Citrus Sinensis ID: 047972

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---
RFACSILNDNLSSPPFINPSPPHLNSPYLNFLKAICVTIMELKRNFTNCFFVILWMGTFIISSCEAYKFNVGGKNGLWVVKPYENYNHWAERMRFQVNDSLYFKYKKGSDSVLVVTKDDYFSCNNKKPVQSLTDGESVFSFDHSGPYFFISGNADNCNKGQKLIVVVMAVRNKSQHHEAPPSPCPVSCTPPASSPQPSASSPPTSPASPRSSVPPPVESPSPMQPPEPSDIPSDFGAPAPALTSSGSSGLGCNSGLVLGFCVGVTLVLGSFIG
cccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccccccHHHHHccccEEEccEEEEEEccccccEEEEcHHHcccccccccccccccccEEEEccccccEEEEEccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccc
ccHHHEHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccccccEEccccccHHHHHHcccEEEccEEEEEEccccccEEEEcHHHHHHcccccccEEccccccEEEEcccccEEEEEccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHEEEEEEEEEEEEEccccc
rfacsilndnlssppfinpspphlnspyLNFLKAICVTIMELKRNFTNCFFVILWMGTFIISSCEaykfnvggknglwvvkpyenynHWAERMRFQVndslyfkykkgsdsvlvvtkddyfscnnkkpvqsltdgesvfsfdhsgpyffisgnadncnkgQKLIVVVMAVRnksqhheappspcpvsctppasspqpsasspptspasprssvpppvespspmqppepsdipsdfgapapaltssgssglgcnsgLVLGFCVGVTLVLGSFIG
RFACSIlndnlssppfinpSPPHLNSPYLNFLKAICVTIMELKRNFTNCFFVILWMGTFIISSCEAYKFNVGGKNGLWVVKPYENYNHWAERMRFQVNDSLYFKYKKGSDSVLVVTKDDYFSCNNKKPVQSLTDGESVFSFDHSGPYFFISGNADNCNKGQKLIVVVMAVRNKSQHHEAPPSPCPVSCTPPASSPQPSASSPPTSPASPRSSVPPPVESPSPMQPPEPSDIPSDFGAPAPALTSSGSSGLGCNSGLVLGFCVGVTLVLGSFIG
RFACSILNDNLSSPPFINPSPPHLNSPYLNFLKAICVTIMELKRNFTNCFFVILWMGTFIISSCEAYKFNVGGKNGLWVVKPYENYNHWAERMRFQVNDSLYFKYKKGSDSVLVVTKDDYFSCNNKKPVQSLTDGESVFSFDHSGPYFFISGNADNCNKGQKLIVVVMAVRNKSQHHEappspcpvsctppasspqpsasspptspasprssvpppvespspmqppepsdipsDFGAPAPAltssgssglgcnsglvlgFCVGVTLVLGSFIG
************************NSPYLNFLKAICVTIMELKRNFTNCFFVILWMGTFIISSCEAYKFNVGGKNGLWVVKPYENYNHWAERMRFQVNDSLYFKYKKGSDSVLVVTKDDYFSCNNKKPVQSLTDGESVFSFDHSGPYFFISGNADNCNKGQKLIVVVMAV*******************************************************************************************************
**ACSI*NDNLSSPPFINPSPPHLNSPYLNFLKAICVTIMELKRNFTNCFFVILWMGTFIISSCEAYKFNVGGKNGLWVVKPYENYNHWAERMRFQVNDSLYFKYKKGSDSVLVVTKDDYFSCNNKKPVQSLTDGESVFSFDHSGPYFFISGNADNCNKGQKLIVVV*************************************************************************************NSGLVLGFCVGVTLVLGSFIG
RFACSILNDNLSSPPFINPSPPHLNSPYLNFLKAICVTIMELKRNFTNCFFVILWMGTFIISSCEAYKFNVGGKNGLWVVKPYENYNHWAERMRFQVNDSLYFKYKKGSDSVLVVTKDDYFSCNNKKPVQSLTDGESVFSFDHSGPYFFISGNADNCNKGQKLIVVVMAVR***********************************************************IPSDFGAPAPALTSSGSSGLGCNSGLVLGFCVGVTLVLGSFIG
RFACSILNDNLSSPPFINPSPPHLNSPYLNFLKAICVTIMELKRNFTNCFFVILWMGTFIISSCEAYKFNVGGKNGLWVVKPYENYNHWAERMRFQVNDSLYFKYKKGSDSVLVVTKDDYFSCNNKKPVQSLTDGESVFSFDHSGPYFFISGNADNCNKGQKLIVVVMAV***************************************************************************GSSGLGCNSGLVLGFCVGVTLVLGSFIG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RFACSILNDNLSSPPFINPSPPHLNSPYLNFLKAICVTIMELKRNFTNCFFVILWMGTFIISSCEAYKFNVGGKNGLWVVKPYENYNHWAERMRFQVNDSLYFKYKKGSDSVLVVTKDDYFSCNNKKPVQSLTDGESVFSFDHSGPYFFISGNADNCNKGQKLIVVVMAVRNKSQHHEAPPSPCPVSCTPPASSPQPSASSPPTSPASPRSSVPPPVESPSPMQPPEPSDIPSDFGAPAPALTSSGSSGLGCNSGLVLGFCVGVTLVLGSFIG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query273 2.2.26 [Sep-21-2011]
Q9T076 349 Early nodulin-like protei no no 0.549 0.429 0.496 7e-37
Q5JNJ5237 Early nodulin-like protei yes no 0.556 0.641 0.431 6e-31
Q9SK27182 Early nodulin-like protei no no 0.509 0.763 0.431 3e-25
Q8LC95186 Early nodulin-like protei no no 0.461 0.677 0.427 1e-24
Q02917187 Early nodulin-55-2 OS=Gly no no 0.450 0.657 0.361 1e-11
P93328180 Early nodulin-16 OS=Medic N/A no 0.435 0.661 0.297 5e-09
P93329268 Early nodulin-20 OS=Medic N/A no 0.428 0.436 0.303 1e-08
Q07488196 Blue copper protein OS=Ar no no 0.315 0.438 0.337 2e-08
P80728108 Mavicyanin OS=Cucurbita p N/A no 0.351 0.888 0.340 3e-08
Q39131172 Lamin-like protein OS=Ara no no 0.369 0.587 0.308 6e-07
>sp|Q9T076|ENL2_ARATH Early nodulin-like protein 2 OS=Arabidopsis thaliana GN=At4g27520 PE=1 SV=1 Back     alignment and function desciption
 Score =  154 bits (389), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 77/155 (49%), Positives = 97/155 (62%), Gaps = 5/155 (3%)

