein homolog R1B-17 OS=Solanum demissum GN=R1B-17 PE=3 SV=1 Back     alignment and function description
>sp|P0C8S1|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1 Back     alignment and function description
>sp|Q6L3X3|R1B8_SOLDE Putative late blight resistance protein homolog R1B-8 OS=Solanum demissum GN=R1B-8 PE=5 SV=1 Back     alignment and function description
>sp|Q8W4J9|RPP8_ARATH Disease resistance protein RPP8 OS=Arabidopsis thaliana GN=RPP8 PE=1 SV=2 Back     alignment and function description
>sp|Q9FJK8|RP8L4_ARATH Probable disease resistance RPP8-like protein 4 OS=Arabidopsis thaliana GN=RPP8L4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query478
359491404 922 PREDICTED: probable disease resistance R 0.899 0.466 0.312 2e-47
359496848 856 PREDICTED: disease resistance RPP8-like 0.815 0.455 0.296 1e-42
147766035 902 hypothetical protein VITISV_038742 [Viti 0.815 0.432 0.285 5e-41
359489148 897 PREDICTED: probable disease resistance R 0.880 0.469 0.291 2e-36
224075299 896 nbs-lrr resistance protein [Populus tric 0.820 0.437 0.288 3e-36
224143391542 predicted protein [Populus trichocarpa] 0.880 0.776 0.282 1e-35
359489156 899 PREDICTED: probable disease resistance p 0.884 0.470 0.292 1e-35
224096480 910 nbs-lrr resistance protein [Populus tric 0.882 0.463 0.281 2e-35
444301787 878 NBS type disease resistance protein [Mal 0.830 0.452 0.305 4e-35
356567194 750 PREDICTED: disease resistance protein RP 0.843 0.537 0.294 5e-35
>gi|359491404|ref|XP_002274414.2| PREDICTED: probable disease resistance RPP8-like protein 2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  196 bits (498), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 152/486 (31%), Positives = 237/486 (48%), Gaps = 56/486 (11%)

Query: 5   FSVMELPFHLKVCCIYLCAFPPSIEISTEQLYQLWVAEGFIPYNS----EETAKHYLKEL 60
            S  +LP++LK C +Y   FP   EIS  +L  LWVAEGF+        E+ A+ YL+EL
Sbjct: 426 LSYSDLPYYLKSCFLYFGLFPEDYEISARRLILLWVAEGFVQPRGQEPLEDVAEDYLEEL 485

Query: 61  IHRGFIQVSKRRSGGTIKACYVPSIAYTSLALMARKTEFVSSIFSE--EESLSNVKR--- 115
           + R  IQV+ R+S G IK C V  + +       ++ +F+  I  E    SL+ V+R   
Sbjct: 486 VGRSMIQVATRKSNGRIKTCCVHDLLHELSVSKGKEDQFLDIIHGEFTVSSLTRVRRLAI 545

Query: 116 --------SKSDHLALIHCENFC-------KKFKHLRVLNLGSAVLDQYPPGLENLFYLK 160
                     +  +  + C + C       +KFK LR+L+L    + +    + NL +L+
Sbjct: 546 HLGVPPTTKNTSKVRSLLCFDICEPSFQELRKFKLLRILDLEGVYISRLHSSIGNLIHLR 605

Query: 161 YLKLNIPSLKCLPSLLCTLLNLQTLEMPSSYIDHSPEDIWMMQKLMHLNFGSITLPAPPK 220
           YL L    LK LP  +  LLNLQTL++ S+ ++  P  IW MQKL HL F  +   A   
Sbjct: 606 YLGLRGTWLKKLPPSIQFLLNLQTLDLRSTLLNPIPIVIWKMQKLRHLYFNELEEMAVNP 665

Query: 221 NNSSPLKNLIFISA--LHPSSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLE 278
              + L NL  +    ++ +S   + L +L N++ L + GDL  +   + K +    +LE
Sbjct: 666 PTDASLANLQTLHGICINQTSYVENGLSKLTNLRELGLHGDLLLHEEAIGKWIFSSERLE 725

Query: 279 CLKLVNEGKMRQ-------------------------LSRMILSEYKFPPSLTQLSLSNT 313
           CLKL     M                           ++++  +EY FP +LT+LSL  +
Sbjct: 726 CLKLHTRDVMGDFAKNAIPKLNFSSHPHLIKLHLKGFMAKLFDAEY-FPQNLTELSLKGS 784

Query: 314 ELVEDPMPTLEELPHLEVLKLKQNSYLERKLACVGCSSFPQLKILHLKSMLWLEEWTMGA 373
            L+EDPM  LE L  L VLKLK ++YL +++ C  C  FPQL  L L  +  +E W +  
Sbjct: 785 FLMEDPMVKLEMLQSLRVLKLKHSAYLGKEMIC-SCGGFPQLHFLKLSFLNTVERWRIED 843

Query: 374 GAMPKLESLILNPCAYLRKLPEEQWCIKSLCKLELHWPQPELRQLLRAFEDMEWRKSQMV 433
           GAM +L  L +  C  L+ +P     + ++ KL+L +   E    ++  +   W K   +
Sbjct: 844 GAMGRLRQLEIIECKRLKIVPRGLQPVTTIHKLKLGYMPREFEMKVQERQGENWYK---I 900

Query: 434 EASYIA 439
           E + +A
Sbjct: 901 EHAVVA 906




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359496848|ref|XP_002269653.2| PREDICTED: disease resistance RPP8-like protein 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147766035|emb|CAN70214.1| hypothetical protein VITISV_038742 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359489148|ref|XP_003633887.1| PREDICTED: probable disease resistance RPP8-like protein 4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224075299|ref|XP_002304589.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222842021|gb|EEE79568.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224143391|ref|XP_002336034.1| predicted protein [Populus trichocarpa] gi|222839536|gb|EEE77873.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359489156|ref|XP_003633889.1| PREDICTED: probable disease resistance protein RDL6/RF9-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224096480|ref|XP_002334697.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222874531|gb|EEF11662.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|444301787|gb|AGD98930.1| NBS type disease resistance protein [Malus x domestica] Back     alignment and taxonomy information
>gi|356567194|ref|XP_003551806.1| PREDICTED: disease resistance protein RPP13-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query478
TAIR|locus:2176486908 RPP8 "RECOGNITION OF PERONOSPO 0.355 0.187 0.308 3e-22
TAIR|locus:2169523901 AT5G35450 [Arabidopsis thalian 0.265 0.140 0.333 1.7e-21
TAIR|locus:2037639907 AT1G58390 "AT1G58390" [Arabido 0.518 0.273 0.298 1.8e-21
TAIR|locus:2025916906 AT1G59780 "AT1G59780" [Arabido 0.560 0.295 0.302 2.9e-21
TAIR|locus:2152536908 AT5G48620 [Arabidopsis thalian 0.259 0.136 0.344 2.2e-20
TAIR|locus:5049561821049 AT1G58848 [Arabidopsis thalian 0.294 0.134 0.389 2.4e-19
TAIR|locus:28269781049 AT1G59218 [Arabidopsis thalian 0.294 0.134 0.389 2.4e-19
TAIR|locus:5049561861138 AT1G58602 [Arabidopsis thalian 0.282 0.118 0.383 2.8e-18
TAIR|locus:2037623899 AT1G58410 [Arabidopsis thalian 0.556 0.295 0.275 1.4e-17
TAIR|locus:2197409727 LOV1 "LOCUS ORCHESTRATING VICT 0.476 0.313 0.275 1.2e-13
TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 202 (76.2 bits), Expect = 3.0e-22, Sum P(3) = 3.0e-22
 Identities = 54/175 (30%), Positives = 91/175 (52%)

Query:   245 LGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGKMRQLSRMILSEYKFPPS 304
             L  L N++TL     L  Y           H +   +L   G   ++S+ I  +++FPP 
Sbjct:   716 LRELRNLETLNFLFSLETYMVDYMGEFVLDHFIHLKQL---GLAVRMSK-IPDQHQFPPH 771

Query:   305 LTQLSLSNTELVEDPMPTLEELPHLEVLKLKQNSYLERKLACVGCSSFPQLKILHLKSML 364
             L  L L    + EDPMP LE+L HL+ ++L + ++L  ++ C     FPQL ++ +    
Sbjct:   772 LVHLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVC-SKGGFPQLCVIEISKES 830

Query:   365 WLEEWTMGAGAMPKLESLILNPCAYLRKLPEEQWCIKSLCKLELHWPQPELRQLL 419
              LEEW +  G+MP L +L ++ C  L++LP+    I SL +L++   + E ++ L
Sbjct:   831 ELEEWIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEGMKREWKEKL 885


GO:0006952 "defense response" evidence=IEA;ISS;TAS
GO:0043531 "ADP binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=ISS
GO:0009416 "response to light stimulus" evidence=IMP
GO:0051607 "defense response to virus" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0009626 "plant-type hypersensitive response" evidence=IMP
GO:0051707 "response to other organism" evidence=IMP
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025916 AT1G59780 "AT1G59780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037623 AT1G58410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197409 LOV1 "LOCUS ORCHESTRATING VICTORIN EFFECTS1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 6e-06
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score = 47.3 bits (113), Expect = 6e-06
 Identities = 21/42 (50%), Positives = 25/42 (59%)

Query: 5   FSVMELPFHLKVCCIYLCAFPPSIEISTEQLYQLWVAEGFIP 46
            S   LP HLK C +YL  FP    I  EQL +LW+AEGF+ 
Sbjct: 240 LSYDNLPMHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVI 281


Length = 285

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 478
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.93
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.85
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.83
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.78
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.76
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.75
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.67
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.66
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.6
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.59
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.58
KOG0617264 consensus Ras suppressor protein (contains leucine 99.58
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.55
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.46
KOG4237498 consensus Extracellular matrix protein slit, conta 99.42
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.39
KOG4237498 consensus Extracellular matrix protein slit, conta 99.29
KOG4341483 consensus F-box protein containing LRR [General fu 99.21
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.06
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.06
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.05
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.04
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.02
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.97
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.97
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.96
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.96
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.84
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.82
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.8
KOG4341483 consensus F-box protein containing LRR [General fu 98.75
PLN03150623 hypothetical protein; Provisional 98.64
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.61
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.59
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.51
PLN03150623 hypothetical protein; Provisional 98.41
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.36
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.33
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.3
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.24
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.19
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.18
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.16
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.11
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.08
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.06
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.93
PRK15386426 type III secretion protein GogB; Provisional 97.9
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.79
PRK15386 426 type III secretion protein GogB; Provisional 97.79
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.73
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.63
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.56
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.43
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.4
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.37
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.28
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.84
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.58
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.44
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.31
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.86
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.8
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.47
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.42
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.06
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.01
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.15
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.73
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.68
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.65
smart0037026 LRR Leucine-rich repeats, outliers. 91.65
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.74
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.56
smart0037026 LRR Leucine-rich repeats, outliers. 89.56
KOG4308478 consensus LRR-containing protein [Function unknown 87.41
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=9e-43  Score=364.85  Aligned_cols=204  Identities=26%  Similarity=0.442  Sum_probs=177.1

Q ss_pred             eecccCCChhhHHHHHhHhcccCCCceechhHHHHHHHHcCCCC-----CChHHHHHHHHHHHHHccceeeeecCCCCcE
Q 047959            3 QIFSVMELPFHLKVCCIYLCAFPPSIEISTEQLYQLWVAEGFIP-----YNSEETAKHYLKELIHRGFIQVSKRRSGGTI   77 (478)
Q Consensus         3 ~klSY~~L~~~~k~cFl~~a~Fp~~~~i~~~~Li~~w~~~g~~~-----~~~~~~~~~~~~~L~~~~ll~~~~~~~~g~~   77 (478)
                      +++|||.||+++|.||+|||+|||||+|+++.||.+|+||||+.     ..+++.|.+|+++|+++++++.....  |+.
T Consensus       401 LklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~--~~~  478 (889)
T KOG4658|consen  401 LKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDE--GRK  478 (889)
T ss_pred             hhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccc--cce
Confidence            68999999988999999999999999999999999999999997     78899999999999999999987754  777


Q ss_pred             eEEEeCHHHHHHHHHHhh-----hcCcEeeccCCC--------CccC-ceec--------------CCCCCeeee---c-
Q 047959           78 KACYVPSIAYTSLALMAR-----KTEFVSSIFSEE--------ESLS-NVKR--------------SKSDHLALI---H-  125 (478)
Q Consensus        78 ~~~~mhdli~dl~~~~~~-----~e~~~~~~~~~~--------~~~~-~~r~--------------~~~~~lr~l---~-  125 (478)
                      ..|+|||+|||||.++|+     +|+.+.   ..+        ...| .+||              ..+++++||   + 
T Consensus       479 ~~~kmHDvvRe~al~ias~~~~~~e~~iv---~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n  555 (889)
T KOG4658|consen  479 ETVKMHDVVREMALWIASDFGKQEENQIV---SDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRN  555 (889)
T ss_pred             eEEEeeHHHHHHHHHHhccccccccceEE---ECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceEEEeec
Confidence            899999999999999999     666433   322        1112 4455              667789888   2 


Q ss_pred             -------CccccCCCCeEeEEEecCCC-CCcCCccCCCCCCCceEeecCCCCCccchhhhCCCCCcEEeCCCC-cCcccc
Q 047959          126 -------CENFCKKFKHLRVLNLGSAV-LDQYPPGLENLFYLKYLKLNIPSLKCLPSLLCTLLNLQTLEMPSS-YIDHSP  196 (478)
Q Consensus       126 -------~~~~~~~~~~L~~L~L~~~~-l~~lp~~~~~l~~L~~L~l~~~~i~~lp~~~~~l~~L~~L~l~~~-~l~~lp  196 (478)
                             ..+||..++.||+|||++|. +..+|++|+.+-+||||+++++.+..+|..+++|++|.+|++..+ .+..+|
T Consensus       556 ~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~  635 (889)
T KOG4658|consen  556 SDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIP  635 (889)
T ss_pred             chhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheecccccccccccc
Confidence                   35678999999999999887 779999999999999999999999999999999999999999999 666666


Q ss_pred             hhhhccccCcEEEee
Q 047959          197 EDIWMMQKLMHLNFG  211 (478)
Q Consensus       197 ~~i~~l~~L~~L~l~  211 (478)
                      .....|++||+|.+.
T Consensus       636 ~i~~~L~~Lr~L~l~  650 (889)
T KOG4658|consen  636 GILLELQSLRVLRLP  650 (889)
T ss_pred             chhhhcccccEEEee
Confidence            666679999999994



>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-12
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 9e-12
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 9e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-08
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 70.4 bits (173), Expect = 1e-13
 Identities = 53/312 (16%), Positives = 102/312 (32%), Gaps = 57/312 (18%)

Query: 127 ENFCKKFKHLRVLNLGSAVLDQYPPGLENLFYLKYLKLNIPSLKCLPSLL--CTLLNLQT 184
             +       +                 N    +       +LK    LL   T      
Sbjct: 26  RPYHDVLSQWQRHYNADRNRWHSAWRQANSNNPQIETRTGRALKATADLLEDATQPGRVA 85

Query: 185 LEMPSSYIDHSPEDIWMMQKLMHLNFGSITLPAPPKNNSSPLKNLIFISALHPSSCTPDI 244
           LE+ S  +   P+  + +  L H+             +++ L  L            PD 
Sbjct: 86  LELRSVPLPQFPDQAFRLSHLQHMTI-----------DAAGLMEL------------PDT 122

Query: 245 LGRLPNVQTLRISG-DLSYYHSGVSKSLCQLHKLECLKLVNEGKMRQL-----SRMILSE 298
           + +   ++TL ++   L      +  S+  L++L  L +    ++ +L     S     E
Sbjct: 123 MQQFAGLETLTLARNPLR----ALPASIASLNRLRELSIRACPELTELPEPLASTDASGE 178

Query: 299 YKFPPSLTQLSLSNTELVEDPMPTLEELPHLEVLKLKQNSYLE-----------RKLACV 347
           ++   +L  L L  T +   P  ++  L +L+ LK++ +                +L   
Sbjct: 179 HQGLVNLQSLRLEWTGIRSLP-ASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLR 237

Query: 348 GCSSF----------PQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEEQ 397
           GC++             LK L LK    L    +    + +LE L L  C  L +LP   
Sbjct: 238 GCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLI 297

Query: 398 WCIKSLCKLELH 409
             + + C + + 
Sbjct: 298 AQLPANCIILVP 309


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query478
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.93
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.93
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.92
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.91
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.91
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.91
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.91
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.9
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.9
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.89
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.88
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.87
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.87
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.87
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.86
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.86
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.86
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.85
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.84
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.84
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.83
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.82
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.82
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.82
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.81
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.79
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.78
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.78
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.78
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.78
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.75
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.74
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.73
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.73
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.73
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.73
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.72
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.72
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.7
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.7
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.69
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.69
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.69
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.68
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.67
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.66
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.66
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.65
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.65
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.63
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.62
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.6
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.59
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.57
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.55
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.54
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.54
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.52
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.52
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.51
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.51
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.5
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.49
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.49
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.48
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.47
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.45
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.41
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.4
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.37
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.35
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.34
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.28
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.27
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.26
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.26
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.23
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.21
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.17
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.16
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.16
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.1
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.09
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.04
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.0
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.99
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.96
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.95
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 98.93
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.79
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.78
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.69
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.68
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 98.67
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.66
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.59
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.55
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.49
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.43
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.39
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.25
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.14
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.13
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.07
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.91
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.78
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.65
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.56
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.45
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.36
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.19
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.1
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
Probab=99.95  E-value=3.1e-27  Score=239.02  Aligned_cols=277  Identities=19%  Similarity=0.170  Sum_probs=226.8

Q ss_pred             ccccCCCCeEeEEEecCCCCCcC-CccCCCCCCCceEeecCCCCCccchh-hhCCCCCcEEeCCCCcCccc-chhhhccc
Q 047959          127 ENFCKKFKHLRVLNLGSAVLDQY-PPGLENLFYLKYLKLNIPSLKCLPSL-LCTLLNLQTLEMPSSYIDHS-PEDIWMMQ  203 (478)
Q Consensus       127 ~~~~~~~~~L~~L~L~~~~l~~l-p~~~~~l~~L~~L~l~~~~i~~lp~~-~~~l~~L~~L~l~~~~l~~l-p~~i~~l~  203 (478)
                      ...+.++++|++|+|++|.++.+ |..+.++++|++|++++|.+..+|.. +.++++|++|++++|.+..+ |..+..++
T Consensus        49 ~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~~l~  128 (477)
T 2id5_A           49 QDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLY  128 (477)
T ss_dssp             TTTTTTCTTCCEEECTTSCCCEECTTTTTTCTTCCEEECCSSCCCSCCTTSSTTCTTCCEEECTTSCCCEECTTTTTTCT
T ss_pred             HhHccCCCCCCEEECCCCccCEeChhhhhCCccCCEEECCCCcCCccCcccccCCCCCCEEECCCCccccCChhHccccc
Confidence            45678899999999999998855 67799999999999999999988864 68899999999999988776 45688899


Q ss_pred             cCcEEEeeCCCCCCCCCCCCCCCCCCcEeCcccCC-CCC-ccccCCCCCCcEEEEEecCCcchhhHHHhccCCCCCCEEE
Q 047959          204 KLMHLNFGSITLPAPPKNNSSPLKNLIFISALHPS-SCT-PDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLK  281 (478)
Q Consensus       204 ~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~-~~~-~~~l~~l~~L~~L~l~~~~~~~~~~l~~~l~~~~~L~~L~  281 (478)
                      +|++|++++|.+....+..+..+++|++|++.++. ... +..+.++++|+.|+++++  ......+..+..+++|+.|+
T Consensus       129 ~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n--~i~~~~~~~~~~l~~L~~L~  206 (477)
T 2id5_A          129 NLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHL--NINAIRDYSFKRLYRLKVLE  206 (477)
T ss_dssp             TCCEEEECCTTCCEECTTSSTTCTTCCEEEEESCCCSSCCHHHHTTCTTCCEEEEESC--CCCEECTTCSCSCTTCCEEE
T ss_pred             cCCEEECCCCccceeChhhccCCCCCCEEECCCCcCcccChhHhcccCCCcEEeCCCC--cCcEeChhhcccCcccceee
Confidence            99999998887777777788999999999999988 443 345889999999999998  34444455788899999999


Q ss_pred             EEecCcccccCccccccccCCCCceEEEEEeecCCCCCcCcccCCCCCCeEEEeeCcccCceeEEeCCCCCcccceeEEe
Q 047959          282 LVNEGKMRQLSRMILSEYKFPPSLTQLSLSNTELVEDPMPTLEELPHLEVLKLKQNSYLERKLACVGCSSFPQLKILHLK  361 (478)
Q Consensus       282 l~~~~~l~~~p~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~~~~L~~L~L~  361 (478)
                      ++++..+..+|.   .... ..+|+.|++++|.++......+..+++|+.|+|++|.+.......  +..+++|+.|+++
T Consensus       207 l~~~~~~~~~~~---~~~~-~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~--~~~l~~L~~L~L~  280 (477)
T 2id5_A          207 ISHWPYLDTMTP---NCLY-GLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEGSM--LHELLRLQEIQLV  280 (477)
T ss_dssp             EECCTTCCEECT---TTTT-TCCCSEEEEESSCCCSCCHHHHTTCTTCCEEECCSSCCCEECTTS--CTTCTTCCEEECC
T ss_pred             CCCCccccccCc---cccc-CccccEEECcCCcccccCHHHhcCccccCeeECCCCcCCccChhh--ccccccCCEEECC
Confidence            998777778887   6666 679999999999987665567899999999999999876443322  6788999999999


Q ss_pred             cCCCCCce-eeCCCcccccceeEEecCCCCCCCccccCCCCCCCEEEEecCc
Q 047959          362 SMLWLEEW-TMGAGAMPKLESLILNPCAYLRKLPEEQWCIKSLCKLELHWPQ  412 (478)
Q Consensus       362 ~~~~l~~l-~~~~~~~~~L~~L~l~~c~~l~~lp~~l~~l~~L~~L~l~~c~  412 (478)
                      ++ .++.+ +..+..+++|+.|++++|......+..+..+++|+.|++++++
T Consensus       281 ~n-~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~l~~N~  331 (477)
T 2id5_A          281 GG-QLAVVEPYAFRGLNYLRVLNVSGNQLTTLEESVFHSVGNLETLILDSNP  331 (477)
T ss_dssp             SS-CCSEECTTTBTTCTTCCEEECCSSCCSCCCGGGBSCGGGCCEEECCSSC
T ss_pred             CC-ccceECHHHhcCcccCCEEECCCCcCceeCHhHcCCCcccCEEEccCCC
Confidence            95 56655 4556789999999999986444334467889999999999865



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 478
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 39.3 bits (90), Expect = 8e-04
 Identities = 39/272 (14%), Positives = 93/272 (34%), Gaps = 37/272 (13%)

Query: 134 KHLRVLNLGSAVLDQYPPG-LENLFYLKYLKLNIPSLKCL-PSLLCTLLNLQTLEMPSSY 191
               +L+L +  + +   G  +NL  L  L L    +  + P     L+ L+ L +  + 
Sbjct: 31  PDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQ 90

Query: 192 IDHSPEDIWMMQKLMHLNFGSITLPAPPKNNSSPLKNLIFISALHPSSCTPDILGRLPNV 251
           +   PE +    + + ++   IT                             +   L  +
Sbjct: 91  LKELPEKMPKTLQELRVHENEIT------------------------KVRKSVFNGLNQM 126

Query: 252 QTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGKMRQLSRMILSEYKFPPSLTQLSLS 311
             + +  +        + +   + KL  +++ +      ++ +       PPSLT+L L 
Sbjct: 127 IVVELGTNPLKSSGIENGAFQGMKKLSYIRIAD----TNITTIPQG---LPPSLTELHLD 179

Query: 312 NTELVEDPMPTLEELPHLEVLKLKQNSYLERKLACVGCSSFPQLKILHLKSMLWLEEWTM 371
             ++ +    +L+ L +L    L  +      +     ++ P L+ LHL +   L +   
Sbjct: 180 GNKITKVDAASLKGLNNLAK--LGLSFNSISAVDNGSLANTPHLRELHL-NNNKLVKVPG 236

Query: 372 GAGAMPKLESLILNPCAYLRKLPEEQWCIKSL 403
           G      ++ + L+    +  +    +C    
Sbjct: 237 GLADHKYIQVVYLHNN-NISAIGSNDFCPPGY 267


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query478
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.86
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.85
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.83
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.83
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.79
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.76
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.76
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.75
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.74
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.61
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.37
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.31
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.3
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.22
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.21
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.16
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.1
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.07
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.05
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.04
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.98
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.76
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.74
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.7
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.65
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.21
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.96
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.5
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.48
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.86  E-value=2.3e-21  Score=187.66  Aligned_cols=167  Identities=22%  Similarity=0.266  Sum_probs=77.0

Q ss_pred             CCCCcEeCcccCCCCCccccCCCCCCcEEEEEecCCcchhhHHHhccCCCCCCEEEEEecCcccccCccccccccCCCCc
Q 047959          226 LKNLIFISALHPSSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGKMRQLSRMILSEYKFPPSL  305 (478)
Q Consensus       226 l~~L~~L~l~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~l~~~l~~~~~L~~L~l~~~~~l~~~p~~~~~~~~~~~~L  305 (478)
                      +++++.+.+..+.-........+++|++|+++++.  .. .+ ..+..+++|+.|++++ +.++.++    .+.. +++|
T Consensus       196 l~~~~~l~l~~n~i~~~~~~~~~~~L~~L~l~~n~--l~-~~-~~l~~l~~L~~L~l~~-n~l~~~~----~~~~-~~~L  265 (384)
T d2omza2         196 LTNLESLIATNNQISDITPLGILTNLDELSLNGNQ--LK-DI-GTLASLTNLTDLDLAN-NQISNLA----PLSG-LTKL  265 (384)
T ss_dssp             CTTCSEEECCSSCCCCCGGGGGCTTCCEEECCSSC--CC-CC-GGGGGCTTCSEEECCS-SCCCCCG----GGTT-CTTC
T ss_pred             ccccceeeccCCccCCCCcccccCCCCEEECCCCC--CC-Cc-chhhcccccchhcccc-CccCCCC----cccc-cccC
Confidence            44455555544441111223445666666666652  11 11 2345556666666665 4455554    2344 5666


Q ss_pred             eEEEEEeecCCCCCcCcccCCCCCCeEEEeeCcccCceeEEeCCCCCcccceeEEecCCCCCceeeCCCcccccceeEEe
Q 047959          306 TQLSLSNTELVEDPMPTLEELPHLEVLKLKQNSYLERKLACVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILN  385 (478)
Q Consensus       306 ~~L~l~~~~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~l~~l~~~~~~~~~L~~L~l~  385 (478)
                      +.|+++++.+.+  ...+..++.++.+.+..|.+.+..   . ...+++++.|+++++ .++.++. ...+|+|++|+++
T Consensus       266 ~~L~l~~~~l~~--~~~~~~~~~l~~l~~~~n~l~~~~---~-~~~~~~l~~L~ls~n-~l~~l~~-l~~l~~L~~L~L~  337 (384)
T d2omza2         266 TELKLGANQISN--ISPLAGLTALTNLELNENQLEDIS---P-ISNLKNLTYLTLYFN-NISDISP-VSSLTKLQRLFFA  337 (384)
T ss_dssp             SEEECCSSCCCC--CGGGTTCTTCSEEECCSSCCSCCG---G-GGGCTTCSEEECCSS-CCSCCGG-GGGCTTCCEEECC
T ss_pred             CEeeccCcccCC--CCcccccccccccccccccccccc---c-cchhcccCeEECCCC-CCCCCcc-cccCCCCCEEECC
Confidence            666666665432  123444445555555444443211   0 233444555555442 3333321 3444555555555


Q ss_pred             cCCCCCCCccccCCCCCCCEEEEecCc
Q 047959          386 PCAYLRKLPEEQWCIKSLCKLELHWPQ  412 (478)
Q Consensus       386 ~c~~l~~lp~~l~~l~~L~~L~l~~c~  412 (478)
                      +| .++.++ .+.++++|+.|++++|.
T Consensus       338 ~n-~l~~l~-~l~~l~~L~~L~l~~N~  362 (384)
T d2omza2         338 NN-KVSDVS-SLANLTNINWLSAGHNQ  362 (384)
T ss_dssp             SS-CCCCCG-GGGGCTTCCEEECCSSC
T ss_pred             CC-CCCCCh-hHcCCCCCCEEECCCCc
Confidence            44 233333 24444555555554443



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure