Citrus Sinensis ID: 048020

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300----
MGPTQDRSEIVFFDVETTFPIRHIWEFGAILVCPRKLEELDKYTTLVRPADPSLVSNLCARRNDITPEDVFSAPTFADIADTVFDILQAPKPKGTIDSLNLLTERFGRRAGDMKMASLATYFGLGQQTHRSLDDVLMNLEVLKYCATVLLLESSLPDIFTGNGCVSQNATARSRINVRSSPEGTSQNLSAPSSKFKFENASNVSPPDQGKEGIHPIFTLVTQGTGELDSVLAVTTADQPNPFDMSQLSNQMETQSLQPDDTMEDKSAPESREMCSTASVSEGSSGYAGFMEPDEVSITSISAAV
cccccccccEEEEEEccccccccEEEEEEEEEEccccEEEEEEEccccccccccccccccccccccHHHHcccccHHHHHHHHHHHHcccccccccccHHHHHHHHccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccHHHccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcc
ccccccccEEEEEEEEccccccHEEEEEEEEEccccEEEEcccEEEEcccccccccHHHHccccccHHHHHccccHHHHHHHHHHHHccccccccEccHHHHHHHHccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccEEEEEcccccccccccHHHHHHccccccccccccHHcccccccccccccccccccccccccccccccEEEcEEEEEc
mgptqdrseivffdvettfpirhiwefgailvcprkleeldkyttlvrpadpslvsnlcarrnditpedvfsaptfadIADTVFDilqapkpkgtidSLNLLTERFGRRAGDMKMASLATYFGLGQQTHRSLDDVLMNLEVLKYCATVLLLesslpdiftgngcvsqnatarsrinvrsspegtsqnlsapsskfkfenasnvsppdqgkegihpiftlvtqgtgeldSVLAVttadqpnpfdmsqlsnqmetqslqpddtmedksapesremcstasvsegssgyagfmepdevSITSISAAV
mgptqdrseiVFFDVETTFPIRHIWEFGAILVCPRKLEELDKYTTlvrpadpslvsnLCARRNDITPEDVFSAPTFADIADTVFDILQapkpkgtidslNLLTERFGRRAGDMKMASLATYFGLGQQTHRSLDDVLMNLEVLKYCATVLLLESSLPDIFTGNGCVSQNATARSRInvrsspegtsqnlsapsskfkfENASNvsppdqgkeGIHPIFTLVTQGTGELDSVLAVTTADQPNPFDMSQLSNQMETQSLQPDDTMEDKSAPESREMCSTASVSEGSSGYAGFMEPDEVSITSISAAV
MGPTQDRSEIVFFDVETTFPIRHIWEFGAILVCPRKLEELDKYTTLVRPADPSLVSNLCARRNDITPEDVFSAPTFADIADTVFDILQAPKPKGTIDSLNLLTERFGRRAGDMKMASLATYFGLGQQTHRSLDDVLMNLEVLKYCATVLLLESSLPDIFTGNGCVSQNATARSRINVRSSPEGTSQNLSAPSSKFKFENASNVSPPDQGKEGIHPIFTLVTQGTGELDSVLAVTTADQPNPFDMSQLSNQMETQSLQPDDTMEDKSAPESREMCSTASVSEGSSGYAGFMEPDEVSITSISAAV
*********IVFFDVETTFPIRHIWEFGAILVCPRKLEELDKYTTLVRPADPSLVSNLCARRNDITPEDVFSAPTFADIADTVFDILQAPKPKGTIDSLNLLTERFGRRAGDMKMASLATYFGLGQQTHRSLDDVLMNLEVLKYCATVLLLESSLPDIFTGNGCVS**********************************************IHPIFTLVTQGTGELDSVLAV***********************************************************************
*****DRSEIVFFDVETTFPIRHIWEFGAILVCPRKLEELDKYTTLVRPADPSLVSNLCARRNDITPEDVFSAPTFADIADTVFDILQAPKPKGTIDSLNLLTERFGRRAGDMKMASLATYFGLGQQTHRSLDDVLMNLEVLKYCATVLLLESSLPDIFT*****************************************************************************************************************************YAGFMEPDEVSITSISAAV
MGPTQDRSEIVFFDVETTFPIRHIWEFGAILVCPRKLEELDKYTTLVRPADPSLVSNLCARRNDITPEDVFSAPTFADIADTVFDILQAPKPKGTIDSLNLLTERFGRRAGDMKMASLATYFGLGQQTHRSLDDVLMNLEVLKYCATVLLLESSLPDIFTGNGCVSQNATARSRIN***************SSKFKFE**********GKEGIHPIFTLVTQGTGELDSVLAVTTADQPNPFDMSQLSNQ*********************************SGYAGFMEPDEVSITSISAAV
*****DRSEIVFFDVETTFPIRHIWEFGAILVCPRKLEELDKYTTLVRPADPSLVSNLCARRNDITPEDVFSAPTFADIADTVFDILQAPKPKGTIDSLNLLTERFGRRAGDMKMASLATYFGLGQQTHRSLDDVLMNLEVLKYCATVLLLESSLPDIFTG**************************************************GIHPIFTLVTQGTGELDSVLAVTTADQPNPFDMSQLSNQ************************************AGFMEPDEVSITSISAAV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGPTQDRSEIVFFDVETTFPIRHIWEFGAILVCPRKLEELDKYTTLVRPADPSLVSNLCARRNDITPEDVFSAPTFADIADTVFDILQAPKPKGTIDSLNLLTERFGRRAGDMKMASLATYFGLGQQTHRSLDDVLMNLEVLKYCATVLLLESSLPDIFTGNGCVSQNATARSRINVRSSPEGTSQNLSAPSSKFKFENASNVSPPDQGKEGIHPIFTLVTQGTGELDSVLAVTTADQPNPFDMSQLSNQMETQSLQPDDTMEDKSAPESREMCSTASVSEGSSGYAGFMEPDEVSITSISAAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query304
225457353 497 PREDICTED: uncharacterized protein LOC10 0.950 0.581 0.543 2e-86
147817752 535 hypothetical protein VITISV_031720 [Viti 0.950 0.540 0.540 6e-86
255547339 501 exonuclease, putative [Ricinus communis] 0.953 0.578 0.550 3e-81
297733948 447 unnamed protein product [Vitis vinifera] 0.878 0.597 0.518 9e-77
356562862 501 PREDICTED: uncharacterized protein LOC10 0.960 0.582 0.469 9e-68
356512002 501 PREDICTED: uncharacterized protein LOC10 0.960 0.582 0.469 8e-67
224124082 470 predicted protein [Populus trichocarpa] 0.855 0.553 0.469 3e-66
42568689 487 exonuclease-like protein [Arabidopsis th 0.881 0.550 0.452 2e-64
297797093 484 exonuclease family protein [Arabidopsis 0.868 0.545 0.457 4e-64
449440810 471 PREDICTED: uncharacterized protein LOC10 0.858 0.554 0.464 5e-63
>gi|225457353|ref|XP_002281793.1| PREDICTED: uncharacterized protein LOC100265514 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  325 bits (832), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 216/335 (64%), Gaps = 46/335 (13%)

Query: 1   MGPTQDRSEIVFFDVETTFPIR-----HIWEFGAILVCPRKLEELDKYTTLVRPADPSLV 55
           MGP ++RSEI FFDVETT P R      I EFGAILVCPRKL EL+ Y+TLVRP D SLV
Sbjct: 1   MGPGEERSEIAFFDVETTVPTRVGQGFAILEFGAILVCPRKLVELESYSTLVRPHDLSLV 60

Query: 56  SNLCARRNDITPEDVFSAPTFADIADTVFDILQ--------------------------- 88
           S+L  R N IT + V SAP F DIAD V+DIL                            
Sbjct: 61  SSLSVRCNGITRDAVVSAPNFRDIADRVYDILHGRIWAGHNILRFDCARIREAFAEIGRP 120

Query: 89  APKPKGTIDSLNLLTERFGRRAGDMKMASLATYFGLGQQTHRSLDDVLMNLEVLKYCATV 148
           AP+PKG+IDSL LLT+RFGRRAGDMKMA+LATYFGLGQQTHRSLDDV MNLEVLKYCATV
Sbjct: 121 APEPKGSIDSLALLTQRFGRRAGDMKMATLATYFGLGQQTHRSLDDVRMNLEVLKYCATV 180

Query: 149 LLLESSLPDIFTGNGCVSQNATARSRINVRSSPEGTSQNLSAPSSKFKFENASNVSPPDQ 208
           L LESSLPDIFT N  VS NA  RSR N ++SP G + N+S PSS  KFEN  +      
Sbjct: 181 LFLESSLPDIFTTNSWVSPNAVTRSRSNGKASPVGMNLNMSTPSSSIKFEN--HSISSPS 238

Query: 209 GKEGIHPIFTLVTQGTGELDSVLAVTTADQPNPFDMSQLSNQMETQSLQPDDTMEDKSAP 268
               +  I  LV   T            +QP+PF++  LS+++E +SL+PD  +E+K   
Sbjct: 239 THSSMEGILNLVEPNT------------NQPDPFNLGALSSEIERESLKPDYALEEKPVT 286

Query: 269 ESREMCSTASVSEGSSGYAGFMEPDEVSITSISAA 303
           ES EM ST + S+    YAGF++P EVS+ SISA+
Sbjct: 287 ESLEMLSTTTASQDCCDYAGFLDPAEVSVASISAS 321

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147817752|emb|CAN66660.1| hypothetical protein VITISV_031720 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255547339|ref|XP_002514727.1| exonuclease, putative [Ricinus communis] gi|223546331|gb|EEF47833.1| exonuclease, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297733948|emb|CBI15195.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356562862|ref|XP_003549687.1| PREDICTED: uncharacterized protein LOC100818863 [Glycine max] Back     alignment and taxonomy information
>gi|356512002|ref|XP_003524710.1| PREDICTED: uncharacterized protein LOC100788659 [Glycine max] Back     alignment and taxonomy information
>gi|224124082|ref|XP_002330100.1| predicted protein [Populus trichocarpa] gi|222871234|gb|EEF08365.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|42568689|ref|NP_200947.3| exonuclease-like protein [Arabidopsis thaliana] gi|111074224|gb|ABH04485.1| At5g61390 [Arabidopsis thaliana] gi|332010078|gb|AED97461.1| exonuclease-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297797093|ref|XP_002866431.1| exonuclease family protein [Arabidopsis lyrata subsp. lyrata] gi|297312266|gb|EFH42690.1| exonuclease family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449440810|ref|XP_004138177.1| PREDICTED: uncharacterized protein LOC101203629 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query304
TAIR|locus:2019100 506 AT1G74390 [Arabidopsis thalian 0.684 0.411 0.435 3.3e-59
TAIR|locus:2163208 487 AT5G61390 [Arabidopsis thalian 0.578 0.361 0.418 1.2e-53
TAIR|locus:2135302255 AT4G39810 [Arabidopsis thalian 0.414 0.494 0.5 2e-45
TAIR|locus:2160359 468 AT5G07710 [Arabidopsis thalian 0.914 0.594 0.372 1e-29
TAIR|locus:2019100 AT1G74390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 385 (140.6 bits), Expect = 3.3e-59, Sum P(2) = 3.3e-59
 Identities = 95/218 (43%), Positives = 134/218 (61%)

Query:    87 LQAPKPKGTIDSLNLLTERFGRRAGDMKMASLATYFGLGQQTHRSLDDVLMNLEVLKYCA 146
             L  P+PK TIDSL+LL+++FG+RAGDMKMASLATYFGLG Q HRSLDDV MNLEV+KYCA
Sbjct:   122 LSPPEPKATIDSLSLLSQKFGKRAGDMKMASLATYFGLGDQAHRSLDDVRMNLEVVKYCA 181

Query:   147 TVLLLESSLPDIFTGNGCVSQNATARSRINVRSSPEGTSQNLSAPSSKFKFENASNVSPP 206
             TVL LESS+PDI T     S   + R+R N +    G  ++ ++ SS  K + +S  S  
Sbjct:   182 TVLFLESSVPDILTDMSWFSPRKSPRTRSNGKLVANGVRESSTSSSSSPKTDPSS--SSV 239

Query:   207 DQGKEGIHPIFTLVTQGTGELDSVLAVTTADQPNPFDMSQLSNQMETQSLQPDDTMEDKS 266
             D      HPI +L+T+   E D+    ++ D  +P D++ L  ++   +LQ D   E K+
Sbjct:   240 DATIVKNHPIVSLLTE-CSESDA----SSYDIEDPIDITTLIGKLRIGTLQTDAAEEAKT 294

Query:   267 APESREMCSTASVSEGSSGYAGFMEPDEVSITSISAAV 304
               +  E  S  S    +   + F+  +EVS++SI A++
Sbjct:   295 VRQQDE--SPPSPDSDAKDES-FLGVNEVSVSSIRASL 329
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004527 "exonuclease activity" evidence=IEA;ISS
GO:0005622 "intracellular" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
TAIR|locus:2163208 AT5G61390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135302 AT4G39810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160359 AT5G07710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00016302001
SubName- Full=Chromosome chr17 scaffold_12, whole genome shotgun sequence; (390 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query304
smart00479169 smart00479, EXOIII, exonuclease domain in DNA-poly 8e-18
cd06127159 cd06127, DEDDh, DEDDh 3'-5' exonuclease domain fam 2e-14
pfam00929161 pfam00929, RNase_T, Exonuclease 2e-12
COG0847243 COG0847, DnaQ, DNA polymerase III, epsilon subunit 1e-09
cd06133176 cd06133, ERI-1_3'hExo_like, DEDDh 3'-5' exonucleas 3e-08
PRK07883 557 PRK07883, PRK07883, hypothetical protein; Validate 8e-08
PRK06807313 PRK06807, PRK06807, DNA polymerase III subunit eps 7e-05
PRK08517257 PRK08517, PRK08517, DNA polymerase III subunit eps 7e-05
PRK08074 928 PRK08074, PRK08074, bifunctional ATP-dependent DNA 0.001
cd06130156 cd06130, DNA_pol_III_epsilon_like, an uncharacteri 0.001
>gnl|CDD|214685 smart00479, EXOIII, exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases Back     alignment and domain information 
 Score = 78.9 bits (195), Expect = 8e-18
 Identities = 38/170 (22%), Positives = 61/170 (35%), Gaps = 37/170 (21%)

Query: 9   EIVFFDVETTF--PIRH-IWEFGAILVCPRKLEELDKYTTLVRPADPSLVSNLCARRNDI 65
            +V  D ETT   P +  I E  A+ V     E ++ + T V+P  P  +++     + I
Sbjct: 1   TLVVIDCETTGLDPGKDEIIEIAAVDVDGG--EIIEVFDTYVKPDRP--ITDYATEIHGI 56

Query: 66  TPEDVFSAPTFADIADTVFDILQ---------------------------APKPKGTIDS 98
           TPE +  APTF ++ + + + L+                            P     ID+
Sbjct: 57  TPEMLDDAPTFEEVLEELLEFLRGRILVAGNSAHFDLRFLKLEHPRLGIKQPPKLPVIDT 116

Query: 99  LNLLTERFGRRAGDMKMASLATYFGLGQQ--THRSLDDVLMNLEVLKYCA 146
           L L             +  LA    L      HR+LDD     ++ K   
Sbjct: 117 LKLARATNPGL-PKYSLKKLAKRLLLEVIQRAHRALDDARATAKLFKKLL 165

Length = 169
>gnl|CDD|176648 cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family Back     alignment and domain information
>gnl|CDD|216200 pfam00929, RNase_T, Exonuclease Back     alignment and domain information
>gnl|CDD|223916 COG0847, DnaQ, DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|99836 cd06133, ERI-1_3'hExo_like, DEDDh 3'-5' exonuclease domain of Caenorhabditis elegans ERI-1, human 3' exonuclease, and similar proteins Back     alignment and domain information
>gnl|CDD|236123 PRK07883, PRK07883, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|235864 PRK06807, PRK06807, DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>gnl|CDD|236281 PRK08517, PRK08517, DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|236148 PRK08074, PRK08074, bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>gnl|CDD|99834 cd06130, DNA_pol_III_epsilon_like, an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 304
COG2176 1444 PolC DNA polymerase III, alpha subunit (gram-posit 100.0
TIGR01405 1213 polC_Gram_pos DNA polymerase III, alpha chain, Gra 100.0
PRK00448 1437 polC DNA polymerase III PolC; Validated 100.0
TIGR00573217 dnaq exonuclease, DNA polymerase III, epsilon subu 99.97
PRK07748207 sporulation inhibitor KapD; Provisional 99.96
PRK09146239 DNA polymerase III subunit epsilon; Validated 99.96
PRK07247195 DNA polymerase III subunit epsilon; Validated 99.96
PRK06807313 DNA polymerase III subunit epsilon; Validated 99.96
PRK07740244 hypothetical protein; Provisional 99.95
PRK06195309 DNA polymerase III subunit epsilon; Validated 99.95
cd06130156 DNA_pol_III_epsilon_like an uncharacterized bacter 99.95
PRK05711240 DNA polymerase III subunit epsilon; Provisional 99.95
TIGR01406225 dnaQ_proteo DNA polymerase III, epsilon subunit, P 99.95
smart00479169 EXOIII exonuclease domain in DNA-polymerase alpha 99.95
cd06133176 ERI-1_3'hExo_like DEDDh 3'-5' exonuclease domain o 99.95
cd06131167 DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonucl 99.95
PRK09145202 DNA polymerase III subunit epsilon; Validated 99.95
PRK08517257 DNA polymerase III subunit epsilon; Provisional 99.95
PRK07983219 exodeoxyribonuclease X; Provisional 99.95
PRK06722281 exonuclease; Provisional 99.95
PRK06310250 DNA polymerase III subunit epsilon; Validated 99.95
PRK06063313 DNA polymerase III subunit epsilon; Provisional 99.94
PRK06309232 DNA polymerase III subunit epsilon; Validated 99.94
PRK07942232 DNA polymerase III subunit epsilon; Provisional 99.94
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.94
PRK07883 557 hypothetical protein; Validated 99.93
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.93
cd06136177 TREX1_2 DEDDh 3'-5' exonuclease domain of three pr 99.93
PRK05168211 ribonuclease T; Provisional 99.93
TIGR01298200 RNaseT ribonuclease T. in gamma-subdivision Proteo 99.92
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 99.92
cd06134189 RNaseT DEDDh 3'-5' exonuclease domain of RNase T. 99.92
cd06137161 DEDDh_RNase DEDDh 3'-5' exonuclease domain of the 99.91
cd06138183 ExoI_N N-terminal DEDDh 3'-5' exonuclease domain o 99.91
PTZ00315 582 2'-phosphotransferase; Provisional 99.91
PRK05601377 DNA polymerase III subunit epsilon; Validated 99.91
cd06127159 DEDDh DEDDh 3'-5' exonuclease domain family. DEDDh 99.9
cd06144152 REX4_like DEDDh 3'-5' exonuclease domain of RNA ex 99.9
PRK09182294 DNA polymerase III subunit epsilon; Validated 99.9
cd06145150 REX1_like DEDDh 3'-5' exonuclease domain of RNA ex 99.9
cd06149157 ISG20 DEDDh 3'-5' exonuclease domain of Interferon 99.89
COG0847243 DnaQ DNA polymerase III, epsilon subunit and relat 99.89
PF00929164 RNase_T: Exonuclease; InterPro: IPR013520 This ent 99.88
PRK11779 476 sbcB exonuclease I; Provisional 99.87
cd06135173 Orn DEDDh 3'-5' exonuclease domain of oligoribonuc 99.87
PRK05359181 oligoribonuclease; Provisional 99.85
KOG0542280 consensus Predicted exonuclease [Replication, reco 99.79
COG5018210 KapD Inhibitor of the KinA pathway to sporulation, 99.7
KOG2249280 consensus 3'-5' exonuclease [Replication, recombin 99.24
COG2925 475 SbcB Exonuclease I [DNA replication, recombination 99.14
cd06143174 PAN2_exo DEDDh 3'-5' exonuclease domain of the euk 99.12
KOG3242208 consensus Oligoribonuclease (3'->5' exoribonucleas 98.8
COG1949184 Orn Oligoribonuclease (3'-5' exoribonuclease) [RNA 98.75
cd05160199 DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain 98.64
KOG2248380 consensus 3'-5' exonuclease [Replication, recombin 98.44
cd06139193 DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease 97.7
PRK05755 880 DNA polymerase I; Provisional 97.32
COG3359278 Predicted exonuclease [DNA replication, recombinat 97.02
PF13482164 RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A 96.9
PHA02570220 dexA exonuclease; Provisional 96.85
KOG4793318 consensus Three prime repair exonuclease [Replicat 96.7
cd0612596 DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonucleas 96.47
cd05780195 DNA_polB_Kod1_like_exo DEDDy 3'-5' exonuclease dom 96.32
PF04857262 CAF1: CAF1 family ribonuclease; InterPro: IPR00694 96.19
KOG0304239 consensus mRNA deadenylase subunit [RNA processing 96.15
cd05779204 DNA_polB_epsilon_exo DEDDy 3'-5' exonuclease domai 96.15
cd05781188 DNA_polB_B3_exo DEDDy 3'-5' exonuclease domain of 96.12
PF01612176 DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR00 95.7
cd05785207 DNA_polB_like2_exo Uncharacterized bacterial subgr 94.63
COG0349361 Rnd Ribonuclease D [Translation, ribosomal structu 94.46
TIGR03491457 RecB family nuclease, putative, TM0106 family. Mem 94.1
KOG12751118 consensus PAB-dependent poly(A) ribonuclease, subu 93.0
PF10108209 DNA_pol_B_exo2: Predicted 3'-5' exonuclease relate 92.93
cd05777230 DNA_polB_delta_exo DEDDy 3'-5' exonuclease domain 92.73
cd05778231 DNA_polB_zeta_exo inactive DEDDy 3'-5' exonuclease 91.68
cd06141170 WRN_exo DEDDy 3'-5' exonuclease domain of WRN and 88.51
cd05784193 DNA_polB_II_exo DEDDy 3'-5' exonuclease domain of 88.43
cd06129161 RNaseD_like DEDDy 3'-5' exonuclease domain of RNas 87.67
cd06146193 mut-7_like_exo DEDDy 3'-5' exonuclease domain of C 87.44
PTZ00166 1054 DNA polymerase delta catalytic subunit; Provisiona 87.12
PF13017213 Maelstrom: piRNA pathway germ-plasm component 86.93
PF03104325 DNA_pol_B_exo1: DNA polymerase family B, exonuclea 86.48
PRK06826 1151 dnaE DNA polymerase III DnaE; Reviewed 86.11
TIGR01388367 rnd ribonuclease D. This model describes ribonucle 85.07
PRK05673 1135 dnaE DNA polymerase III subunit alpha; Validated 84.68
cd00007155 35EXOc 3'-5' exonuclease. The 35EXOc domain is res 83.15
cd05783204 DNA_polB_B1_exo DEDDy 3'-5' exonuclease domain of 81.29
PRK10829373 ribonuclease D; Provisional 81.02
cd05782208 DNA_polB_like1_exo Uncharacterized bacterial subgr 80.57
PRK05762 786 DNA polymerase II; Reviewed 80.02
>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair] Back     alignment and domain information 
Probab=100.00  E-value=6.7e-44  Score=373.36  Aligned_cols=207  Identities=19%  Similarity=0.218  Sum_probs=190.2

Q ss_pred             CCCcEEEEEEeecCCCC---ceEEEEEEEEeCCceeeeeeEEEEEcCCCCCCCChHHHHhcCCCHHHHhCCCCHHHHHHH
Q 048020            6 DRSEIVFFDVETTFPIR---HIWEFGAILVCPRKLEELDKYTTLVRPADPSLVSNLCARRNDITPEDVFSAPTFADIADT   82 (304)
Q Consensus         6 ~~~~~VvfDlETTGl~~---~IIEIGAV~v~~g~~~iid~f~~lV~P~~~~~I~~~~~~ltGIT~e~L~~ap~f~eVl~~   82 (304)
                      .+.+|||||+||||+++   +|||||||++.+|  +++++|+.|++|..  ++|..++++||||++||.++++..+|+.+
T Consensus       419 ~datyVVfDiETTGLs~~~d~iIE~aAvKikng--~iId~f~~Fi~P~~--pl~~~~telTgITdeml~~a~~i~~vL~k  494 (1444)
T COG2176         419 DDATYVVFDIETTGLSPVYDEIIEIAAVKIKNG--RIIDKFQFFIKPGR--PLSATITELTGITDEMLENAPEIEEVLEK  494 (1444)
T ss_pred             ccccEEEEEeecCCcCcccchhhhheeeeeeCC--cchHHHHHhcCCCC--cCchhhhhccccCHHHHcCCccHHHHHHH
Confidence            35679999999999987   9999999999988  89999999999999  99999999999999999999999999999


Q ss_pred             HHHHh-------------------------cCCCCCCceehHHHHHHHhcCCCCCCCHHHHHHHhCCC-CCCCChHHHHH
Q 048020           83 VFDIL-------------------------QAPKPKGTIDSLNLLTERFGRRAGDMKMASLATYFGLG-QQTHRSLDDVL  136 (304)
Q Consensus        83 f~~fl-------------------------~~~~~~~~IDTl~Lark~l~p~~~~~kL~~Lak~lGI~-~~~HrAL~DA~  136 (304)
                      |.+|+                         ..++.+++||||.|+| .++|..++|+|+.||+.||+. +.||||.+||.
T Consensus       495 f~~~~~d~IlVAHNasFD~gFl~~~~~k~~~~~~~~pvIDTL~lar-~L~P~~ksh~Lg~l~kk~~v~le~hHRA~yDae  573 (1444)
T COG2176         495 FREFIGDSILVAHNASFDMGFLNTNYEKYGLEPLTNPVIDTLELAR-ALNPEFKSHRLGTLCKKLGVELERHHRADYDAE  573 (1444)
T ss_pred             HHHHhcCcEEEeccCccchhHHHHHHHHhCCccccCchhhHHHHHH-HhChhhhhcchHHHHHHhCccHHHhhhhhhhHH
Confidence            99999                         4567899999999999 789999999999999999997 99999999999


Q ss_pred             HHHHHHHHHHHHhhhccCCc--cccccCCCCCCCccccCCCceeeec---cCcccc---cccccccccccCcccCCCCcc
Q 048020          137 MNLEVLKYCATVLLLESSLP--DIFTGNGCVSQNATARSRINVRSSP---EGTSQN---LSAPSSKFKFENASNVSPPDQ  208 (304)
Q Consensus       137 aTa~L~~~ll~~l~le~~lp--~~l~~~~~~~~~~~~~~r~~h~~il---~~glkn---lvs~s~~~yf~~~prip~s~~  208 (304)
                      ||++||..+++.+. +.++.  ..+|.. +.....|+|.|++|++|+   |.||||   |||.||++|||++||||||+|
T Consensus       574 at~~vf~~f~~~~k-e~Gi~~l~eln~~-l~~~~~ykr~r~~h~~i~vknq~GlKnLykLvS~s~~kyf~~~PrI~~S~L  651 (1444)
T COG2176         574 ATAKVFFVFLKDLK-EKGITNLSELNDK-LSSEDLYKRLRPKHATIYVKNQVGLKNLYKLVSISHTKYFYGRPRIPRSVL  651 (1444)
T ss_pred             HHHHHHHHHHHHHH-HhchhhHHHHhHh-hhhhHHHhhccccceEEEEechHhHHHHHHHHHHHHHHhhccCCCCcHHHH
Confidence            99999999999986 44654  567765 356788999999999999   899999   999999999999999999999


Q ss_pred             ccCCCccceee
Q 048020          209 GKEGIHPIFTL  219 (304)
Q Consensus       209 ~~~~~~~~~~~  219 (304)
                      .+|.-.-++.+
T Consensus       652 ~~~regLligs  662 (1444)
T COG2176         652 KKNREGLLIGS  662 (1444)
T ss_pred             HHhhcCeeecc
Confidence            99887766653

>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type Back     alignment and domain information
>PRK00448 polC DNA polymerase III PolC; Validated Back     alignment and domain information
>TIGR00573 dnaq exonuclease, DNA polymerase III, epsilon subunit family Back     alignment and domain information
>PRK07748 sporulation inhibitor KapD; Provisional Back     alignment and domain information
>PRK09146 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07247 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK06807 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07740 hypothetical protein; Provisional Back     alignment and domain information
>PRK06195 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06130 DNA_pol_III_epsilon_like an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III Back     alignment and domain information
>PRK05711 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>TIGR01406 dnaQ_proteo DNA polymerase III, epsilon subunit, Proteobacterial Back     alignment and domain information
>smart00479 EXOIII exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases Back     alignment and domain information
>cd06133 ERI-1_3'hExo_like DEDDh 3'-5' exonuclease domain of Caenorhabditis elegans ERI-1, human 3' exonuclease, and similar proteins Back     alignment and domain information
>cd06131 DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonuclease domain of the epsilon subunit of Escherichia coli DNA polymerase III and similar proteins Back     alignment and domain information
>PRK09145 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK08517 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK07983 exodeoxyribonuclease X; Provisional Back     alignment and domain information
>PRK06722 exonuclease; Provisional Back     alignment and domain information
>PRK06310 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK06063 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK06309 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07942 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07883 hypothetical protein; Validated Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06136 TREX1_2 DEDDh 3'-5' exonuclease domain of three prime repair exonuclease (TREX)1, TREX2, and similar proteins Back     alignment and domain information
>PRK05168 ribonuclease T; Provisional Back     alignment and domain information
>TIGR01298 RNaseT ribonuclease T Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>cd06134 RNaseT DEDDh 3'-5' exonuclease domain of RNase T Back     alignment and domain information
>cd06137 DEDDh_RNase DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonucleases PAN2, RNA exonuclease (REX)-1,-3, and -4, ISG20, and similar proteins Back     alignment and domain information
>cd06138 ExoI_N N-terminal DEDDh 3'-5' exonuclease domain of Escherichia coli exonuclease I and similar proteins Back     alignment and domain information
>PTZ00315 2'-phosphotransferase; Provisional Back     alignment and domain information
>PRK05601 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06127 DEDDh DEDDh 3'-5' exonuclease domain family Back     alignment and domain information
>cd06144 REX4_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 4, XPMC2, Interferon Stimulated Gene product of 20 kDa, and similar proteins Back     alignment and domain information
>PRK09182 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06145 REX1_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 1, -3 and similar eukaryotic proteins Back     alignment and domain information
>cd06149 ISG20 DEDDh 3'-5' exonuclease domain of Interferon Stimulated Gene product of 20 kDa, and similar proteins Back     alignment and domain information
>COG0847 DnaQ DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00929 RNase_T: Exonuclease; InterPro: IPR013520 This entry includes a variety of exonuclease proteins, such as ribonuclease T [] and the epsilon subunit of DNA polymerase III Back     alignment and domain information
>PRK11779 sbcB exonuclease I; Provisional Back     alignment and domain information
>cd06135 Orn DEDDh 3'-5' exonuclease domain of oligoribonuclease and similar proteins Back     alignment and domain information
>PRK05359 oligoribonuclease; Provisional Back     alignment and domain information
>KOG0542 consensus Predicted exonuclease [Replication, recombination and repair] Back     alignment and domain information
>COG5018 KapD Inhibitor of the KinA pathway to sporulation, predicted exonuclease [General function prediction only] Back     alignment and domain information
>KOG2249 consensus 3'-5' exonuclease [Replication, recombination and repair] Back     alignment and domain information
>COG2925 SbcB Exonuclease I [DNA replication, recombination, and repair] Back     alignment and domain information
>cd06143 PAN2_exo DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonuclease PAN2 Back     alignment and domain information
>KOG3242 consensus Oligoribonuclease (3'->5' exoribonuclease) [RNA processing and modification] Back     alignment and domain information
>COG1949 Orn Oligoribonuclease (3'-5' exoribonuclease) [RNA processing and modification] Back     alignment and domain information
>cd05160 DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain of family-B DNA polymerases Back     alignment and domain information
>KOG2248 consensus 3'-5' exonuclease [Replication, recombination and repair] Back     alignment and domain information
>cd06139 DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase I and similar bacterial family-A DNA polymerases Back     alignment and domain information
>PRK05755 DNA polymerase I; Provisional Back     alignment and domain information
>COG3359 Predicted exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13482 RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A 2AJQ_F 1T8E_A 1T7P_A 1SKR_A 1X9W_A 1TK8_A 1TK0_A 1SL2_A Back     alignment and domain information
>PHA02570 dexA exonuclease; Provisional Back     alignment and domain information
>KOG4793 consensus Three prime repair exonuclease [Replication, recombination and repair] Back     alignment and domain information
>cd06125 DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonuclease domain superfamily Back     alignment and domain information
>cd05780 DNA_polB_Kod1_like_exo DEDDy 3'-5' exonuclease domain of Pyrococcus kodakaraensis Kod1 and similar archaeal family-B DNA polymerases Back     alignment and domain information
>PF04857 CAF1: CAF1 family ribonuclease; InterPro: IPR006941 CAF1 is an RNase of the DEDD superfamily, and a subunit of the Ccr4-Not complex that mediates 3' to 5' mRNA deadenylation Back     alignment and domain information
>KOG0304 consensus mRNA deadenylase subunit [RNA processing and modification] Back     alignment and domain information
>cd05779 DNA_polB_epsilon_exo DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase epsilon, a family-B DNA polymerase Back     alignment and domain information
>cd05781 DNA_polB_B3_exo DEDDy 3'-5' exonuclease domain of Sulfurisphaera ohwakuensis DNA polymerase B3 and similar archaeal family-B DNA polymerases Back     alignment and domain information
>PF01612 DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR002562 This domain is responsible for the 3'-5' exonuclease proofreading activity of Escherichia coli DNA polymerase I (polI) and other enzymes, it catalyses the hydrolysis of unpaired or mismatched nucleotides Back     alignment and domain information
>cd05785 DNA_polB_like2_exo Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases Back     alignment and domain information
>COG0349 Rnd Ribonuclease D [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03491 RecB family nuclease, putative, TM0106 family Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF10108 DNA_pol_B_exo2: Predicted 3'-5' exonuclease related to the exonuclease domain of PolB; InterPro: IPR019288 This entry represents various prokaryotic 3'-5' exonucleases and hypothetical proteins Back     alignment and domain information
>cd05777 DNA_polB_delta_exo DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase delta, a family-B DNA polymerase Back     alignment and domain information
>cd05778 DNA_polB_zeta_exo inactive DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase zeta, a family-B DNA polymerase Back     alignment and domain information
>cd06141 WRN_exo DEDDy 3'-5' exonuclease domain of WRN and similar proteins Back     alignment and domain information
>cd05784 DNA_polB_II_exo DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase II and similar bacterial family-B DNA polymerases Back     alignment and domain information
>cd06129 RNaseD_like DEDDy 3'-5' exonuclease domain of RNase D, WRN, and similar proteins Back     alignment and domain information
>cd06146 mut-7_like_exo DEDDy 3'-5' exonuclease domain of Caenorhabditis elegans mut-7 and similar proteins Back     alignment and domain information
>PTZ00166 DNA polymerase delta catalytic subunit; Provisional Back     alignment and domain information
>PF13017 Maelstrom: piRNA pathway germ-plasm component Back     alignment and domain information
>PF03104 DNA_pol_B_exo1: DNA polymerase family B, exonuclease domain Several related DNA polymerases were too dissimilar to be included Back     alignment and domain information
>PRK06826 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>TIGR01388 rnd ribonuclease D Back     alignment and domain information
>PRK05673 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>cd00007 35EXOc 3'-5' exonuclease Back     alignment and domain information
>cd05783 DNA_polB_B1_exo DEDDy 3'-5' exonuclease domain of Sulfolobus solfataricus DNA polymerase B1 and similar archaeal family-B DNA polymerases Back     alignment and domain information
>PRK10829 ribonuclease D; Provisional Back     alignment and domain information
>cd05782 DNA_polB_like1_exo Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases Back     alignment and domain information
>PRK05762 DNA polymerase II; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query304
1w0h_A204 3'-5' exonuclease ERI1; nuclease domain, hydrolase 1e-14
1zbh_A299 3'-5' exonuclease ERI1; histone mRNA 3'-END-specif 3e-13
2xri_A224 ERI1 exoribonuclease 3; hydrolase, metal binding; 5e-13
1zbu_A349 ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; 7e-13
2p1j_A186 POLIII, DNA polymerase III POLC-type; structural g 2e-11
3cg7_A308 CRN-4, cell death-related nuclease 4; hydrolase, a 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
3mxm_B242 Three prime repair exonuclease 1; RNAse H-like fol 7e-08
3u3y_B314 Three prime repair exonuclease 1; RNAse H fold, 3' 5e-07
1y97_A238 Three prime repair exonuclease 2; TREX2, hydrolase 2e-06
>1w0h_A 3'-5' exonuclease ERI1; nuclease domain, hydrolase; HET: AMP; 1.59A {Homo sapiens} SCOP: c.55.3.5 Length = 204 Back     alignment and structure
 Score = 70.2 bits (172), Expect = 1e-14
 Identities = 34/186 (18%), Positives = 51/186 (27%), Gaps = 46/186 (24%)

Query: 3   PTQDRSEIVFFDVETTFPI-------RHIWEFGAILVCPRKLEELDKYTTLVRPADPSLV 55
                  I   D E T            I EF  +L+    LE  D +   VRP   + +
Sbjct: 5   ADSYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQL 64

Query: 56  SNLCARRNDITPEDVFSAPTFADIADTVFDILQ--------------------------- 88
           S+ C     IT + V  A TF  +   V D ++                           
Sbjct: 65  SDFCISLTGITQDQVDRADTFPQVLKKVIDWMKLKELGTKYKYSLLTDGSWDMSKFLNIQ 124

Query: 89  --------APKPKGTIDSLNLLTERFGRRAGDMKMASLATYFGL---GQQTHRSLDDVLM 137
                    P  K  I+        +       K+  +    G+   G+  H  LDD   
Sbjct: 125 CQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRP-HCGLDDSKN 183

Query: 138 NLEVLK 143
              +  
Sbjct: 184 IARIAV 189
>1zbh_A 3'-5' exonuclease ERI1; histone mRNA 3'-END-specific recognition, structures of 3'- exonuclease and ITS RNA complex, hydrolase/RNA complex; HET: AMP; 3.00A {Homo sapiens} Length = 299 Back     alignment and structure
>2xri_A ERI1 exoribonuclease 3; hydrolase, metal binding; 2.15A {Homo sapiens} Length = 224 Back     alignment and structure
>1zbu_A ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; HET: AMP; 3.00A {Homo sapiens} Length = 349 Back     alignment and structure
>2p1j_A POLIII, DNA polymerase III POLC-type; structural genomics, exonuclease, PSI-2, protein structure initiative; HET: DNA; 2.50A {Thermotoga maritima MSB8} Length = 186 Back     alignment and structure
>3cg7_A CRN-4, cell death-related nuclease 4; hydrolase, apoptosis, 3'-5' exonuclease, deddh; 2.50A {Caenorhabditis elegans} PDB: 3cm5_A 3cm6_A Length = 308 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3mxm_B Three prime repair exonuclease 1; RNAse H-like fold, polyproline type II helix, hydrolase-DNA; HET: DNA; 1.75A {Mus musculus} PDB: 3mxj_B 2ioc_B 3mxi_B* 3b6o_A* 2o4g_A* 3b6p_A* 2o4i_A 2oa8_A Length = 242 Back     alignment and structure
>3u3y_B Three prime repair exonuclease 1; RNAse H fold, 3' exonuclease, homodimer, hydrolase-DNA compl; HET: BU1; 2.28A {Mus musculus} PDB: 3u6f_B* Length = 314 Back     alignment and structure
>1y97_A Three prime repair exonuclease 2; TREX2, hydrolase; 2.50A {Homo sapiens} SCOP: c.55.3.5 Length = 238 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query304
2p1j_A186 POLIII, DNA polymerase III POLC-type; structural g 99.96
1w0h_A204 3'-5' exonuclease ERI1; nuclease domain, hydrolase 99.95
2gui_A194 DNA polymerase III epsilon subunit; DNA polymerase 99.95
3mxm_B242 Three prime repair exonuclease 1; RNAse H-like fol 99.95
1y97_A238 Three prime repair exonuclease 2; TREX2, hydrolase 99.94
2xri_A224 ERI1 exoribonuclease 3; hydrolase, metal binding; 99.94
3cg7_A308 CRN-4, cell death-related nuclease 4; hydrolase, a 99.93
1zbh_A299 3'-5' exonuclease ERI1; histone mRNA 3'-END-specif 99.93
3u3y_B314 Three prime repair exonuclease 1; RNAse H fold, 3' 99.93
2f96_A224 Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolas 99.93
1wlj_A189 Interferon stimulated gene 20KDA; exoribonuclease, 99.92
3v9w_A235 Ribonuclease T; DEDD nucleases family, EXO-nucleas 99.92
1zbu_A349 ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; 99.92
2igi_A180 Oligoribonuclease; RNAse, exoribonuclease, exonucl 99.91
2qxf_A 482 Exodeoxyribonuclease I; alpha-beta domain, DNAQ su 99.89
3tr8_A186 Oligoribonuclease; transcription, hydrolase; 2.50A 99.88
2gbz_A194 Oligoribonuclease; ORN, deddh, structural genomics 99.88
4hec_A190 Putative uncharacterized protein; ssgcid, structur 98.68
2kfn_A 605 Klenow fragment of DNA polymerase I; complex (poly 98.51
4gmj_B285 CCR4-NOT transcription complex subunit 7; mRNA dec 98.07
2d5r_A252 CCR4-NOT transcription complex subunit 7; poly(A) 97.46
1x9m_A 698 DNA polymerase; DNA ploymerase, N-2-acetylaminoflu 97.4
2p51_A333 SPCC18.06C protein; DEDD nuclease fold, hydrolase, 97.34
1uoc_A289 POP2; hydrolase, DEDD nuclease, mRNA degradation, 97.19
4dfk_A 540 DNA polymerase I, thermostable; DNA polymerase, tr 96.0
3f2b_A 1041 DNA-directed DNA polymerase III alpha chain; DNA p 95.9
1qht_A 775 Protein (DNA polymerase); archaea, hyperthermostab 94.67
1noy_A388 Protein (DNA polymerase (E.C.2.7.7.7)); exonucleas 94.28
2e6m_A208 Werner syndrome ATP-dependent helicase homolog; AP 91.01
3saf_A428 Exosome component 10; exoribonuclease, RNA exosome 90.82
3iay_A 919 DNA polymerase delta catalytic subunit; protein-DN 89.41
2hbj_A410 Exosome complex exonuclease RRP6; RNA metabolism, 88.05
3pv8_A 592 DNA polymerase I; DNA polymerase I, protein-DNA co 87.59
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 86.03
2gv9_A 1193 DNA polymerase; polymerase alpha fold, transferase 85.05
1s5j_A 847 DNA polymerase I; replication, disulfide bonds, tr 83.58
2a1r_A430 Poly(A)-specific ribonuclease PARN; DEDD, nuclease 82.45
>2p1j_A POLIII, DNA polymerase III POLC-type; structural genomics, exonuclease, PSI-2, protein structure initiative; HET: DNA; 2.50A {Thermotoga maritima MSB8} Back     alignment and structure
Probab=99.96  E-value=1.5e-28  Score=214.75  Aligned_cols=138  Identities=24%  Similarity=0.319  Sum_probs=122.2

Q ss_pred             CCcEEEEEEeecCCCC---ceEEEEEEEEeCCceeeeeeEEEEEcCCCCCCCChHHHHhcCCCHHHHhCCCCHHHHHHHH
Q 048020            7 RSEIVFFDVETTFPIR---HIWEFGAILVCPRKLEELDKYTTLVRPADPSLVSNLCARRNDITPEDVFSAPTFADIADTV   83 (304)
Q Consensus         7 ~~~~VvfDlETTGl~~---~IIEIGAV~v~~g~~~iid~f~~lV~P~~~~~I~~~~~~ltGIT~e~L~~ap~f~eVl~~f   83 (304)
                      +.+||+||+||||+++   +|||||+|++++|  +++++|+++|+|..  +|+++++++||||+++|+++|++.+|+.+|
T Consensus        11 ~~~~v~iD~ETTGl~~~~~~IieIg~v~~~~g--~i~~~f~~lv~P~~--~i~~~~~~i~GIt~~~l~~~~~~~~v~~~~   86 (186)
T 2p1j_A           11 DATFVVLDFETTGLDPQVDEIIEIGAVKIQGG--QIVDEYHTLIKPSR--EISRKSSEITGITQEMLENKRSIEEVLPEF   86 (186)
T ss_dssp             --CEEEEEEEESCSCTTTCCEEEEEEEEEETT--EEEEEEEEECBCSS--CCCHHHHHHHCCCHHHHTTCCBHHHHHHHH
T ss_pred             CCCEEEEEEECCCCCCCCCeEEEEEEEEEECC--EEEEEEEEEECcCC--CCCHHHhhhcCCCHHHHhcCCCHHHHHHHH
Confidence            4689999999999864   9999999999976  78899999999999  899999999999999999999999999999


Q ss_pred             HHHh-------------------------cCCCCCCceehHHHHHHHhcCCCCCCCHHHHHHHhCCC-CCCCChHHHHHH
Q 048020           84 FDIL-------------------------QAPKPKGTIDSLNLLTERFGRRAGDMKMASLATYFGLG-QQTHRSLDDVLM  137 (304)
Q Consensus        84 ~~fl-------------------------~~~~~~~~IDTl~Lark~l~p~~~~~kL~~Lak~lGI~-~~~HrAL~DA~a  137 (304)
                      .+|+                         ..+...+++||+.++++. + ..++++|..++++||++ .++|||++||++
T Consensus        87 ~~~l~~~~lv~hn~~fD~~~L~~~~~~~g~~~~~~~~iDt~~l~~~~-~-~~~~~~L~~l~~~~gi~~~~~H~Al~Da~~  164 (186)
T 2p1j_A           87 LGFLEDSIIVAHNANFDYRFLRLWIKKVMGLDWERPYIDTLALAKSL-L-KLRSYSLDSVVEKLGLGPFRHHRALDDARV  164 (186)
T ss_dssp             HHHSSSCEEEETTHHHHHHHHHHHHHHHHCCCCCCCEEEHHHHHHHH-T-CCSCCSHHHHHHHTTCCSTTCCHHHHHHHH
T ss_pred             HHHHCCCEEEEECcHHHHHHHHHHHHHcCCCCCCCCEEeHHHHHHHH-h-hcCCCCHHHHHHHcCCCCCCCcCHHHHHHH
Confidence            9998                         122357899999999954 4 66789999999999997 779999999999


Q ss_pred             HHHHHHHHHHHhh
Q 048020          138 NLEVLKYCATVLL  150 (304)
Q Consensus       138 Ta~L~~~ll~~l~  150 (304)
                      |++||.+++++..
T Consensus       165 t~~l~~~l~~~~~  177 (186)
T 2p1j_A          165 TAQVFLRFVEMMK  177 (186)
T ss_dssp             HHHHHHHHTTCC-
T ss_pred             HHHHHHHHHHHHH
Confidence            9999999887654
>1w0h_A 3'-5' exonuclease ERI1; nuclease domain, hydrolase; HET: AMP; 1.59A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>2gui_A DNA polymerase III epsilon subunit; DNA polymerase proofreading domain, transferase; HET: DNA U5P; 1.60A {Escherichia coli} SCOP: c.55.3.5 PDB: 1j54_A* 1j53_A* 2ido_A* 2xy8_A* Back     alignment and structure
>3mxm_B Three prime repair exonuclease 1; RNAse H-like fold, polyproline type II helix, hydrolase-DNA; HET: DNA; 1.75A {Mus musculus} SCOP: c.55.3.5 PDB: 3mxj_B 2ioc_B 3mxi_B* 3b6o_A* 2o4g_A* 3b6p_A* 2o4i_A 2oa8_A Back     alignment and structure
>1y97_A Three prime repair exonuclease 2; TREX2, hydrolase; 2.50A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>2xri_A ERI1 exoribonuclease 3; hydrolase, metal binding; 2.15A {Homo sapiens} Back     alignment and structure
>3cg7_A CRN-4, cell death-related nuclease 4; hydrolase, apoptosis, 3'-5' exonuclease, deddh; 2.50A {Caenorhabditis elegans} PDB: 3cm5_A 3cm6_A Back     alignment and structure
>1zbh_A 3'-5' exonuclease ERI1; histone mRNA 3'-END-specific recognition, structures of 3'- exonuclease and ITS RNA complex, hydrolase/RNA complex; HET: AMP; 3.00A {Homo sapiens} Back     alignment and structure
>3u3y_B Three prime repair exonuclease 1; RNAse H fold, 3' exonuclease, homodimer, hydrolase-DNA compl; HET: BU1; 2.28A {Mus musculus} PDB: 3u6f_B* Back     alignment and structure
>2f96_A Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolase, SAD, PS protein structure initiative, midwest center for structural genomics; 2.09A {Pseudomonas aeruginosa} SCOP: c.55.3.5 Back     alignment and structure
>1wlj_A Interferon stimulated gene 20KDA; exoribonuclease, hydrolase; HET: U5P; 1.90A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>3v9w_A Ribonuclease T; DEDD nucleases family, EXO-nucleases, hydrolase-DNA complex; HET: DNA; 1.70A {Escherichia coli} PDB: 3ngy_A 3v9u_A* 3ngz_A* 3va3_A* 3v9z_A* 3nh0_A 3nh2_A 3nh1_A* 3v9s_A* 3v9x_A* 3va0_A* 2is3_A Back     alignment and structure
>1zbu_A ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; HET: AMP; 3.00A {Homo sapiens} Back     alignment and structure
>2igi_A Oligoribonuclease; RNAse, exoribonuclease, exonuclease, hydrolase, mRNA decay; 1.70A {Escherichia coli} SCOP: c.55.3.5 PDB: 1yta_A 1j9a_A Back     alignment and structure
>2qxf_A Exodeoxyribonuclease I; alpha-beta domain, DNAQ superfamily, SH3-like domain, produc structure, DNA damage, DNA repair, exonuclease; HET: TMP; 1.50A {Escherichia coli} SCOP: c.55.3.5 PDB: 1fxx_A* 3c94_A 3c95_A 3hl8_A* 3hp9_A* Back     alignment and structure
>3tr8_A Oligoribonuclease; transcription, hydrolase; 2.50A {Coxiella burnetii} Back     alignment and structure
>2gbz_A Oligoribonuclease; ORN, deddh, structural genomics, hydrolase; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>4hec_A Putative uncharacterized protein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, unknown; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2kfn_A Klenow fragment of DNA polymerase I; complex (polymerase/DNA), exonuclease, transferase, transferase/DNA complex; HET: US1; 2.03A {Escherichia coli} SCOP: c.55.3.5 e.8.1.1 PDB: 1d9f_A* 1d9d_A* 1krp_A* 1ksp_A* 1qsl_A* 1kfs_A* 2kfz_A* 2kzm_A* 2kzz_A* 1dpi_A* 1kfd_A* 1kln_A* 1d8y_A* Back     alignment and structure
>4gmj_B CCR4-NOT transcription complex subunit 7; mRNA decay, deadenylase, RNA bindin; HET: GOL; 2.70A {Homo sapiens} Back     alignment and structure
>2d5r_A CCR4-NOT transcription complex subunit 7; poly(A) deadenylase, antiproliferative protein, transcription; 2.50A {Homo sapiens} SCOP: c.55.3.9 Back     alignment and structure
>1x9m_A DNA polymerase; DNA ploymerase, N-2-acetylaminofluorene, replication block, mutagenesis, transferase/electron transport/DNA complex; HET: DNA 2DT 8FG; 2.10A {Enterobacteria phage T7} SCOP: c.55.3.5 e.8.1.1 PDB: 1skr_A* 1skw_A* 1sl0_A* 1sks_A* 1sl2_A* 1t7p_A* 1t8e_A* 1tk0_A* 1tk5_A* 1tk8_A* 1tkd_A* 1sl1_A* 1x9s_A* 1x9w_A* 1zyq_A* 2ajq_A* Back     alignment and structure
>2p51_A SPCC18.06C protein; DEDD nuclease fold, hydrolase, gene regulation; 1.40A {Schizosaccharomyces pombe} PDB: 3g0z_A 3g10_A Back     alignment and structure
>1uoc_A POP2; hydrolase, DEDD nuclease, mRNA degradation, poly(A) tail, transcription regulation, repressor, phosphorylation.; 2.3A {Saccharomyces cerevisiae} SCOP: c.55.3.9 Back     alignment and structure
>4dfk_A DNA polymerase I, thermostable; DNA polymerase, transferase-DNA complex; HET: DNA DOC 0L5; 1.65A {Thermus aquaticus} PDB: 1jxe_A* 3ktq_A* 3lwl_A* 3lwm_A* 3m8s_A* 3m8r_A* 3oju_A* 3rr7_A* 3rr8_A* 3rrg_A* 3ojs_A* 3rtv_A* 3sv3_A* 3sv4_A* 3syz_A* 3sz2_A* 3t3f_A* 4df4_A* 4df8_A* 4dfj_A* ... Back     alignment and structure
>3f2b_A DNA-directed DNA polymerase III alpha chain; DNA polymerase C, DNA polymerase III; HET: DGT; 2.39A {Geobacillus kaustophilus} PDB: 3f2c_A* 3f2d_A* Back     alignment and structure
>1qht_A Protein (DNA polymerase); archaea, hyperthermostable, family B polymer alpha family polymerase, transferase; 2.10A {Thermococcus SP} SCOP: c.55.3.5 e.8.1.1 PDB: 1tgo_A 2xhb_A* 2vwj_A* 2vwk_A* 1wns_A* 1wn7_A 1qqc_A* 4ahc_A* 4ail_C* 3a2f_A* 2jgu_A* 1d5a_A Back     alignment and structure
>1noy_A Protein (DNA polymerase (E.C.2.7.7.7)); exonuclease, DNA-binding, complex (nucleotidyltransferase/DNA); HET: DNA; 2.20A {Enterobacteria phage T4} SCOP: c.55.3.5 PDB: 1noz_A* Back     alignment and structure
>2e6m_A Werner syndrome ATP-dependent helicase homolog; APO form, hydrolase; 2.00A {Mus musculus} PDB: 2e6l_A 2fby_A 2fbv_A 2fbx_A 2fbt_A 2fc0_A* Back     alignment and structure
>3saf_A Exosome component 10; exoribonuclease, RNA exosome, hydrolase; 2.50A {Homo sapiens} PDB: 3sag_A 3sah_A 2cpr_A Back     alignment and structure
>3iay_A DNA polymerase delta catalytic subunit; protein-DNA complex, DNA replication, DNA-BI DNA-directed DNA polymerase, exonuclease, hydrolase; HET: DNA DOC DCP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2hbj_A Exosome complex exonuclease RRP6; RNA metabolism, RNA surveillance, RNA processing, hydrolase, gene regulation; 2.10A {Saccharomyces cerevisiae} SCOP: a.60.8.4 c.55.3.5 PDB: 2hbk_A 2hbl_A* 2hbm_A* Back     alignment and structure
>3pv8_A DNA polymerase I; DNA polymerase I, protein-DNA complex, thymine-adenine, CLOS conformation; HET: DNA 2DT D3T; 1.52A {Geobacillus kaustophilus} PDB: 3px0_A* 3px4_A* 3px6_A* 3thv_A* 3ti0_A* 4dse_A* 4dsf_A* 4ds4_A* 4dqp_A* 4dqi_A* 4ds5_A* 4e0d_A* 4dqr_A* 4dqq_A* 3tan_A* 3tap_A* 3taq_A* 3tar_A* 4dqs_A* 3hp6_A* ... Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>2gv9_A DNA polymerase; polymerase alpha fold, transferase; HET: DNA; 2.68A {Human herpesvirus 1} PDB: 1dml_B* Back     alignment and structure
>1s5j_A DNA polymerase I; replication, disulfide bonds, transferase; HET: DNA; 2.40A {Sulfolobus solfataricus} SCOP: c.55.3.5 e.8.1.1 Back     alignment and structure
>2a1r_A Poly(A)-specific ribonuclease PARN; DEDD, nuclease domain, hydrolase-RNA complex; 2.60A {Homo sapiens} PDB: 2a1s_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 304
d1y97a1228 c.55.3.5 (A:1-228) Three prime repair exonuclease 2e-09
d1w0ha_200 c.55.3.5 (A:) Exonuclease ERI1 {Human (Homo sapien 5e-09
d2qxfa1 467 c.55.3.5 (A:8-474) Exonuclease I {Escherichia coli 1e-07
d3b6oa1226 c.55.3.5 (A:9-234) Three prime repair exonuclease 4e-07
d2f96a1202 c.55.3.5 (A:19-220) Ribonuclease T {Pseudomonas ae 1e-05
d2igia1180 c.55.3.5 (A:1-180) Oligoribonuclease {Escherichia 1e-05
d2guia1174 c.55.3.5 (A:7-180) N-terminal exonuclease domain o 6e-04
>d1y97a1 c.55.3.5 (A:1-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: DnaQ-like 3'-5' exonuclease
domain: Three prime repair exonuclease 2, TREX2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 54.6 bits (130), Expect = 2e-09
 Identities = 36/211 (17%), Positives = 51/211 (24%), Gaps = 63/211 (29%)

Query: 1   MGPTQDRSEIVFFDVETT-FPIRH--IWEFGAILVCPRKLEE--------------LDKY 43
           M         VF D+E T  P     I E     V    LE               LDK 
Sbjct: 1   MSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHDESGALVLPRVLDKL 60

Query: 44  TTLVRPADPSLVSNLCARRNDITPEDVFSA--PTFADIADTVFDILQA------------ 89
           T  + P  P   +   +    ++ E +       F            +            
Sbjct: 61  TLCMCPERP--FTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHN 118

Query: 90  --------------------PKPKGTIDSLNLLTE--------RFGRRAGDMKMASLAT- 120
                               P+    +D+L  L             R      + SL   
Sbjct: 119 GFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGSLFHR 178

Query: 121 YFGL-GQQTHRSLDDVLMNLEVLKYCATVLL 150
           YF       H +  DV   L +  + A  LL
Sbjct: 179 YFRAEPSAAHSAEGDVHTLLLIFLHRAAELL 209
>d1w0ha_ c.55.3.5 (A:) Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 200 Back     information, alignment and structure
>d2qxfa1 c.55.3.5 (A:8-474) Exonuclease I {Escherichia coli K12 (Escherichia coli K-12) [TaxId: 83333]} Length = 467 Back     information, alignment and structure
>d3b6oa1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 226 Back     information, alignment and structure
>d2f96a1 c.55.3.5 (A:19-220) Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287]} Length = 202 Back     information, alignment and structure
>d2igia1 c.55.3.5 (A:1-180) Oligoribonuclease {Escherichia coli [TaxId: 562]} Length = 180 Back     information, alignment and structure
>d2guia1 c.55.3.5 (A:7-180) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]} Length = 174 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query304
d2guia1174 N-terminal exonuclease domain of the epsilon subun 99.95
d1w0ha_200 Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 960 99.95
d1y97a1228 Three prime repair exonuclease 2, TREX2 {Human (Ho 99.92
d3b6oa1226 Three prime repair exonuclease 1, TREX1 {Mouse (Mu 99.91
d1wlja_173 Interferon-stimulated gene 20 kDa protein, ISG20 { 99.91
d2f96a1202 Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287 99.85
d2qxfa1 467 Exonuclease I {Escherichia coli K12 (Escherichia c 99.8
d2igia1180 Oligoribonuclease {Escherichia coli [TaxId: 562]} 99.64
d2d5ra1252 CCR4-NOT transcription complex subunit 7, CAF1 {Hu 97.96
d1kfsa1195 Exonuclease domain of prokaryotic DNA polymerase { 97.46
d1uoca_286 Pop2 RNase D domain {Baker's yeast (Saccharomyces 97.44
d2hhva1171 Exonuclease domain of prokaryotic DNA polymerase { 96.36
d1yt3a3193 Ribonuclease D, catalytic domain {Escherichia coli 93.83
d1x9ma1204 Exonuclease domain of T7 DNA polymerase {Bacteriop 91.42
d2hbka2292 Exosome complex exonuclease RRP6 {Baker's yeast (S 90.23
d1tgoa1347 Exonuclease domain of family B DNA polymerases {Ar 86.17
>d2guia1 c.55.3.5 (A:7-180) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: DnaQ-like 3'-5' exonuclease
domain: N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III
species: Escherichia coli [TaxId: 562]

Probab=99.95  E-value=3.8e-27  Score=196.84  Aligned_cols=133  Identities=23%  Similarity=0.291  Sum_probs=114.7

Q ss_pred             cEEEEEEeecCCCC--------ceEEEEEEEEeCCceeeeeeEEEEEcCCCCCCCChHHHHhcCCCHHHHhCCCCHHHHH
Q 048020            9 EIVFFDVETTFPIR--------HIWEFGAILVCPRKLEELDKYTTLVRPADPSLVSNLCARRNDITPEDVFSAPTFADIA   80 (304)
Q Consensus         9 ~~VvfDlETTGl~~--------~IIEIGAV~v~~g~~~iid~f~~lV~P~~~~~I~~~~~~ltGIT~e~L~~ap~f~eVl   80 (304)
                      ++||||+||||+++        +|||||||+++++. .+.++|+.+|+|..  ++++.+.++||||++++.+++++.+++
T Consensus         1 r~vv~D~ETTGl~~~~~~~~~d~IIeIg~v~~~~~~-~~~~~~~~~v~P~~--~i~~~~~~i~gIt~e~~~~~~~~~~~~   77 (174)
T d2guia1           1 RQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRR-LTGNNFHVYLKPDR--LVDPEAFGVHGIADEFLLDKPTFAEVA   77 (174)
T ss_dssp             EEEEEEEEESCCCSSSSTTTTCCEEEEEEEEEETTE-ECSCCEEEECCCSS--CCCHHHHHHHCCCHHHHTTSCCHHHHH
T ss_pred             CEEEEEeeCCCCCcccccCCCCEEEEEEEEEEECCE-EeeeEEEEEeccCc--cchhhhhhccccchhhhhcchhHHHHH
Confidence            58999999999853        79999999999762 34578999999988  999999999999999999999999999


Q ss_pred             HHHHHHh-----------------------------cCCCCCCceehHHHHHHHhcCCCCCCCHHHHHHHhCCC---CCC
Q 048020           81 DTVFDIL-----------------------------QAPKPKGTIDSLNLLTERFGRRAGDMKMASLATYFGLG---QQT  128 (304)
Q Consensus        81 ~~f~~fl-----------------------------~~~~~~~~IDTl~Lark~l~p~~~~~kL~~Lak~lGI~---~~~  128 (304)
                      .+|.+|+                             .......++|++.++++ ++|. ..++|..++++||++   .++
T Consensus        78 ~~~~~~~~~~~~v~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~-~~~~-~~~~L~~l~~~~~~~~~~~~~  155 (174)
T d2guia1          78 DEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARK-MFPG-KRNSLDALCARYEIDNSKRTL  155 (174)
T ss_dssp             HHHHHHHTTSEEEETTHHHHHHHHHHHHHHTCSCCCCGGGTSEEEEHHHHHHH-HSTT-SCCSHHHHHHHTTCCCTTCSS
T ss_pred             HHHHHhcCCCeEEEeecchhhHHHHHHHHHhCCCCCCcccccchhhHHHHHHH-HcCC-CCCCHHHHHHHcCCCCCCCCC
Confidence            9999999                             11223467899999994 5554 567999999999994   458


Q ss_pred             CChHHHHHHHHHHHHHHH
Q 048020          129 HRSLDDVLMNLEVLKYCA  146 (304)
Q Consensus       129 HrAL~DA~aTa~L~~~ll  146 (304)
                      |||++||.+|++||.+|+
T Consensus       156 H~Al~Da~~ta~v~~~l~  173 (174)
T d2guia1         156 HGALLDAQILAEVYLAMT  173 (174)
T ss_dssp             CCHHHHHHHHHHHHHHHT
T ss_pred             cCHHHHHHHHHHHHHHHc
Confidence            999999999999999874
>d1w0ha_ c.55.3.5 (A:) Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y97a1 c.55.3.5 (A:1-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b6oa1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f96a1 c.55.3.5 (A:19-220) Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2qxfa1 c.55.3.5 (A:8-474) Exonuclease I {Escherichia coli K12 (Escherichia coli K-12) [TaxId: 83333]} Back     information, alignment and structure
>d2igia1 c.55.3.5 (A:1-180) Oligoribonuclease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d5ra1 c.55.3.9 (A:11-262) CCR4-NOT transcription complex subunit 7, CAF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kfsa1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uoca_ c.55.3.9 (A:) Pop2 RNase D domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hhva1 c.55.3.5 (A:298-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]} Back     information, alignment and structure
>d1yt3a3 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x9ma1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2hbka2 c.55.3.5 (A:129-420) Exosome complex exonuclease RRP6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tgoa1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Archaeon Thermococcus gorgonarius [TaxId: 71997]} Back     information, alignment and structure