Query: 42  LKRNFTNCFFVILWMGTFIISSCEAYKFNVGGKNGLWVVKPYENYNHWAERMRFQVNDSL 101
           LK    + FF IL   + + +   A KFNVGG +G WV  P ENY  W+ + RF V+D+L
Sbjct: 4   LKMKSLSFFFTILLSLSTLFTISNARKFNVGG-SGAWVTNPPENYESWSGKNRFLVHDTL 62

Query: 102 YFKYKKGSDSVLVVTKDDYFSCNNKKPVQSLTDGESVFSFDHSGPYFFISGNADNCNKGQ 161
           YF Y KG+DSVL V K DY +CN K P++ + DG+S  S D  GP++FISGN DNC KGQ
Sbjct: 63  YFSYAKGADSVLEVNKADYDACNTKNPIKRVDDGDSEISLDRYGPFYFISGNEDNCKKGQ 122

Query: 162 KLIVVVMAVR----NKSQHHEAPPSPCPVSCTPPA 192
           KL VVV++ R     +S H  AP S  P S TPP 
Sbjct: 123 KLNVVVISARIPSTAQSPHAAAPGSSTPGSMTPPG 157

Arabidopsis thaliana (taxid: 3702)
>sp|Q5JNJ5|ENL1_ORYSJ Early nodulin-like protein 1 OS=Oryza sativa subsp. japonica GN=ENODL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SK27|ENL1_ARATH Early nodulin-like protein 1 OS=Arabidopsis thaliana GN=At2g25060 PE=1 SV=2 Back     alignment and function description
>sp|Q8LC95|ENL3_ARATH Early nodulin-like protein 3 OS=Arabidopsis thaliana GN=At5g25090 PE=1 SV=2 Back     alignment and function description
>sp|Q02917|NO552_SOYBN Early nodulin-55-2 OS=Glycine max GN=ENOD55-2 PE=2 SV=1 Back     alignment and function description
>sp|P93328|NO16_MEDTR Early nodulin-16 OS=Medicago truncatula GN=ENOD16 PE=3 SV=1 Back     alignment and function description
>sp|P93329|NO20_MEDTR Early nodulin-20 OS=Medicago truncatula GN=ENOD20 PE=3 SV=1 Back     alignment and function description
>sp|Q07488|BCB1_ARATH Blue copper protein OS=Arabidopsis thaliana GN=BCB PE=1 SV=2 Back     alignment and function description
>sp|P80728|MAVI_CUCPE Mavicyanin OS=Cucurbita pepo PE=1 SV=1 Back     alignment and function description
>sp|Q39131|LAML_ARATH Lamin-like protein OS=Arabidopsis thaliana GN=At5g15350 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query273
255553701221 Early nodulin 55-2 precursor, putative [ 0.794 0.981 0.521 2e-50
224132924195 predicted protein [Populus trichocarpa] 0.703 0.984 0.479 7e-46
449444554201 PREDICTED: early nodulin-like protein 1- 0.560 0.761 0.575 2e-43
51968674370 predicted GPI-anchored protein [Arabidop 0.644 0.475 0.521 1e-41
15238868370 early nodulin-like protein 1 [Arabidopsi 0.644 0.475 0.521 2e-41
255574684 379 copper ion binding protein, putative [Ri 0.545 0.393 0.542 4e-41
224114912343 predicted protein [Populus trichocarpa] 0.527 0.419 0.575 4e-40
28396618370 phytocyanin protein, PUP2 [Arabidopsis t 0.644 0.475 0.510 6e-40
356546868274 PREDICTED: uncharacterized protein LOC10 0.465 0.463 0.593 2e-38
225446398207 PREDICTED: early nodulin-like protein 2 0.736 0.971 0.449 3e-38
>gi|255553701|ref|XP_002517891.1| Early nodulin 55-2 precursor, putative [Ricinus communis] gi|223542873|gb|EEF44409.1| Early nodulin 55-2 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  205 bits (522), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 148/236 (62%), Gaps = 19/236 (8%)

Query: 40  MELKRNFTNCFFVILWMGTFIISSCEAYKFNVGGKNGLWVVKPYENYNHWAERMRFQVND 99
           M  +R      F+ L M  F+    +AYKF VGG++G WV+ P ENY  WA R RFQVND
Sbjct: 1   MASRRFLGYFIFIFLVMMGFLSGPSKAYKFYVGGRDG-WVLNPSENYTRWAHRNRFQVND 59

Query: 100 SLYFKYKKGSDSVLVVTKDDYFSCNNKKPVQSLTDGESVFSFDHSGPYFFISGNADNCNK 159
           +L+FKYKKGSDSVL+V K+DY SCN K P+QSLTDG+S+F FDHSGP++FISGN DNCNK
Sbjct: 60  TLFFKYKKGSDSVLLVKKEDYTSCNTKSPIQSLTDGDSIFIFDHSGPFYFISGNTDNCNK 119

Query: 160 GQKLIVVVMAVRNK-SQHHEAPPSPCPVSCTPPASSPQPSASSPPTSPASPRS-SVPPPV 217
           GQKL VVVMAVR K S    AP SP PV+  P + S  P +S P   P +  S S  P V
Sbjct: 120 GQKLHVVVMAVRPKPSPTTPAPQSPSPVAAPPQSPSSSPISSPPVPPPTTAESPSESPIV 179

Query: 218 ESPSPMQPPEPSDIPSDFGAPAPALTSSGSSGLGCNSGLVLGFCVGVTLVLGSFIG 273
            + S + PP                  SGS G     GLVLG  +GV++ LGSFIG
Sbjct: 180 SNASELAPPN----------------HSGSEGYNSFFGLVLGASIGVSVTLGSFIG 219

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224132924|ref|XP_002327913.1| predicted protein [Populus trichocarpa] gi|222837322|gb|EEE75701.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449444554|ref|XP_004140039.1| PREDICTED: early nodulin-like protein 1-like [Cucumis sativus] gi|449518202|ref|XP_004166132.1| PREDICTED: early nodulin-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|51968674|dbj|BAD43029.1| predicted GPI-anchored protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15238868|ref|NP_200198.1| early nodulin-like protein 1 [Arabidopsis thaliana] gi|10177249|dbj|BAB10717.1| unnamed protein product [Arabidopsis thaliana] gi|109946411|gb|ABG48384.1| At5g53870 [Arabidopsis thaliana] gi|332009038|gb|AED96421.1| early nodulin-like protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255574684|ref|XP_002528251.1| copper ion binding protein, putative [Ricinus communis] gi|223532337|gb|EEF34136.1| copper ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224114912|ref|XP_002316891.1| predicted protein [Populus trichocarpa] gi|222859956|gb|EEE97503.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|28396618|emb|CAD66637.1| phytocyanin protein, PUP2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356546868|ref|XP_003541844.1| PREDICTED: uncharacterized protein LOC100809181, partial [Glycine max] Back     alignment and taxonomy information
>gi|225446398|ref|XP_002275206.1| PREDICTED: early nodulin-like protein 2 [Vitis vinifera] gi|302143308|emb|CBI21869.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query273
TAIR|locus:2154679 370 ENODL1 "early nodulin-like pro 0.454 0.335 0.603 2.7e-36
TAIR|locus:505006529199 ENODL3 "early nodulin-like pro 0.439 0.603 0.576 2.3e-32
TAIR|locus:2137672 349 ENODL2 "early nodulin-like pro 0.472 0.369 0.515 2.6e-31
TAIR|locus:2127861221 ENODL4 "early nodulin-like pro 0.446 0.552 0.508 1.1e-30
UNIPROTKB|Q5JNJ5237 ENODL1 "Early nodulin-like pro 0.479 0.552 0.496 4.4e-29
TAIR|locus:2085775203 ENODL9 "early nodulin-like pro 0.465 0.625 0.453 1.9e-26
TAIR|locus:2040164182 ENODL14 "early nodulin-like pr 0.417 0.626 0.456 1.2e-24
TAIR|locus:2116767177 ENODL15 "early nodulin-like pr 0.450 0.694 0.424 1.2e-24
TAIR|locus:2179240186 ENODL13 "early nodulin-like pr 0.461 0.677 0.427 2.6e-24
TAIR|locus:2118691190 ENODL12 "early nodulin-like pr 0.369 0.531 0.504 1e-22
TAIR|locus:2154679 ENODL1 "early nodulin-like protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 391 (142.7 bits), Expect = 2.7e-36, P = 2.7e-36
 Identities = 76/126 (60%), Positives = 92/126 (73%)

Query:    49 CF-FVILWMGTFIISSCEAYKFNVGGKNGLWVVKPYENYNHWAERMRFQVNDSLYFKYKK 107
             CF F+IL       S  +A++FNVGG NG WV  P ENYN WAER RFQVNDSLYFKY K
Sbjct:     9 CFSFLILASFATFFSVADAWRFNVGG-NGAWVTNPQENYNTWAERNRFQVNDSLYFKYAK 67

Query:   108 GSDSVLVVTKDDYFSCNNKKPVQSLTDGESVFSFDHSGPYFFISGNADNCNKGQKLIVVV 167
             GSDSV  V K D+  CN + P+++  +GESV + D SG ++FISGN D+C KGQKLIVVV
Sbjct:    68 GSDSVQQVMKADFDGCNVRNPIKNFENGESVVTLDRSGAFYFISGNQDHCQKGQKLIVVV 127

Query:   168 MAVRNK 173
             +AVRN+
Sbjct:   128 LAVRNQ 133
GO:0005507 "copper ion binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0031225 "anchored to membrane" evidence=TAS
TAIR|locus:505006529 ENODL3 "early nodulin-like protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137672 ENODL2 "early nodulin-like protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127861 ENODL4 "early nodulin-like protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5JNJ5 ENODL1 "Early nodulin-like protein 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2085775 ENODL9 "early nodulin-like protein 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040164 ENODL14 "early nodulin-like protein 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116767 ENODL15 "early nodulin-like protein 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179240 ENODL13 "early nodulin-like protein 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118691 ENODL12 "early nodulin-like protein 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query273
pfam0229884 pfam02298, Cu_bind_like, Plastocyanin-like domain 4e-22
PLN03148167 PLN03148, PLN03148, Blue copper-like protein; Prov 8e-11
TIGR00601 378 TIGR00601, rad23, UV excision repair protein Rad23 1e-07
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-06
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 6e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-05
pfam07174 297 pfam07174, FAP, Fibronectin-attachment protein (FA 3e-05
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 7e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 9e-05
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 1e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-04
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 1e-04
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 1e-04
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 2e-04
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-04
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 3e-04
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 3e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-04
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 4e-04
pfam07174 297 pfam07174, FAP, Fibronectin-attachment protein (FA 4e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-04
pfam04652315 pfam04652, DUF605, Vta1 like 4e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 5e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 5e-04
pfam04652315 pfam04652, DUF605, Vta1 like 5e-04
TIGR01348 546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase 5e-04
pfam03276 582 pfam03276, Gag_spuma, Spumavirus gag protein 5e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 6e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 7e-04
PRK00404141 PRK00404, tatB, sec-independent translocase; Provi 7e-04
PRK14954 620 PRK14954, PRK14954, DNA polymerase III subunits ga 9e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.001
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.001
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.001
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.001
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.001
PRK09111 598 PRK09111, PRK09111, DNA polymerase III subunits ga 0.001
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.002
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.002
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.002
pfam12526115 pfam12526, DUF3729, Protein of unknown function (D 0.002
PLN02983274 PLN02983, PLN02983, biotin carboxyl carrier protei 0.002
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.003
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.003
COG5373 931 COG5373, COG5373, Predicted membrane protein [Func 0.003
PRK14971 614 PRK14971, PRK14971, DNA polymerase III subunits ga 0.003
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.004
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.004
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.004
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.004
PHA03369 663 PHA03369, PHA03369, capsid maturational protease; 0.004
PRK03427 333 PRK03427, PRK03427, cell division protein ZipA; Pr 0.004
>gnl|CDD|216965 pfam02298, Cu_bind_like, Plastocyanin-like domain Back     alignment and domain information 
 Score = 87.4 bits (217), Expect = 4e-22
 Identities = 33/84 (39%), Positives = 45/84 (53%)

Query: 78  WVVKPYENYNHWAERMRFQVNDSLYFKYKKGSDSVLVVTKDDYFSCNNKKPVQSLTDGES 137
           W V    +Y  WA    F+V D+L F Y KG  +V+ VTK DY SCN  KP+++ T G  
Sbjct: 1   WTVPLNADYTLWASGKTFRVGDTLVFNYDKGFHNVVEVTKADYESCNTSKPIRTYTTGND 60

Query: 138 VFSFDHSGPYFFISGNADNCNKGQ 161
           +      G ++FI G   +C  GQ
Sbjct: 61  IIPLTKPGQHYFICGVPGHCKGGQ 84

This family represents a domain found in flowering plants related to the copper binding protein plastocyanin. Some members of this family may not bind copper due to the lack of key residues. Length = 84
>gnl|CDD|178693 PLN03148, PLN03148, Blue copper-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) Back     alignment and domain information
>gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223061 PHA03369, PHA03369, capsid maturational protease; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 273
PLN03148167 Blue copper-like protein; Provisional 100.0
PF0229885 Cu_bind_like: Plastocyanin-like domain; InterPro: 99.96
PRK02710119 plastocyanin; Provisional 98.92
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 98.65
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 98.62
COG3794128 PetE Plastocyanin [Energy production and conversio 98.48
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 98.46
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 98.14
TIGR0265783 amicyanin amicyanin. Members of this family are am 97.54
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 97.07
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 96.7
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 96.48
COG4454158 Uncharacterized copper-binding protein [Inorganic 95.1
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 95.09
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 93.68
TIGR02695125 azurin azurin. Azurin is a blue copper-binding pro 93.51
PF00812145 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a 93.07
KOG3858233 consensus Ephrin, ligand for Eph receptor tyrosine 91.76
PRK10378 375 inactive ferrous ion transporter periplasmic prote 91.76
PLN02604 566 oxidoreductase 90.44
TIGR02376311 Cu_nitrite_red nitrite reductase, copper-containin 87.96
PRK02888635 nitrous-oxide reductase; Validated 86.76
PLN02354 552 copper ion binding / oxidoreductase 84.94
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 83.8
PLN02835 539 oxidoreductase 83.46
KOG3671 569 consensus Actin regulatory protein (Wiskott-Aldric 80.07
>PLN03148 Blue copper-like protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=5.2e-41  Score=291.32  Aligned_cols=106  Identities=29%  Similarity=0.584  Sum_probs=99.7

Q ss_pred             HhhhcccceEEEEcCCCCccccCCCCCchhhccCCeEEeCCEEEEEeeCCCCeEEEEcccCCCccCCCCCCcccCCCCeE
Q 047972           59 FIISSCEAYKFNVGGKNGLWVVKPYENYNHWAERMRFQVNDSLYFKYKKGSDSVLVVTKDDYFSCNNKKPVQSLTDGESV  138 (273)
Q Consensus        59 ll~~~A~A~~y~VGg~~G~W~~~P~~~Yt~WAs~ktF~VGDtLvF~y~~~~HsVvqVtk~dYd~C~~s~pi~~~ssG~t~  138 (273)
                      ++...++|++|+|||+.| |+.  +.||++|+++|+|+|||+|+|+|++++|||+||+|++|++|+.++++..|++|++.
T Consensus        13 ~~~~~~~a~~~~VGd~~G-W~~--~~~Y~~WA~~k~F~VGD~LvF~Y~~~~hnV~~V~~~~Y~~C~~~~pi~~~tsG~d~   89 (167)
T PLN03148         13 FSASATTATDHIVGANKG-WNP--GINYTLWANNQTFYVGDLISFRYQKTQYNVFEVNQTGYDNCTTEGAAGNWTSGKDF   89 (167)
T ss_pred             HhhhhccceEEEeCCCCC-cCC--CCChhHhhcCCCCccCCEEEEEecCCCceEEEEChHHcCcccCCCCcceecCCCcE
Confidence            344577899999999999 984  47899999999999999999999999999999999999999999999999999999


Q ss_pred             EEecCcccEEEEeCCCCCCCCCCeEEEEEe
Q 047972          139 FSFDHSGPYFFISGNADNCNKGQKLIVVVM  168 (273)
Q Consensus       139 V~L~~pG~~YFICgv~gHC~~GMKlaI~V~  168 (273)
                      |+|+++|+|||||+ .+||++||||.|+|.
T Consensus        90 v~L~~~G~~YFIcg-~ghC~~GmKl~I~V~  118 (167)
T PLN03148         90 IPLNKAKRYYFICG-NGQCFNGMKVTILVH  118 (167)
T ss_pred             EEecCCccEEEEcC-CCccccCCEEEEEEc
Confidence            99999999999999 599999999999995

>PF02298 Cu_bind_like: Plastocyanin-like domain; InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>TIGR02695 azurin azurin Back     alignment and domain information
>PF00812 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO) Back     alignment and domain information
>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10378 inactive ferrous ion transporter periplasmic protein EfeO; Provisional Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PLN02835 oxidoreductase Back     alignment and domain information
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query273
1ws7_A109 Crystal Structure Of Mavicyanin From Cucurbita Pepo 8e-10
1x9r_A116 Umecyanin From Horse Raddish- Crystal Structure Of 3e-08
1jer_A138 Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 7e-04
>pdb|1WS7|A Chain A, Crystal Structure Of Mavicyanin From Cucurbita Pepo Medullosa (Zucchini) Length = 109 Back     alignment and structure 
Iteration: 1

 Score = 60.8 bits (146), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 47/97 (48%), Gaps = 1/97 (1%)
Query: 71  VGGKNGLWVVKPYENYNHWAERMRFQVNDSLYFKYKKGSDSVLVVTKDDYFSCNNKKPVQ 130
           VG   G   + PY+ Y  WA   +F V DSL F Y     +VL V ++ + SCN+  P  
Sbjct: 7   VGDSTGWTTLVPYD-YAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSSSPAA 65
Query: 131 SLTDGESVFSFDHSGPYFFISGNADNCNKGQKLIVVV 167
           S T G         G ++F+ G   +C  GQK+ + V
Sbjct: 66  SYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKV 102
>pdb|1X9R|A Chain A, Umecyanin From Horse Raddish- Crystal Structure Of The Oxidised Form Length = 116 Back     alignment and structure
>pdb|1JER|A Chain A, Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query273
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 1e-37
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 1e-34
1jer_A138 Cucumber stellacyanin; electron transport, copper, 1e-32
2cbp_A96 Cucumber basic protein; electron transport, phytoc 2e-32
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 2e-29
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 9e-07
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 5e-05
1twf_A 1733 B220, DNA-directed RNA polymerase II largest subun 6e-04
3a58_A320 Exocyst complex component SEC3; protein complex, P 3e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 6e-04
2es4_D 332 Lipase chaperone; protein-protein complex, steric 7e-04
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Length = 109 Back     alignment and structure
 Score =  127 bits (321), Expect = 1e-37
 Identities = 33/104 (31%), Positives = 46/104 (44%), Gaps = 1/104 (0%)

Query: 66  AYKFNVGGKNGLWVVKPYENYNHWAERMRFQVNDSLYFKYKKGSDSVLVVTKDDYFSCNN 125
           A    VG   G W      +Y  WA   +F V DSL F Y     +VL V ++ + SCN+
Sbjct: 2   ATVHKVGDSTG-WTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNS 60

Query: 126 KKPVQSLTDGESVFSFDHSGPYFFISGNADNCNKGQKLIVVVMA 169
             P  S T G         G ++F+ G   +C  GQK+ + V  
Sbjct: 61  SSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKVDP 104
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Length = 116 Back     alignment and structure
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Length = 96 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Length = 91 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>2es4_D Lipase chaperone; protein-protein complex, steric chaperone, triacylglycerol hydrolase, all alpha helix protein, A/B hydrolase fold; 1.85A {Burkholderia glumae} SCOP: a.137.15.1 Length = 332 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query273
1jer_A138 Cucumber stellacyanin; electron transport, copper, 100.0
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 100.0
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 100.0
2cbp_A96 Cucumber basic protein; electron transport, phytoc 100.0
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 99.98
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 99.33
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 99.27
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 99.11
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 99.08
2cal_A154 Rusticyanin; iron respiratory electron transport c 99.06
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 99.02
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 99.0
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.99
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.98
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.97
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 98.96
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.93
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 98.93
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 98.91
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 98.86
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 98.82
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.81
3c75_A132 Amicyanin; copper proteins, electron transfer comp 98.53
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 98.38
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 98.31
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 98.31
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 98.29
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 98.19
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 98.19
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 98.17
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 98.05
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 97.96
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 97.94
1iko_P178 Ephrin-B2; greek KEY, glycosylation, signaling pro 97.31
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 97.23
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 97.05
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 96.87
2x11_B177 Ephrin-A5; receptor-signaling protein complex, dev 96.83
2vsm_B140 Ephrin-B2; developmental protein, henipavirus, neu 96.0
3czu_B182 Ephrin-A1; ATP-binding, kinase, nucleotide-binding 95.98
3d12_B141 Ephrin-B3; beta propeller, protein-receptor comple 95.76
1shx_A138 Ephrin-A5; ephrin signaling, hormone-growth factor 95.55
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 95.05
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 94.29
2wo3_B157 Ephrin-A2; transferase-signaling protein complex, 94.19
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 93.44
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 93.3
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 85.58
3hei_B132 Ephrin-A1; EPH receptor tyrosine kinase, cell memb 84.53
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 83.49
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 82.07
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
Probab=100.00  E-value=1.2e-41  Score=285.74  Aligned_cols=107  Identities=28%  Similarity=0.512  Sum_probs=101.0

Q ss_pred             cceEEEEcCCCCccccCCC-CCchhhccCCeEEeCCEEEEEeeCCCCeEEEE-cccCCCccCCCCCCcccCCCCeEEEe-
Q 047972           65 EAYKFNVGGKNGLWVVKPY-ENYNHWAERMRFQVNDSLYFKYKKGSDSVLVV-TKDDYFSCNNKKPVQSLTDGESVFSF-  141 (273)
Q Consensus        65 ~A~~y~VGg~~G~W~~~P~-~~Yt~WAs~ktF~VGDtLvF~y~~~~HsVvqV-tk~dYd~C~~s~pi~~~ssG~t~V~L-  141 (273)
                      +|++|+|||++| |+++++ .+|++||++|+|+|||+|+|+|++++|+|+|| +|++|+.|+.++++..+++|+++|+| 
T Consensus         2 ~a~~~~VGg~~G-W~~~~~~~~Y~~Wa~~~~F~vGD~LvF~y~~~~HsV~~V~~~~~y~~C~~s~p~~~~~~G~~~v~L~   80 (138)
T 1jer_A            2 QSTVHIVGDNTG-WSVPSSPNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDACNFVNSDNDVERTSPVIERL   80 (138)
T ss_dssp             CCCEEETTGGGC-SSCCSSTTHHHHHHHTCCEETTCEEEECCCTTTCCCEEESCHHHHHHTCCTTSCCCCCCCSCEEEEC
T ss_pred             CceEEEECCcCc-CcCCCCccchhhhhcCCcCcCCCEEEEeecCCCceEEEeCchhhcCccCCCCccccccCCCeEEEec
Confidence            578999999999 998754 68999999999999999999999999999999 99999999999999999999999999 


Q ss_pred             cCcccEEEEeCCCCCCCCCCeEEEEEeecCC
Q 047972          142 DHSGPYFFISGNADNCNKGQKLIVVVMAVRN  172 (273)
Q Consensus       142 ~~pG~~YFICgv~gHC~~GMKlaI~V~a~~~  172 (273)
                      +++|++||||++++||++||||+|+|.+.+.
T Consensus        81 ~~~G~~YFicg~~gHC~~GmKl~I~V~~~~~  111 (138)
T 1jer_A           81 DELGMHYFVCTVGTHCSNGQKLSINVVAANA  111 (138)
T ss_dssp             CSSEEEEEECCSTTTGGGTCEEEEEEECCC-
T ss_pred             cCCcCEEEEcCCCCccccCCEEEEEEcCCCC
Confidence            9999999999999999999999999997653
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>1iko_P Ephrin-B2; greek KEY, glycosylation, signaling protein; HET: NAG MAN; 1.92A {Mus musculus} SCOP: b.6.1.5 Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>2x11_B Ephrin-A5; receptor-signaling protein complex, developmental protein, signaling platform, kinase, transferase, neurogenesis, receptor, cataract; 4.83A {Homo sapiens} Back     alignment and structure
>2vsm_B Ephrin-B2; developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion; HET: NAG; 1.80A {Homo sapiens} PDB: 2wo2_B* 2i85_A 3gxu_B 2vsk_B 2hle_B 1kgy_E Back     alignment and structure
>3czu_B Ephrin-A1; ATP-binding, kinase, nucleotide-binding, receptor, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG MAN; 2.65A {Homo sapiens} PDB: 3mbw_B* Back     alignment and structure
>3d12_B Ephrin-B3; beta propeller, protein-receptor complex, envelope protein, glycoprotein, hemagglutinin, hydrolase, membrane, signal-AN transmembrane; HET: NAG BMA MAN BGC LXZ NGA GL0 GLC LXB NGZ GXL; 3.00A {Mus musculus} Back     alignment and structure
>1shx_A Ephrin-A5; ephrin signaling, hormone-growth factor complex; HET: NAG; 2.10A {Mus musculus} SCOP: b.6.1.5 PDB: 1shw_A* 3mx0_B* Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>2wo3_B Ephrin-A2; transferase-signaling protein complex, EFN, EPHA4, KINA ephrin, complex, membrane, cell surface receptor, tyrosine- kinase, glycoprotein; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>3hei_B Ephrin-A1; EPH receptor tyrosine kinase, cell membrane, disulfi glycoprotein, GPI-anchor, lipoprotein, membrane, ATP-bindin kinase; 2.00A {Homo sapiens} SCOP: b.6.1.0 Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 273
d2cbpa_96 b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativ 5e-33
d1ws8a_104 b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) 2e-31
d1jera_110 b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativ 1e-26
d1f56a_91 b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia olera 5e-25
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 96 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Plantacyanin
species: Cucumber (Cucumis sativus) [TaxId: 3659]

 Score =  114 bits (286), Expect = 5e-33
 Identities = 27/100 (27%), Positives = 40/100 (40%), Gaps = 6/100 (6%)

Query: 69  FNVGGKNGLWVVKPYENYNHWAERMRFQVNDSLYFKYKKGSDSVLVVTKDDYFSCNNKKP 128
           + VGG  G W      N   W +  RF+  D L F Y     +V+VV +  + +CN    
Sbjct: 3   YVVGGSGG-WTF----NTESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCNTPAG 57

Query: 129 VQSLTDGESVFSFDHSGPYFFISGNADNCNKGQKLIVVVM 168
            +  T G         G  +FI     +C  G K+ V  +
Sbjct: 58  AKVYTSGRDQIKLP-KGQSYFICNFPGHCQSGMKIAVNAL 96
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Length = 104 Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 110 Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 91 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query273
d1ws8a_104 Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663 100.0
d2cbpa_96 Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1jera_110 Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1f56a_91 Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 99.97
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 99.18
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 99.14
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 99.08
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 99.06
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 99.02
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 98.99
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 98.98
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 98.9
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 98.86
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 98.82
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.79
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.73
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 98.66
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 98.6
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.59
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 98.3
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 98.07
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 97.87
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 97.81
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 97.32
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 97.16
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 96.94
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 96.86
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 96.44
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 96.05
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 96.03
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 95.88
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 95.37
d1shxa1138 Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} 95.24
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 93.87
d1ikop_141 Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 92.43
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 92.3
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 91.41
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 91.02
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 89.29
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 88.07
d1kv7a1140 multi-copper oxidase CueO {Escherichia coli [TaxId 83.52
d1yela1102 At1g16640 {Thale cress (Arabidopsis thaliana) [Tax 82.66
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 80.65
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Mavicyanin
species: Zucchini (Cucurbita pepo) [TaxId: 3663]

Probab=100.00  E-value=3.3e-38  Score=250.56  Aligned_cols=103  Identities=32%  Similarity=0.642  Sum_probs=99.3

Q ss_pred             cceEEEEcCCCCccccCCCCCchhhccCCeEEeCCEEEEEeeCCCCeEEEEcccCCCccCCCCCCcccCCCCeEEEecCc
Q 047972           65 EAYKFNVGGKNGLWVVKPYENYNHWAERMRFQVNDSLYFKYKKGSDSVLVVTKDDYFSCNNKKPVQSLTDGESVFSFDHS  144 (273)
Q Consensus        65 ~A~~y~VGg~~G~W~~~P~~~Yt~WAs~ktF~VGDtLvF~y~~~~HsVvqVtk~dYd~C~~s~pi~~~ssG~t~V~L~~p  144 (273)
                      .|++|+|||++| |+.+++.+|++|+++++|+|||+|+|+|+++.|+|+||++++|+.|+..+++..+++|++.|+|+++
T Consensus         1 ~at~~~VGg~~g-W~~~~~~~Y~~Wa~~~~f~vGD~l~F~y~~~~h~V~~v~~~~y~~C~~~~~~~~~~~G~~~v~l~~~   79 (104)
T d1ws8a_           1 MATVHKVGDSTG-WTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSSSPAASYTSGADSIPLKRP   79 (104)
T ss_dssp             CCCEEETTGGGC-SCSSSCCCHHHHHHTSCBCTTCEEEEECCTTTCCEEEECHHHHHHTCCSSCSEEECSSEEEEECCSS
T ss_pred             CCcEEEeCCcCc-cCcCCCcCHHHHhhCCcCCCCCEEEEEECCCCceEEEECHHHhcCCcCCCccccccCCCeEEEEecC
Confidence            478999999999 9987778999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccEEEEeCCCCCCCCCCeEEEEEe
Q 047972          145 GPYFFISGNADNCNKGQKLIVVVM  168 (273)
Q Consensus       145 G~~YFICgv~gHC~~GMKlaI~V~  168 (273)
                      |+|||||++++||++||||.|+|+
T Consensus        80 g~~yF~C~~~~HC~~Gmkl~I~V~  103 (104)
T d1ws8a_          80 GTFYFLCGIPGHCQLGQKVEIKVD  103 (104)
T ss_dssp             EEEEEECCSTTTTTTTCEEEEEEC
T ss_pred             ccEEEECCCcchhhCCCEEEEEEC
Confidence            999999999999999999999996
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1shxa1 b.6.1.5 (A:32-170) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yela1 b.142.1.2 (A:1-102) At1g16640 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure