Citrus Sinensis ID: 048050

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MPVMALGAGGSLYEVYHPDFSGNSRDFIEIHNSYETLSDPTARAIYDISLEEDENNVVWVFGSVRVKMGNQSRRGRR
ccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHccccccccHHHHccccccccccccccccc
ccEEEEcccccHHEEEccccccccccEEEHHcHHHHcccHcHHHHHHcccccccccEEEEEEEEEEEcccccccccc
mpvmalgaggslyevyhpdfsgnsrdfIEIHnsyetlsdptarAIYDIsleedennVVWVFGSVRVkmgnqsrrgrr
MPVMALGAGGSLYEVYHPDFSGNSRDFIEIHNSyetlsdptARAIYDISLEEDENNVVWVFGsvrvkmgnqsrrgrr
MPVMALGAGGSLYEVYHPDFSGNSRDFIEIHNSYETLSDPTARAIYDISLEEDENNVVWVFGSVRVKMGNQSRRGRR
******GAGGSLYEVYHPDFSGNSRDFIEIHNSYETLSDPTARAIYDISLEEDENNVVWVFGSVRV***********
*PVMALGAGGSLYEVYHPDFSGNSRDFIEIHNSYETLSDPTARAIYDISLEE*************************
MPVMALGAGGSLYEVYHPDFSGNSRDFIEIHNSYETLSDPTARAIYDISLEEDENNVVWVFGSVRVKM*********
MPVMALGAGGSLYEVYHPDFSGNSRDFIEIHNSYETLSDPTARAIYDISLEEDENNVVWVFGSVRVKM*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPVMALGAGGSLYEVYHPDFSGNSRDFIEIHNSYETLSDPTARAIYDISLEEDENNVVWVFGSVRVKMGNQSRRGRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query77
255579560168 chaperone protein DNAj, putative [Ricinu 0.532 0.244 0.574 2e-07
225462060148 PREDICTED: chaperone protein dnaJ 11, ch 0.519 0.270 0.627 2e-07
224093380142 predicted protein [Populus trichocarpa] 0.571 0.309 0.588 3e-07
356552398142 PREDICTED: chaperone protein dnaJ 11, ch 0.506 0.274 0.613 4e-07
297834156157 DNAJ heat shock N-terminal domain-contai 0.740 0.363 0.477 6e-07
15231204157 chaperone DnaJ-domain containing protein 0.740 0.363 0.477 1e-06
118487648171 unknown [Populus trichocarpa] 0.519 0.233 0.568 2e-06
224122088171 predicted protein [Populus trichocarpa] 0.519 0.233 0.568 2e-06
357460317161 Chaperone protein dnaJ [Medicago truncat 0.519 0.248 0.586 4e-06
22406163799 predicted protein [Populus trichocarpa] 0.519 0.404 0.595 5e-06
>gi|255579560|ref|XP_002530622.1| chaperone protein DNAj, putative [Ricinus communis] gi|223529832|gb|EEF31765.1| chaperone protein DNAj, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (76%), Gaps = 6/47 (12%)

Query: 11  SLYEVYHPDFS------GNSRDFIEIHNSYETLSDPTARAIYDISLE 51
           SL ++YHPD +       + RDF+EIHN+YETLSDP ARA+YD+SL+
Sbjct: 94  SLAKLYHPDAAVREDVETDGRDFMEIHNAYETLSDPAARALYDLSLD 140

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225462060|ref|XP_002275924.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Vitis vinifera] gi|296090000|emb|CBI39819.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224093380|ref|XP_002309904.1| predicted protein [Populus trichocarpa] gi|222852807|gb|EEE90354.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356552398|ref|XP_003544555.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|297834156|ref|XP_002884960.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330800|gb|EFH61219.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15231204|ref|NP_187939.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|9294537|dbj|BAB02800.1| DnaJ-like protein [Arabidopsis thaliana] gi|21592683|gb|AAM64632.1| DnaJ protein, putative [Arabidopsis thaliana] gi|32815917|gb|AAP88343.1| At3g13310 [Arabidopsis thaliana] gi|332641811|gb|AEE75332.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|118487648|gb|ABK95649.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224122088|ref|XP_002330538.1| predicted protein [Populus trichocarpa] gi|222872096|gb|EEF09227.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357460317|ref|XP_003600440.1| Chaperone protein dnaJ [Medicago truncatula] gi|358349362|ref|XP_003638707.1| Chaperone protein dnaJ [Medicago truncatula] gi|355489488|gb|AES70691.1| Chaperone protein dnaJ [Medicago truncatula] gi|355504642|gb|AES85845.1| Chaperone protein dnaJ [Medicago truncatula] gi|388517361|gb|AFK46742.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224061637|ref|XP_002300579.1| predicted protein [Populus trichocarpa] gi|222847837|gb|EEE85384.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query77
TAIR|locus:2088100157 AT3G13310 [Arabidopsis thalian 0.610 0.299 0.562 5.9e-09
GENEDB_PFALCIPARUM|PF11_0099 540 PF11_0099 "heat shock protein 0.532 0.075 0.523 3.1e-05
UNIPROTKB|Q8IIR6 540 PF11_0099 "Heat shock protein 0.532 0.075 0.523 3.1e-05
TAIR|locus:2827820160 AT2G17880 "AT2G17880" [Arabido 0.467 0.225 0.5 6.3e-05
DICTYBASE|DDB_G0282313 363 DDB_G0282313 "heat shock prote 0.480 0.101 0.552 9.9e-05
UNIPROTKB|Q74B05 313 GSU2406 "DnaJ domain protein" 0.415 0.102 0.485 0.00044
TIGR_CMR|GSU_2406 313 GSU_2406 "dnaJ domain protein" 0.415 0.102 0.485 0.00044
TAIR|locus:2088100 AT3G13310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 133 (51.9 bits), Expect = 5.9e-09, P = 5.9e-09
 Identities = 27/48 (56%), Positives = 33/48 (68%)

Query:    11 SLYEVYHPDFS-GNSRDFIEIHNSYETLSDPTARAIYDISLEEDENNV 57
             SL +VYHPD S  + RDF+EIH +Y TL+DPT RAIYD +L      V
Sbjct:    86 SLAKVYHPDASESDGRDFMEIHKAYATLADPTTRAIYDSTLRVPRRRV 133
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GENEDB_PFALCIPARUM|PF11_0099 PF11_0099 "heat shock protein DnaJ homologue Pfj2" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IIR6 PF11_0099 "Heat shock protein DnaJ homologue Pfj2" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
TAIR|locus:2827820 AT2G17880 "AT2G17880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282313 DDB_G0282313 "heat shock protein DnaJ family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q74B05 GSU2406 "DnaJ domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2406 GSU_2406 "dnaJ domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

No confident hit detected by STRING

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query77
pfam0022663 pfam00226, DnaJ, DnaJ domain 1e-07
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 2e-07
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 1e-06
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 2e-05
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 4e-05
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 4e-05
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 7e-05
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 2e-04
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 2e-04
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 2e-04
TIGR00714155 TIGR00714, hscB, Fe-S protein assembly co-chaperon 4e-04
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 0.001
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 0.001
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 0.001
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 0.002
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 0.002
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information 
 Score = 43.7 bits (104), Expect = 1e-07
 Identities = 19/36 (52%), Positives = 22/36 (61%), Gaps = 4/36 (11%)

Query: 16 YHPD-FSGNS---RDFIEIHNSYETLSDPTARAIYD 47
          YHPD   G+      F EI+ +YE LSDP  RAIYD
Sbjct: 28 YHPDKNPGDPAAEEKFKEINEAYEVLSDPEKRAIYD 63

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|211601 TIGR00714, hscB, Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 77
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.91
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.88
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.86
PRK14288 369 chaperone protein DnaJ; Provisional 99.79
PRK14296 372 chaperone protein DnaJ; Provisional 99.78
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.78
PRK14279 392 chaperone protein DnaJ; Provisional 99.75
PRK14286 372 chaperone protein DnaJ; Provisional 99.75
PRK14287 371 chaperone protein DnaJ; Provisional 99.74
PRK14276 380 chaperone protein DnaJ; Provisional 99.73
PRK14283 378 chaperone protein DnaJ; Provisional 99.73
PRK14282 369 chaperone protein DnaJ; Provisional 99.73
PRK14299 291 chaperone protein DnaJ; Provisional 99.73
PRK14285 365 chaperone protein DnaJ; Provisional 99.73
PRK14298 377 chaperone protein DnaJ; Provisional 99.72
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.72
PRK14292 371 chaperone protein DnaJ; Provisional 99.72
PRK14277 386 chaperone protein DnaJ; Provisional 99.72
PRK14291 382 chaperone protein DnaJ; Provisional 99.72
PRK14280 376 chaperone protein DnaJ; Provisional 99.72
PRK14278 378 chaperone protein DnaJ; Provisional 99.71
PRK14294 366 chaperone protein DnaJ; Provisional 99.71
PRK14284 391 chaperone protein DnaJ; Provisional 99.71
PHA03102153 Small T antigen; Reviewed 99.71
PRK14297 380 chaperone protein DnaJ; Provisional 99.71
PRK14301 373 chaperone protein DnaJ; Provisional 99.7
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.7
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.7
PRK14295 389 chaperone protein DnaJ; Provisional 99.7
PRK14281 397 chaperone protein DnaJ; Provisional 99.69
PRK10767 371 chaperone protein DnaJ; Provisional 99.68
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
PRK14300 372 chaperone protein DnaJ; Provisional 99.66
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.66
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.66
PRK14289 386 chaperone protein DnaJ; Provisional 99.66
PRK14290 365 chaperone protein DnaJ; Provisional 99.65
PRK14293 374 chaperone protein DnaJ; Provisional 99.65
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.65
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.65
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.63
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.58
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.53
COG2214 237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.48
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.47
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.44
PRK01356166 hscB co-chaperone HscB; Provisional 99.44
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.44
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.43
PRK05014171 hscB co-chaperone HscB; Provisional 99.42
PRK00294173 hscB co-chaperone HscB; Provisional 99.42
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.4
PRK03578176 hscB co-chaperone HscB; Provisional 99.38
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.29
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.28
PTZ00100116 DnaJ chaperone protein; Provisional 99.24
PHA02624 647 large T antigen; Provisional 99.23
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 99.22
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.14
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.07
PRK01773173 hscB co-chaperone HscB; Provisional 99.06
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.02
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.87
KOG1150 250 consensus Predicted molecular chaperone (DnaJ supe 98.72
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.66
KOG0431453 consensus Auxilin-like protein and related protein 98.01
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 97.75
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 97.61
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.53
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.06
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.54
KOG0724 335 consensus Zuotin and related molecular chaperones 94.57
PF14687112 DUF4460: Domain of unknown function (DUF4460) 92.27
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 88.54
PF0770914 SRR: Seven Residue Repeat; InterPro: IPR011714 Thi 80.84
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.91  E-value=2.6e-24  Score=152.61  Aligned_cols=55  Identities=35%  Similarity=0.405  Sum_probs=51.3

Q ss_pred             ChhHHHHHHHHHHHHhCCCCCC-C---hHHHHHHHHHHHhcCChhhHHHHhhhcccccc
Q 048050            1 MPVMALGAGGSLYEVYHPDFSG-N---SRDFIEIHNSYETLSDPTARAIYDISLEEDEN   55 (77)
Q Consensus         1 ~~~eIkkayr~l~~~~HPD~~~-~---~~~f~~i~~Ay~vL~d~~~R~~yD~~~~~~~~   55 (77)
                      |++|||+|||+||++||||+|+ +   +++|++|++||+|||||++|+.||++++....
T Consensus        17 s~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~   75 (371)
T COG0484          17 SEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFK   75 (371)
T ss_pred             CHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccc
Confidence            6799999999999999999999 3   68999999999999999999999999988654

>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF07709 SRR: Seven Residue Repeat; InterPro: IPR011714 This repeat is found in some Plasmodium and Theileria proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query77
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 3e-08
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 2e-07
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 7e-07
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 7e-07
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 8e-07
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 3e-06
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 4e-06
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 4e-06
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 5e-06
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 7e-06
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 1e-05
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 1e-05
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 1e-05
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 2e-05
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 2e-05
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 2e-05
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 2e-05
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 3e-05
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 3e-05
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 4e-05
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 6e-05
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 7e-05
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-05
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 1e-04
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 2e-04
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 5e-04
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
 Score = 46.8 bits (111), Expect = 3e-08
 Identities = 7/32 (21%), Positives = 14/32 (43%)

Query: 16 YHPDFSGNSRDFIEIHNSYETLSDPTARAIYD 47
          +HPD  G+     +++  Y+ + D    A   
Sbjct: 41 FHPDKGGDEEKMKKMNTLYKKMEDGVKYAHQP 72
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query77
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.84
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.8
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.79
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.79
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.78
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.78
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.78
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.77
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.76
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.76
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.75
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.75
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.75
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.75
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.74
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.73
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.7
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.7
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.69
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.68
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.68
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.64
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.64
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.63
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.62
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.62
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.62
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.59
2guz_A71 Mitochondrial import inner membrane translocase su 99.59
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.58
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.55
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.51
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.48
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.05
2guz_B65 Mitochondrial import inner membrane translocase su 98.66
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.84  E-value=3.4e-21  Score=112.80  Aligned_cols=55  Identities=29%  Similarity=0.335  Sum_probs=50.0

Q ss_pred             ChhHHHHHHHHHHHHhCCCCCCC-hHHHHHHHHHHHhcCChhhHHHHhhhcccccc
Q 048050            1 MPVMALGAGGSLYEVYHPDFSGN-SRDFIEIHNSYETLSDPTARAIYDISLEEDEN   55 (77)
Q Consensus         1 ~~~eIkkayr~l~~~~HPD~~~~-~~~f~~i~~Ay~vL~d~~~R~~yD~~~~~~~~   55 (77)
                      +.++||+||++|++++|||+++. .+.|++|++||+||+||.+|..||.++.....
T Consensus        21 s~~eIk~ayr~l~~~~HPDk~~~~~~~f~~i~~Ay~~L~d~~~R~~YD~~~~~~~~   76 (92)
T 2o37_A           21 NEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDQYGLEAAR   76 (92)
T ss_dssp             CHHHHHHHHHHHHHHHCTTSTTCCHHHHHHHHHHHHHHTSHHHHHHHHHHCHHHHH
T ss_pred             CHHHHHHHHHHHHHHHCcCCCCChHHHHHHHHHHHHHHCCHHHHHHHHHHCHHHhh
Confidence            46899999999999999999975 78999999999999999999999999876543
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 77
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 3e-05
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 3e-04
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 7e-04
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 0.001
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Large T antigen, the N-terminal J domain
species: Murine polyomavirus [TaxId: 10634]

 Score = 36.1 bits (83), Expect = 3e-05
 Identities = 6/32 (18%), Positives = 12/32 (37%)

Query: 16 YHPDFSGNSRDFIEIHNSYETLSDPTARAIYD 47
           HPD  G+     E+++ + T          +
Sbjct: 41 LHPDKGGSHALMQELNSLWGTFKTEVYNLRMN 72
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query77
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.82
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.78
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.73
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.71
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.66
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.63
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.55
d2b7ea156 Pre-mRNA-processing protein PRP40 {Baker's yeast ( 87.72
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.82  E-value=1.1e-20  Score=106.04  Aligned_cols=52  Identities=33%  Similarity=0.358  Sum_probs=48.1

Q ss_pred             ChhHHHHHHHHHHHHhCCCCCCC----hHHHHHHHHHHHhcCChhhHHHHhhhccc
Q 048050            1 MPVMALGAGGSLYEVYHPDFSGN----SRDFIEIHNSYETLSDPTARAIYDISLEE   52 (77)
Q Consensus         1 ~~~eIkkayr~l~~~~HPD~~~~----~~~f~~i~~Ay~vL~d~~~R~~yD~~~~~   52 (77)
                      |.++||+||+++++++|||++++    .+.|..|++||+||+||.+|..||.+|..
T Consensus        16 s~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~   71 (75)
T d1xbla_          16 EEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHA   71 (75)
T ss_dssp             CHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTS
T ss_pred             CHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcc
Confidence            57899999999999999999875    46799999999999999999999999865
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b7ea1 a.159.2.1 (A:4-59) Pre-mRNA-processing protein PRP40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure