Citrus Sinensis ID: 048062


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680------
MSIIGEAILTASVDLLVNKLASEGILFFARQEKIQDDLMEWENMLEMIKAVLDDAEEKKTTNRFVKKWLGKLQNLAYDVEDLLDQFQTEAFRRKLVLGNREPAAAHDQPSSSRTRTKHLLALEKLVIEGCEELSVSISSLPALCKFIIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEELILSTKEQTYIWKSHDGLLQDICSLKSLEIRSCPKLQSLVAEEEKDQQQQLCELSCRLEYLALSGCEGLVKLPQSSLSLSSLREIEIYKCSSLVSFPEVALPSKLKKIQIRECDALKSLPQAWMCDNNSSLEILKIWDCHSLTYIAGVQLPPSLKRLEIYLCYNLRTLTVEEGIQCSSSRRYASSLLEELEISGCLSLTCIFSKNELPATLESLEVGNLPPSLKSLRVGGCSKLESIAERLDNNTSLETIAVSFCRNLKILPSGLHNLRQLQEIGIWECDLVSFPQGGLPCAKLMRLEISYCKRLQVLPKGLHNLTSLQQLRIGKGVELPSLEEDGLPTNLHSLEINSNKEIWKSMIERGRGFHRFSSLRQLTIINCDDVVSFPLKADDKGSGTTLPLPASLTTLWIFNFPNLERLSSSIVDLQYLTSLYLLECPKLKYFPEKGLPSSLLLLIIWECPLIVEKCRKDGGQYWDLLTHIPRVEIDGKSVFGDNT
ccHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHcHHHHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccEEccccccccccccEEEEccccccccccccccccccccEEEEcccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHHccccccccEEEEEcccccEEccccccccccccEEEEEccccccccccccccccccEEEEEEccccccccccccccccccccEEEEEccccccccccccccccccEEEEcccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEccccccHHHHHHccccccccccccEEEEccccccEEEccccccccccccccccccccEEccccccccccccccccccccccEEEEccccccccccccccccccccccccccHHHHHHccccccccccccccccEEEEccEEEEcccc
ccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHcccHHHHHHHEHHccccccccccccccccHccccHHcEEEEccccHccccHHccccccEEEEccccccEcccccccccccccEEEEccccccccccccccccHHHccEEEEcccccccccccccHHHcccccccEEEccccccHHcccccccccccHHHcccccHccEEEEcccccccccccHcccccccEEEEEcccccccccccccccccccEEEEcccccccEccHHHcccccccccEEEEcccccccccccccccccccEEEccccccHccccHHccccHHHHHHcccccccEEEccccccHccccccccccHHHccccccccccccEEEEEcccccHHccccHccccccccEEEEcccccHccccccccccccccEEEEcccccccccccccccccccEEEEcccHHHHcccccccccccccEEEEcccccHcccccccccccccEEEEcccHHHHHHHHHccccccccccccEEEEccccccccccccccccccHHHccccccccEEEEcccccHHHccHHccccccccEEEEcccccHcccccccccccccEEEEcccHHHHHHHcccccccccccccccEEEEcccEEccccc
MSIIGEAILTASVDLLVNKLASEGILFFARQEKIQDDLMEWENMLEMIKAVLDDAEEKKTTNRFVKKWLGKLQNLAYDVEDLLDQFQTEAFRRKLVlgnrepaaahdqpsssrtrTKHLLALEKLVIEGCEELSVSISSLPALCKFIIGGCKKVVWRSatdhlgsqnsvvcrdtsnqvflagplkpqlpKLEELILSTKEQTYIWKSHDgllqdicslksleirscpklqsLVAEEEKDQQQQLCELSCRLEYLALsgceglvklpqsslslsslreieiykcsslvsfpevalpsklkkIQIRECDalkslpqawmcdnnssleilkiwdchsltyiagvqlppslkRLEIYLCYNLRTLTVEEGIQCSSSRRYASSLLEELeisgclsltcifsknelpatleslevgnlppslkslrvggcSKLESIAErldnntslETIAVSFCRNLKILPSGLHNLRQLQEIgiwecdlvsfpqgglpcaKLMRLEISYCKRlqvlpkglhnltslqqlrigkgvelpsleedglptnlhsleiNSNKEIWKSMIERgrgfhrfsslrqltiincddvvsfplkaddkgsgttlplpaslttlwifnfpnlerlsssivdlQYLTSlyllecpklkyfpekglpssLLLLIIWECPLIVEKCRKDGGQYWDLlthiprveidgksvfgdnt
MSIIGEAILTASVDLLVNKLASEGILFFARQEKIQDDLMEWENMLEMIKAVLDDAEEKKTTNRFVKKWLGKLQNLAYDVEDLLDQFQTEAFRRKLVLGnrepaaahdqpsssrtrtKHLLALEKLVIEGCEELSVSISSLPALCKFIIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFlagplkpqlpKLEELILSTKEQTYIWKSHDGLLQDICSLKSLEIRSCPKLQSLVAEEEKDQQQQLCELSCRLEYLALSGCEGLVKLPQSSLSLSSLREIEIYKCSSLVSFPEVALPSKLKKIQIRECDALKSLPQAWMCDNNSSLEILKIWDCHSLTYIAGVQLPPSLKRLEIYLCYNLRTLtveegiqcsSSRRYASSLLEELEISGCLSLTCIFSKNELPATLESLEVGNLPPSLKSLRVGGCSKLESIAerldnntsLETIAVSFCRNLKILPSGLHNLRQLQEIGIWECDLVSFPQGGLPCAKLMRLEISYCKRLQVLPKGLHNLTSLQQLRIGKGVELPSLEEdglptnlhsleinsNKEIWKSMIERGRGFHRFSSLRQLTIINCDDVVSFPLKADDKGSGTTLPLPASLTTLWIFNFPNLERLSSSIVDLQYLTSLYLLECPKLKYFPEKGLPSSLLLLIIWECPLIVEKCRKDGGQYWDLLthiprveidgksvfgdnt
MSIIGEAILTASVDLLVNKLASEGILFFARQEKIQDDLMEWENMLEMIKAVLDDAEEKKTTNRFVKKWLGKLQNLAYDVEDLLDQFQTEAFRRKLVLGNREPAAAHDQPSSSRTRTKHLLALEKLVIEGCEELSVSISSLPALCKFIIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLAGplkpqlpkleelilSTKEQTYIWKSHDGLLQDICSLKSLEIRSCPKLQSLVAEEEKDQQQQLCELSCRLEYLALSGCEGLVKLPQsslslsslREIEIYKCSSLVSFPEVALPSKLKKIQIRECDALKSLPQAWMCDNNSSLEILKIWDCHSLTYIAGVQLPPSLKRLEIYLCYNLRTLTVEEGIQCSSSRRYASSLLEELEISGCLSLTCIFSKNELPATLESLEVGNLPPSLKSLRVGGCSKLESIAERLDNNTSLETIAVSFCRNLKILPSGLHNLRQLQEIGIWECDLVSFPQGGLPCAKLMRLEISYCKRLQVLPKGLHNLTSLQQLRIGKGVELPSLEEDGLPTNLHSLEINSNKEIWKSMIERGRGFHRFSSLRQLTIINCDDVVSFPLKADDKGSGttlplpaslttlWIFNFPNLERLSSSIVDLQYLTSLYLLECPKLKYFPEKGLPSSLLLLIIWECPLIVEKCRKDGGQYWDLLTHIPRVEIDGKSVFGDNT
**IIGEAILTASVDLLVNKLASEGILFFARQEKIQDDLMEWENMLEMIKAVLDDAEEKKTTNRFVKKWLGKLQNLAYDVEDLLDQFQTEAFRRKLVL********************HLLALEKLVIEGCEELSVSISSLPALCKFIIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEELILSTKEQTYIWKSHDGLLQDICSLKSLEIRSCPKLQSLV*********QLCELSCRLEYLALSGCEGLVKLPQSSLSLSSLREIEIYKCSSLVSFPEVALPSKLKKIQIRECDALKSLPQAWMCDNNSSLEILKIWDCHSLTYIAGVQLPPSLKRLEIYLCYNLRTLTVEEGIQCSSSRRYASSLLEELEISGCLSLTCIFSKNELPATLESLEVGNLPPSLKSLRVGGCSKLESIAERLDNNTSLETIAVSFCRNLKILPSGLHNLRQLQEIGIWECDLVSFPQGGLPCAKLMRLEISYCKRLQVLPKGLHNLTSLQQLRIGKGVELPSL****LPTNLHSLEINSNKEIWKSMIERGRGFHRFSSLRQLTIINCDDVVSFPLKADDKGSGTTLPLPASLTTLWIFNFPNLERLSSSIVDLQYLTSLYLLECPKLKYFPEKGLPSSLLLLIIWECPLIVEKCRKDGGQYWDLLTHIPRVEIDG********
MSIIGEAILTASVDLLVNKLASEGILFFARQEKIQDDLMEWENMLEMIKAVLDDAEEKKTTNRFVKKWLGKLQNLAYDVEDLLDQFQTEAFRRKLVLGNREPAAAHDQPSSSRTRTKHLLALEKLVIEGCEELSVSISSLPALCKFIIGGCKKVV*************VVCRDTSNQVFLAGPLKPQLPKLEELILSTKEQTYIWKSHDGLLQDICSLKSLEIRSCPKLQSLVAEEE********ELSCRLEYLALSGCEGLVKLPQSSLSLSSLREIEIYKCSSLVSFPEVALPSKLKKIQIRECDALKSLPQAWMC*NNSSLEILKIWDCHSLTYIAGVQLPPSLKRLEIYLCYNLRTLTVEEG*******RYASSLLEELEISGCLSLTCIFSKNELPATLESLEVGNLPPSLKSLRVGGCSKLESIAERLDNNTSLETIAVSFCRNLKILPSGLHNLRQLQEIGIWECDLVSFPQGGLPCAKLMRLEISYCKRLQVLPKGLHNLTSLQQLRIGKGVELPSLEEDGLPTNLHSLEINSNKEIWKSMIERGRGFHRFSSLRQLTIINCDDVVSFPLKADDKGSGTTLPLPASLTTLWIFNFPNLERLSSSIVDLQYLTSLYLLECPKLKYFPEKGLPSSLLLLIIWECPLIVEKCRKDGGQYWDLLTHIPRVEIDGKSVFG***
MSIIGEAILTASVDLLVNKLASEGILFFARQEKIQDDLMEWENMLEMIKAVLDDAEEKKTTNRFVKKWLGKLQNLAYDVEDLLDQFQTEAFRRKLVLGN***************RTKHLLALEKLVIEGCEELSVSISSLPALCKFIIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEELILSTKEQTYIWKSHDGLLQDICSLKSLEIRSCPKLQSLV*********QLCELSCRLEYLALSGCEGLVKLPQSSLSLSSLREIEIYKCSSLVSFPEVALPSKLKKIQIRECDALKSLPQAWMCDNNSSLEILKIWDCHSLTYIAGVQLPPSLKRLEIYLCYNLRTLTVEEGIQCSSSRRYASSLLEELEISGCLSLTCIFSKNELPATLESLEVGNLPPSLKSLRVGGCSKLESIAERLDNNTSLETIAVSFCRNLKILPSGLHNLRQLQEIGIWECDLVSFPQGGLPCAKLMRLEISYCKRLQVLPKGLHNLTSLQQLRIGKGVELPSLEEDGLPTNLHSLEINSNKEIWKSMIERGRGFHRFSSLRQLTIINCDDVVSFPLKADDKGSGTTLPLPASLTTLWIFNFPNLERLSSSIVDLQYLTSLYLLECPKLKYFPEKGLPSSLLLLIIWECPLIVEKCRKDGGQYWDLLTHIPRVEIDGKSVFGDNT
*SIIGEAILTASVDLLVNKLASEGILFFARQEKIQDDLMEWENMLEMIKAVLDDAEEKKTTNRFVKKWLGKLQNLAYDVEDLLDQFQTEAFRRKLVLGNREPAAAHDQPSSSRTRTKHLLALEKLVIEGCEELSVSISSLPALCKFIIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEELILSTKEQTYIWKSHDGLLQDICSLKSLEIRSCPKLQSLVAEEEKDQQQQLCELSCRLEYLALSGCEGLVKLPQSSLSLSSLREIEIYKCSSLVSFPEVALPSKLKKIQIRECDALKSLPQAWMCDNNSSLEILKIWDCHSLTYIAGVQLPPSLKRLEIYLCYNLRTLTVEEGIQCSSSRRYASSLLEELEISGCLSLTCIFSKNELPATLESLEVGNLPPSLKSLRVGGCSKLESIAERLDNNTSLETIAVSFCRNLKILPSGLHNLRQLQEIGIWECDLVSFPQGGLPCAKLMRLEISYCKRLQVLPKGLHNLTSLQQLRIGKGVELPSLEEDGLPTNLHSLEINSNKEIWKSMIERGRGFHRFSSLRQLTIINCDDVVSFPLKADDKGSGTTLPLPASLTTLWIFNFPNLERLSSSIVDLQYLTSLYLLECPKLKYFPEKGLPSSLLLLIIWECPLIVEKCRKDGGQYWDLLTHIPRVEIDGKSVF****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIIGEAILTASVDLLVNKLASEGILFFARQEKIQDDxxxxxxxxxxxxxxxxxxxxxKTTNRFVKKWLGKLQNLAYDVEDLLDQFQTEAFRRKLVLGNREPAAAHDQPSSSRTRTKHLLALEKLVIEGCEELSVSISSLPALCKFIIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEELILSTKEQTYIWKSHDGLLQDICSLKSLEIRSCPKLQSLVAEEEKDQQQQLCELSCRLEYLALSGCEGLVKLPQSSLSLSSLREIEIYKCSSLVSFPEVALPSKLKKIQIRECDALKSLPQAWMCDNNSSLEILKIWDCHSLTYIAGVQLPPSLKRLEIYLCYNLRTLTVEEGIQCSSSRRYASSLLEELEISGCLSLTCIFSKNELPATLESLEVGNLPPSLKSLRVGGCSKLESIAERLDNNTSLETIAVSFCRNLKILPSGLHNLRQLQEIGIWECDLVSFPQGGLPCAKLMRLEISYCKRLQVLPKGLHNLTSLQQLRIGKGVELPSLEEDGLPTNLHSLEINSNKEIWKSMIERGRGFHRFSSLRQLTIINCDDVVSFPLKADDKGSGTTLPLPASLTTLWIFNFPNLERLSSSIVDLQYLTSLYLLECPKLKYFPEKGLPSSLLLLIIWECPLIVEKCRKDGGQYWDLLTHIPRVEIDGKSVFGDNT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query686 2.2.26 [Sep-21-2011]
Q9LRR51424 Putative disease resistan yes no 0.478 0.230 0.306 8e-23
Q9LRR4 1054 Putative disease resistan no no 0.134 0.087 0.408 6e-10
O23530 1301 Protein SUPPRESSOR OF npr no no 0.516 0.272 0.253 4e-09
Q7XBQ9 970 Disease resistance protei N/A no 0.123 0.087 0.359 7e-09
Q7XA42 979 Putative disease resistan N/A no 0.123 0.086 0.348 2e-08
Q7XA40 992 Putative disease resistan N/A no 0.138 0.095 0.37 4e-08
P23799630 Putative adenylate cyclas N/A no 0.465 0.506 0.262 3e-07
Q7XA39988 Putative disease resistan N/A no 0.551 0.382 0.257 7e-07
Q9LVT1623 Putative disease resistan no no 0.158 0.174 0.263 7e-06
P26337630 Putative adenylate cyclas N/A no 0.431 0.469 0.255 8e-06
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function desciption
 Score =  109 bits (272), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 121/395 (30%), Positives = 184/395 (46%), Gaps = 67/395 (16%)

Query: 292  VALPSKLKKIQIRECDALKSLPQAWMCDNNSSLEILKIWDCHSLTYIAGVQLPPSLKRLE 351
            + LP  L+ + I  CD L SLP+  + ++  +L  L I  CHSL    G   P +LK L 
Sbjct: 1087 MELPQNLQSLHIDSCDGLTSLPEN-LTESYPNLHELLIIACHSLESFPGSHPPTTLKTLY 1145

Query: 352  IYLCYNLRTLTVEEGIQCSSSRRYASSLLEELEI-SGCLSLTCIFSKNELPATLESLEVG 410
            I  C   + L   E +Q   +R Y  S LE L I S C +L         P +L      
Sbjct: 1146 IRDC---KKLNFTESLQ--PTRSY--SQLEYLFIGSSCSNLV------NFPLSLF----- 1187

Query: 411  NLPPSLKSLRVGGCSKLESIAERL---DNNTSLETIAVSFCRNLKILPSGLHNLRQLQEI 467
               P L+SL +  C   ++ +      D+  +LE++ +  C NL+               
Sbjct: 1188 ---PKLRSLSIRDCESFKTFSIHAGLGDDRIALESLEIRDCPNLE--------------- 1229

Query: 468  GIWECDLVSFPQGGLPCAKLMRLEISYCKRLQVLPKGLHNLTSLQQLRIGKGVELPSLEE 527
                    +FPQGGLP  KL  + +S CK+LQ LP+ L  LTSL  L I K  E+ ++  
Sbjct: 1230 --------TFPQGGLPTPKLSSMLLSNCKKLQALPEKLFGLTSLLSLFIIKCPEIETIPG 1281

Query: 528  DGLPTNLHSLEINSNKEIWKSMIERGR-GFHRFSSLRQLTIINCD-DVVSFPLKADDKGS 585
             G P+NL +L I+    +   +  R   G     +LR L I   + D+ SFP    ++G 
Sbjct: 1282 GGFPSNLRTLCIS----LCDKLTPRIEWGLRDLENLRNLEIDGGNEDIESFP----EEGL 1333

Query: 586  GTTLPLPASLTTLWIFNFPNLERLS-SSIVDLQYLTSLYLLECPKLKYFPEKGLPSSLLL 644
                 LP S+ +L I  F NL+ L+     D + + ++ +  C KL+   ++ LP  L  
Sbjct: 1334 -----LPKSVFSLRISRFENLKTLNRKGFHDTKAIETMEISGCDKLQISIDEDLP-PLSC 1387

Query: 645  LIIWECPLIVEKCRKDGGQYWDLLTHIPRVEIDGK 679
            L I  C L+ E   +   +++ +L +IP VEIDG+
Sbjct: 1388 LRISSCSLLTETFAEVETEFFKVL-NIPYVEIDGE 1421




Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|P23799|ESAG8_TRYBB Putative adenylate cyclase regulatory protein OS=Trypanosoma brucei brucei GN=ESAG8 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVT1|DRL39_ARATH Putative disease resistance protein At5g47280 OS=Arabidopsis thaliana GN=At5g47280 PE=3 SV=1 Back     alignment and function description
>sp|P26337|ESA8C_TRYEQ Putative adenylate cyclase regulatory protein OS=Trypanosoma equiperdum GN=ESAG8C PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query686
224132254552 predicted protein [Populus trichocarpa] 0.750 0.932 0.403 2e-80
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.734 0.353 0.360 1e-67
356554923 1399 PREDICTED: putative disease resistance R 0.711 0.348 0.371 3e-65
45826061739 resistance protein [Quercus suber] 0.717 0.665 0.351 1e-59
225449649 1418 PREDICTED: putative disease resistance p 0.760 0.368 0.361 2e-59
400131587 1388 FB_MR5 [Malus x robusta] 0.711 0.351 0.368 3e-56
224059584 1418 cc-nbs-lrr resistance protein [Populus t 0.639 0.309 0.360 1e-53
359487225 1373 PREDICTED: putative disease resistance R 0.739 0.369 0.319 2e-52
359487253 1390 PREDICTED: putative disease resistance p 0.736 0.363 0.311 7e-51
296085123 1278 unnamed protein product [Vitis vinifera] 0.721 0.387 0.317 1e-50
>gi|224132254|ref|XP_002328223.1| predicted protein [Populus trichocarpa] gi|222837738|gb|EEE76103.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  306 bits (785), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 227/562 (40%), Positives = 308/562 (54%), Gaps = 47/562 (8%)

Query: 146 FIIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEEL-ILSTKEQTYI 204
            +I GCK+VV+     +L S NS+   + S   +LA      L +++EL I +  E T +
Sbjct: 1   MVINGCKEVVYEGGV-YLRSLNSMTISNISKLTYLAEGFIQPLAEVQELEIANCMELTSL 59

Query: 205 WKSHDGLLQDICSLKSLEIRSCPKLQSLV-AEEEKDQQQQLCELSCRLEYLALSGCEGLV 263
           +++   L + + SL  LE+R+CP++ SL+  E     QQQL   +C+LE L  S CE L 
Sbjct: 60  YENGVALAKQLTSLLKLEVRNCPQVVSLMEGEVPVYMQQQLA--NCKLESLTFSTCESLK 117

Query: 264 KLPQSSLSLSSLREIEIYKCSSLVSFPEVALPSKLKKIQIRECDALKSLPQAWMCDNNSS 323
           KLPQ   SL SL+E++I  C  L+SFPE  LPS L+ I+I  C+AL  LP A +  N   
Sbjct: 118 KLPQWVHSLVSLKELKIQYCPRLLSFPEAGLPSTLRIIEIVGCNALTPLPAA-VTYNMMC 176

Query: 324 LEILKIWDCHSLTYIAGVQLPPSLKRLEIYLCYNLRTL----------TVEEGIQCSSSR 373
           LE L+I +C SL     +QLPP+LK+LEI  C NL  L            +E   CS + 
Sbjct: 177 LEQLRIENCESLISFGRIQLPPTLKKLEIRYCENLLCLLDDGEGSSSKKSDENTSCSGNN 236

Query: 374 RYASSLLEELEISGCLSLTCIFSKNELPATLESLEV------------GNLPPSLKSLRV 421
              SSLLE L +  C SLT I    ELP+ L+ L+V              LP  LK L +
Sbjct: 237 ---SSLLEYLYVGICNSLTSI---GELPSALKYLQVCSCSKLKSLSSRDKLPAGLKHLAI 290

Query: 422 GGCSKLESIAERLDNNTSLETIAVSFCRNLKILPSGLHNLRQLQEIGIWECD-LVSFPQG 480
             C  LES+ +R  +N SLE + + FC NL+ LP GLH L  L+EI IW C  LVSF   
Sbjct: 291 DSCENLESMPDRFQDNMSLENLKIWFCFNLRSLPEGLHKLCHLREISIWYCPALVSFAAE 350

Query: 481 GLPCAKLMRLEISYCKRLQVLPKGLHNLTSLQQLRIGKGVELPSLEEDGLPTNLHSLEIN 540
           GLP   L RL I  C  L+ +P  +HNL SL++L I    ++ S  E+G PT+L  L   
Sbjct: 351 GLP-INLRRLFIIKCDGLKAIPDHMHNLMSLEELSIYYCPDIVSFPEEGFPTSLTYL--- 406

Query: 541 SNKEIWKSMIERGRGFHRFSSLRQLTIINCDDVVSFPLKADDKGSGTTLPLPASLTTLWI 600
           +  ++    +    G H+ S+LR L I      +SFP  + D G    + LP++L  L I
Sbjct: 407 ATVDLKICELLFNWGMHKLSALRTLIIQGGFSHISFP--SVDMG----VRLPSALNRLSI 460

Query: 601 FNFPNLERLS-SSIVDLQYLTSLYLLECPKLKYFPEKGLPSSLLLLIIWECPLIVEKCRK 659
            +FPNLE LS S   +L  L  L + +CPKL  FP KGLPSSLL L I  CPL+V++  K
Sbjct: 461 EDFPNLEYLSYSGFQNLSSLERLSISDCPKLTSFPGKGLPSSLLELRIRACPLLVQQI-K 519

Query: 660 DGGQYWDLLTHIPRVEIDGKSV 681
              + W  + HIP + IDGK V
Sbjct: 520 GRVKEWLKIRHIPYINIDGKVV 541




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
>gi|356554923|ref|XP_003545790.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|45826061|gb|AAS77675.1| resistance protein [Quercus suber] Back     alignment and taxonomy information
>gi|225449649|ref|XP_002262753.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|400131587|emb|CCH50986.1| FB_MR5 [Malus x robusta] Back     alignment and taxonomy information
>gi|224059584|ref|XP_002299919.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222847177|gb|EEE84724.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359487225|ref|XP_002268551.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487253|ref|XP_003633548.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085123|emb|CBI28618.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query686
TAIR|locus:20916621424 AT3G14460 [Arabidopsis thalian 0.508 0.245 0.291 6.9e-25
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.440 0.254 0.281 1.2e-16
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.333 0.176 0.295 5.4e-14
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.485 0.168 0.249 1.3e-13
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.134 0.087 0.408 7.3e-13
TAIR|locus:20534051215 AT2G14080 [Arabidopsis thalian 0.456 0.257 0.268 5.3e-12
UNIPROTKB|O486471802 O48647 "XA1" [Oryza sativa (ta 0.351 0.133 0.301 6.3e-11
TAIR|locus:2147992 1189 AT5G11250 [Arabidopsis thalian 0.409 0.236 0.273 3.4e-10
TAIR|locus:2117149 1201 AT4G19050 [Arabidopsis thalian 0.565 0.323 0.237 1.9e-09
TAIR|locus:21704081139 AT5G46270 [Arabidopsis thalian 0.352 0.212 0.259 3e-09
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 243 (90.6 bits), Expect = 6.9e-25, Sum P(3) = 6.9e-25
 Identities = 114/391 (29%), Positives = 188/391 (48%)

Query:   304 RECDALKSLPQAWMCDNNSSLEILKIWDCHSLTYIAGVQLPPSLKRLEIYLCYNLRTLTV 363
             R  +A+K  P  +  D+ + +E LK+ D   L     ++LP +L+ L I  C  L +L  
Sbjct:  1058 RSSEAIK--PSQYD-DDETDMEYLKVTDISHL-----MELPQNLQSLHIDSCDGLTSLP- 1108

Query:   364 EEGIQCSSSRRYASSLL--EELE-ISGC---LSLTCIFSKN--ELPATLESLEVGNLPPS 415
              E +  S    +   ++    LE   G     +L  ++ ++  +L  T ESL+       
Sbjct:  1109 -ENLTESYPNLHELLIIACHSLESFPGSHPPTTLKTLYIRDCKKLNFT-ESLQPTRSYSQ 1166

Query:   416 LKSLRVGG-CSKLESIAERLDNNTSLETIAVSFCRNLKI--LPSGLHNLR-QLQEIGIWE 471
             L+ L +G  CS L +    L     L ++++  C + K   + +GL + R  L+ + I +
Sbjct:  1167 LEYLFIGSSCSNLVNFP--LSLFPKLRSLSIRDCESFKTFSIHAGLGDDRIALESLEIRD 1224

Query:   472 C-DLVSFPQGGLPCAKLMRLEISYCKRLQVLPKGLHNLTSLQQLRIGKGVELPSLEEDGL 530
             C +L +FPQGGLP  KL  + +S CK+LQ LP+ L  LTSL  L I K  E+ ++   G 
Sbjct:  1225 CPNLETFPQGGLPTPKLSSMLLSNCKKLQALPEKLFGLTSLLSLFIIKCPEIETIPGGGF 1284

Query:   531 PTNLHSLEINSNKEIWKSMIERGRGFHRFSSLRQLTIINC-DDVVSFPLKADDKGSGXXX 589
             P+NL +L I+   ++    IE G       +LR L I    +D+ SFP    ++G     
Sbjct:  1285 PSNLRTLCISLCDKL-TPRIEWG--LRDLENLRNLEIDGGNEDIESFP----EEG----- 1332

Query:   590 XXXXXXXXXWIFNFPNLERLS-SSIVDLQYLTSLYLLECPKLKYFPEKGLPSSLLLLIIW 648
                       I  F NL+ L+     D + + ++ +  C KL+   ++ LP  L  L I 
Sbjct:  1333 LLPKSVFSLRISRFENLKTLNRKGFHDTKAIETMEISGCDKLQISIDEDLPP-LSCLRIS 1391

Query:   649 ECPLIVEKCRKDGGQYWDLLTHIPRVEIDGK 679
              C L+ E   +   +++ +L +IP VEIDG+
Sbjct:  1392 SCSLLTETFAEVETEFFKVL-NIPYVEIDGE 1421


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117149 AT4G19050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170408 AT5G46270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00660113
hypothetical protein (552 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query686
PLN03210 1153 PLN03210, PLN03210, Resistant to P 5e-08
PLN03210 1153 PLN03210, PLN03210, Resistant to P 6e-08
PLN032101153 PLN03210, PLN03210, Resistant to P 8e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-06
PRK15386426 PRK15386, PRK15386, type III secretion protein Gog 1e-04
PLN032101153 PLN03210, PLN03210, Resistant to P 0.001
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 56.0 bits (135), Expect = 5e-08
 Identities = 72/246 (29%), Positives = 114/246 (46%), Gaps = 19/246 (7%)

Query: 416 LKSLRVGGCSKLESIAERLDNNTSLETIAVSFCRNLKILPSGLHNLRQLQEIGIWECDLV 475
           L+++ + G   L+ I + L   T+LET+ +S C +L  LPS +  L +L+++ +  C+ +
Sbjct: 636 LRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENL 694

Query: 476 SFPQGGLPCAKLMRLEISYCKRLQVLPKGLHNLTSLQQLRIGKGVELPS-LEEDGLPTNL 534
                G+    L RL +S C RL+  P    N++ L  L      E PS L  + L   L
Sbjct: 695 EILPTGINLKSLYRLNLSGCSRLKSFPDISTNISWL-DLDETAIEEFPSNLRLENL-DEL 752

Query: 535 HSLEINSNKEIWKSMIERGRGFHRFS-SLRQLTIINCDDVVSFPLKADDKGSGTTLPLPA 593
              E+ S K +W+ +          S SL +L + +   +V  P         +++    
Sbjct: 753 ILCEMKSEK-LWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELP---------SSIQNLH 802

Query: 594 SLTTLWIFNFPNLERLSSSIVDLQYLTSLYLLECPKLKYFPEKGLPSSLLLL---IIWEC 650
            L  L I N  NLE L + I +L+ L SL L  C +L+ FP+     S L L    I E 
Sbjct: 803 KLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTFPDISTNISDLNLSRTGIEEV 861

Query: 651 PLIVEK 656
           P  +EK
Sbjct: 862 PWWIEK 867


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 686
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.91
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.91
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.89
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.88
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.64
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.62
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.52
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.46
KOG4237498 consensus Extracellular matrix protein slit, conta 99.37
KOG4237498 consensus Extracellular matrix protein slit, conta 99.3
KOG0617264 consensus Ras suppressor protein (contains leucine 99.28
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.28
KOG0617264 consensus Ras suppressor protein (contains leucine 99.24
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.23
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.11
KOG4341483 consensus F-box protein containing LRR [General fu 99.09
KOG4341483 consensus F-box protein containing LRR [General fu 99.07
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.02
PRK15386 426 type III secretion protein GogB; Provisional 98.82
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.67
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.64
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.6
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.59
PRK15386426 type III secretion protein GogB; Provisional 98.51
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.47
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.45
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.42
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.35
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.31
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.28
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.22
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.16
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.05
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.86
PLN03150623 hypothetical protein; Provisional 97.86
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.84
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.8
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.75
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.72
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.69
PLN03150623 hypothetical protein; Provisional 97.64
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.6
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.55
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.53
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.41
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.37
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.29
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.13
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.09
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.86
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.51
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.37
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.22
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.85
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.45
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.23
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 94.93
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.74
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.4
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.25
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 93.62
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 93.33
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.23
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.3
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 90.58
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 90.53
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 90.46
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.5e-36  Score=352.89  Aligned_cols=486  Identities=14%  Similarity=0.117  Sum_probs=369.7

Q ss_pred             hcccceeeeccCCcccc----cccCCCCcceEEEEcCccceeEccccccCCCcceeecccCcchhhccCCCCCCccchhh
Q 048062          118 HLLALEKLVIEGCEELS----VSISSLPALCKFIIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEE  193 (686)
Q Consensus       118 ~l~~L~~L~l~~c~~~~----~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~L~~L~~~~~~~~~~~~~~~~~~l~~l~~  193 (686)
                      .+++|+.|++++|....    ..+..+++|++|++++|......+ ...+++|++|.+.++..    .+..+..+.++++
T Consensus        91 ~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p-~~~l~~L~~L~Ls~n~~----~~~~p~~~~~l~~  165 (968)
T PLN00113         91 RLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIP-RGSIPNLETLDLSNNML----SGEIPNDIGSFSS  165 (968)
T ss_pred             CCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccC-ccccCCCCEEECcCCcc----cccCChHHhcCCC
Confidence            47899999999876432    224478899999999887654222 23478899886655432    3445557888999


Q ss_pred             hhhchhhhhhhhcccchhhhcCcCccEeecccccccccccchhhHHHHHHhhhcCCCccEEEccCCCCCccccccccCCC
Q 048062          194 LILSTKEQTYIWKSHDGLLQDICSLKSLEIRSCPKLQSLVAEEEKDQQQQLCELSCRLEYLALSGCEGLVKLPQSSLSLS  273 (686)
Q Consensus       194 L~~l~l~~n~~~~~~~~~~~~~~~L~~L~L~~~~~l~~lp~~~~~~~l~~l~~~~~~L~~L~l~~~~~l~~~p~~~~~l~  273 (686)
                      |+.+++++|.+....+..++.+++|++|++++|.....+|..     ++.+    ++|++|++++|.....+|..++.++
T Consensus       166 L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~-----l~~l----~~L~~L~L~~n~l~~~~p~~l~~l~  236 (968)
T PLN00113        166 LKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRE-----LGQM----KSLKWIYLGYNNLSGEIPYEIGGLT  236 (968)
T ss_pred             CCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChH-----HcCc----CCccEEECcCCccCCcCChhHhcCC
Confidence            999999999988776777889999999999988755556655     7777    8999999999877668888899999


Q ss_pred             CccEEeccCCCCCccCCC-CCCCCCCcEEeccccccccccchhhhcccCCCccEEeEecCCCCcccccc-cCCCcccEEe
Q 048062          274 SLREIEIYKCSSLVSFPE-VALPSKLKKIQIRECDALKSLPQAWMCDNNSSLEILKIWDCHSLTYIAGV-QLPPSLKRLE  351 (686)
Q Consensus       274 ~L~~L~l~~~~~l~~lp~-~~~l~~L~~L~l~~~~~l~~l~~~~~~~~l~~L~~L~l~~~~~l~~~~~~-~~~~~L~~L~  351 (686)
                      +|++|++++|.....+|. ++.+++|+.|++++|.....+|..+.  ++++|++|++++|.....++.. ..+++|+.|+
T Consensus       237 ~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~--~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~  314 (968)
T PLN00113        237 SLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIF--SLQKLISLDLSDNSLSGEIPELVIQLQNLEILH  314 (968)
T ss_pred             CCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHh--hccCcCEEECcCCeeccCCChhHcCCCCCcEEE
Confidence            999999999875455664 77889999999998766566777766  6889999999987644444433 5678899999


Q ss_pred             eccccCcccccccccccccccccccCCCccEEeccCCccccccccCCCchhhhhhhhccCCCCCCceEEecCCCCccchH
Q 048062          352 IYLCYNLRTLTVEEGIQCSSSRRYASSLLEELEISGCLSLTCIFSKNELPATLESLEVGNLPPSLKSLRVGGCSKLESIA  431 (686)
Q Consensus       352 l~~c~~l~~l~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~l~~~~~~~~L~~L~l~~~~~~~~l~  431 (686)
                      ++++.....+|  ..+..       +++|+.|++++| .+..     .+|..+..+      ++|+.|++++|.....+|
T Consensus       315 l~~n~~~~~~~--~~~~~-------l~~L~~L~L~~n-~l~~-----~~p~~l~~~------~~L~~L~Ls~n~l~~~~p  373 (968)
T PLN00113        315 LFSNNFTGKIP--VALTS-------LPRLQVLQLWSN-KFSG-----EIPKNLGKH------NNLTVLDLSTNNLTGEIP  373 (968)
T ss_pred             CCCCccCCcCC--hhHhc-------CCCCCEEECcCC-CCcC-----cCChHHhCC------CCCcEEECCCCeeEeeCC
Confidence            98876544444  33332       456999999885 3332     344554333      689999999987667788


Q ss_pred             HhhcCCCCCCeeeecccCCcccccccccCCCCCcEEEecCceee-ecCCCCCCCCCccEEeeccccccccccccccCCCC
Q 048062          432 ERLDNNTSLETIAVSFCRNLKILPSGLHNLRQLQEIGIWECDLV-SFPQGGLPCAKLMRLEISYCKRLQVLPKGLHNLTS  510 (686)
Q Consensus       432 ~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~-~l~~~~~~~~~L~~L~l~~~~~l~~l~~~l~~l~~  510 (686)
                      ..+..+++|+.|++++|.....+|..+..+++|+.|++++|.+. .+|.....+++|+.|++++|.....+|..+..+++
T Consensus       374 ~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~  453 (968)
T PLN00113        374 EGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPS  453 (968)
T ss_pred             hhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCC
Confidence            88888899999999998888888888888899999999999776 56766777789999999987666667777778899


Q ss_pred             CCeEEecCCCCCCCCCCCCCCCCCceeeccCCcchhhhhhhcccccCCCCCccEEEeccCCCceEcCCCcCCCCCCCCCC
Q 048062          511 LQQLRIGKGVELPSLEEDGLPTNLHSLEINSNKEIWKSMIERGRGFHRFSSLRQLTIINCDDVVSFPLKADDKGSGTTLP  590 (686)
Q Consensus       511 L~~L~l~~c~~l~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~l~~l~~L~~L~i~~c~~l~~~~~~~~~~~~~~~~~  590 (686)
                      |+.|++++|.....+|.....++|++|++++|. +.+.+|.   .+..+++|+.|++++|.-...+|..++         
T Consensus       454 L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~-l~~~~~~---~~~~l~~L~~L~Ls~N~l~~~~p~~~~---------  520 (968)
T PLN00113        454 LQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQ-FSGAVPR---KLGSLSELMQLKLSENKLSGEIPDELS---------  520 (968)
T ss_pred             CcEEECcCceeeeecCcccccccceEEECcCCc-cCCccCh---hhhhhhccCEEECcCCcceeeCChHHc---------
Confidence            999999998777666665556789999999987 5545555   677888999999998755556776653         


Q ss_pred             CccccceeeccccccccccccccCCCCCcCEEeecCCCCCCcCCCC-CCcCccceeeecCChhH
Q 048062          591 LPASLTTLWIFNFPNLERLSSSIVDLQYLTSLYLLECPKLKYFPEK-GLPSSLLLLIIWECPLI  653 (686)
Q Consensus       591 ~~~~L~~L~l~~~~~L~~l~~~~~~l~~L~~L~i~~c~~l~~l~~~-~~~~~L~~L~i~~c~~l  653 (686)
                      .+++|++|++++|.-...+|..+..+++|++|++++|.....+|.. .-+++|+.|++++|+..
T Consensus       521 ~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~  584 (968)
T PLN00113        521 SCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLH  584 (968)
T ss_pred             CccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcce
Confidence            5678888899887666677877888888999999888766677753 33677888888888643



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query686
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-07
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 3e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 7e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 8e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-07
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 4e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
4fdw_A401 Leucine rich hypothetical protein; putative cell s 6e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-04
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 8e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 93.1 bits (232), Expect = 7e-21
 Identities = 54/310 (17%), Positives = 98/310 (31%), Gaps = 48/310 (15%)

Query: 251 LEYLALSGCEGLVKLPQSSLSLSSLREIEIYKCSSLVSFPEVALPSKLKKIQIRECDALK 310
            E L   G   L                +  +  S          S   +I+ R   ALK
Sbjct: 14  RENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQAN----SNNPQIETRTGRALK 69

Query: 311 SLPQAWMCDNNSSLEILKIWDCHSLTYIAGVQLPPSLKRL----EIYLCYN-LRTLTVEE 365
           +               L++     L      Q P    RL     + +    L  L    
Sbjct: 70  ATADLLEDATQPGRVALELRSV-PLP-----QFPDQAFRLSHLQHMTIDAAGLMELPDTM 123

Query: 366 GIQCSSSRRYASSLLEELEISGCLSLTCIFSKNELPATLESLEVGNLPPSLKSLRVGGCS 425
             Q +         LE L ++    L        LPA++ SL        L+ L +  C 
Sbjct: 124 Q-QFAG--------LETLTLARN-PLR------ALPASIASLN------RLRELSIRACP 161

Query: 426 KLESI---------AERLDNNTSLETIAVSFCRNLKILPSGLHNLRQLQEIGIWECDLVS 476
           +L  +         +       +L+++ + +   ++ LP+ + NL+ L+ + I    L +
Sbjct: 162 ELTELPEPLASTDASGEHQGLVNLQSLRLEWTG-IRSLPASIANLQNLKSLKIRNSPLSA 220

Query: 477 FPQGGLPCAKLMRLEISYCKRLQVLPKGLHNLTSLQQLRIGKGVELPSL-EEDGLPTNLH 535
                    KL  L++  C  L+  P        L++L +     L +L  +    T L 
Sbjct: 221 LGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLE 280

Query: 536 SLEINSNKEI 545
            L++     +
Sbjct: 281 KLDLRGCVNL 290


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Length = 115 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query686
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.98
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.98
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.98
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.85
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.81
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.8
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.77
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.77
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.76
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.76
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.76
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.75
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.75
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.74
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.73
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.72
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.72
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.7
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.7
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.7
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.69
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.69
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.68
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.65
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.65
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.65
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.63
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.6
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.6
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.6
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.59
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.59
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.58
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.58
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.57
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.55
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.54
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.53
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.53
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.53
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.46
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.45
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.45
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.45
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.4
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.39
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.39
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.38
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.38
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.38
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.37
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.36
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.34
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.3
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.27
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.25
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.25
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.25
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.23
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.23
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.22
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.22
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.19
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.16
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.16
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.15
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.07
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.02
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.98
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.97
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.95
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.94
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.91
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.9
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 98.85
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.83
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.81
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.81
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.81
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.79
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.76
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 98.68
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.67
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.66
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.63
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.62
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.6
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.53
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.47
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.46
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.24
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.17
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.16
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.15
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.12
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.11
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.09
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.97
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.85
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.75
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.09
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.03
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.92
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.87
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 90.39
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 90.13
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 87.88
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2e-41  Score=387.73  Aligned_cols=529  Identities=16%  Similarity=0.092  Sum_probs=353.8

Q ss_pred             cccchHhHhhhhccCCCCCcccCCCCcccccc----hhcccceeeeccCCcccc---cc---cCCCCcceEEEEcCccce
Q 048062           85 QFQTEAFRRKLVLGNREPAAAHDQPSSSRTRT----KHLLALEKLVIEGCEELS---VS---ISSLPALCKFIIGGCKKV  154 (686)
Q Consensus        85 ~l~~~~~l~~l~i~~~~~~~~~~~~~~~~~~p----~~l~~L~~L~l~~c~~~~---~~---l~~l~~L~~L~l~~~~~~  154 (686)
                      .+...++|++|+++++.         .....|    ..+++|++|++++|....   ..   ++.+++|++|++++|...
T Consensus       121 ~l~~l~~L~~L~Ls~n~---------l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~  191 (768)
T 3rgz_A          121 SLGSCSGLKFLNVSSNT---------LDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKIS  191 (768)
T ss_dssp             GGGGCTTCCEEECCSSE---------EECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEE
T ss_pred             HHhCCCCCCEEECcCCc---------cCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCccc
Confidence            56666788889988763         122222    346888999988886544   12   678888888888887755


Q ss_pred             eEccccccCCCcceeecccCcchhhccCCCCCCccchhhhhhchhhhhhhhcccchhhhcCcCccEeecccccccccccc
Q 048062          155 VWRSATDHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEELILSTKEQTYIWKSHDGLLQDICSLKSLEIRSCPKLQSLVA  234 (686)
Q Consensus       155 ~~~~~~~~~~~L~~L~~~~~~~~~~~~~~~~~~l~~l~~L~~l~l~~n~~~~~~~~~~~~~~~L~~L~L~~~~~l~~lp~  234 (686)
                      ...+ +..+++|++|.+.+....    +..+ .+.++++|+.+++++|.+....+..+..+++|++|++++|.....+|.
T Consensus       192 ~~~~-~~~l~~L~~L~Ls~n~l~----~~~~-~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~  265 (768)
T 3rgz_A          192 GDVD-VSRCVNLEFLDVSSNNFS----TGIP-FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPP  265 (768)
T ss_dssp             SCCB-CTTCTTCCEEECCSSCCC----SCCC-BCTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCC
T ss_pred             ccCC-cccCCcCCEEECcCCcCC----CCCc-ccccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCc
Confidence            4332 366788888866554322    2222 377788888888888888776666778888888888888763333332


Q ss_pred             hhhHHHHHHhhhcCCCccEEEccCCCCCccccccccCC-CCccEEeccCCCCCccCCC-CCCCCCCcEEecccccccccc
Q 048062          235 EEEKDQQQQLCELSCRLEYLALSGCEGLVKLPQSSLSL-SSLREIEIYKCSSLVSFPE-VALPSKLKKIQIRECDALKSL  312 (686)
Q Consensus       235 ~~~~~~l~~l~~~~~~L~~L~l~~~~~l~~~p~~~~~l-~~L~~L~l~~~~~l~~lp~-~~~l~~L~~L~l~~~~~l~~l  312 (686)
                      .       .+    ++|++|++++|.....+|..+... ++|++|++++|.....+|. ++.+++|++|++++|.....+
T Consensus       266 ~-------~l----~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~i  334 (768)
T 3rgz_A          266 L-------PL----KSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGEL  334 (768)
T ss_dssp             C-------CC----TTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEEC
T ss_pred             c-------cc----CCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcC
Confidence            1       22    666666666665434566655543 6666666666643223443 555666666666665433345


Q ss_pred             chh-hhcccCCCccEEeEecCCCCcccccc-cC---------------------------CCcccEEeeccccCcccccc
Q 048062          313 PQA-WMCDNNSSLEILKIWDCHSLTYIAGV-QL---------------------------PPSLKRLEIYLCYNLRTLTV  363 (686)
Q Consensus       313 ~~~-~~~~~l~~L~~L~l~~~~~l~~~~~~-~~---------------------------~~~L~~L~l~~c~~l~~l~~  363 (686)
                      |.. +.  .+++|++|++++|.....++.. ..                           +++|++|++++|.-...+| 
T Consensus       335 p~~~l~--~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p-  411 (768)
T 3rgz_A          335 PMDTLL--KMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP-  411 (768)
T ss_dssp             CHHHHT--TCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECC-
T ss_pred             CHHHHh--cCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccC-
Confidence            543 32  4556666666555321122211 11                           3455555555543332333 


Q ss_pred             cccccccccccccCCCccEEeccCCccccccccCCCchhhhhhhhccCCCCCCceEEecCCCCccchHHhhcCCCCCCee
Q 048062          364 EEGIQCSSSRRYASSLLEELEISGCLSLTCIFSKNELPATLESLEVGNLPPSLKSLRVGGCSKLESIAERLDNNTSLETI  443 (686)
Q Consensus       364 ~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~l~~~~~~~~L~~L~l~~~~~~~~l~~~l~~l~~L~~L  443 (686)
                       ..+..       +++|+.|++++| .++.     .+|..+..+      ++|++|++++|...+.+|..+..+++|++|
T Consensus       412 -~~l~~-------l~~L~~L~Ls~N-~l~~-----~~p~~l~~l------~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L  471 (768)
T 3rgz_A          412 -PTLSN-------CSELVSLHLSFN-YLSG-----TIPSSLGSL------SKLRDLKLWLNMLEGEIPQELMYVKTLETL  471 (768)
T ss_dssp             -GGGGG-------CTTCCEEECCSS-EEES-----CCCGGGGGC------TTCCEEECCSSCCCSCCCGGGGGCTTCCEE
T ss_pred             -HHHhc-------CCCCCEEECcCC-cccC-----cccHHHhcC------CCCCEEECCCCcccCcCCHHHcCCCCceEE
Confidence             22222       456778887774 4443     234444333      689999999987777888888899999999


Q ss_pred             eecccCCcccccccccCCCCCcEEEecCceee-ecCCCCCCCCCccEEeeccccccccccccccCCCCCCeEEecCCCCC
Q 048062          444 AVSFCRNLKILPSGLHNLRQLQEIGIWECDLV-SFPQGGLPCAKLMRLEISYCKRLQVLPKGLHNLTSLQQLRIGKGVEL  522 (686)
Q Consensus       444 ~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~-~l~~~~~~~~~L~~L~l~~~~~l~~l~~~l~~l~~L~~L~l~~c~~l  522 (686)
                      ++++|.....+|..+..+++|+.|++++|.+. .+|.....+++|+.|++++|.....+|..+..+++|+.|++++|+..
T Consensus       472 ~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~  551 (768)
T 3rgz_A          472 ILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFN  551 (768)
T ss_dssp             ECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEE
T ss_pred             EecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccC
Confidence            99998888788888888999999999999777 67777777889999999998766788888999999999999887643


Q ss_pred             CCCCCC-----------------------------------------------------------------------CCC
Q 048062          523 PSLEED-----------------------------------------------------------------------GLP  531 (686)
Q Consensus       523 ~~~~~~-----------------------------------------------------------------------~~~  531 (686)
                      ..+|..                                                                       +.+
T Consensus       552 g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l  631 (768)
T 3rgz_A          552 GTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNN  631 (768)
T ss_dssp             SBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSS
T ss_pred             CcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhcc
Confidence            333311                                                                       123


Q ss_pred             CCCceeeccCCcchhhhhhhcccccCCCCCccEEEeccCCCceEcCCCcCCCCCCCCCCCccccceeecccccccccccc
Q 048062          532 TNLHSLEINSNKEIWKSMIERGRGFHRFSSLRQLTIINCDDVVSFPLKADDKGSGTTLPLPASLTTLWIFNFPNLERLSS  611 (686)
Q Consensus       532 ~~L~~L~l~~~~~l~~~~~~~~~~l~~l~~L~~L~i~~c~~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~L~~l~~  611 (686)
                      ++|+.|++++|. +.+.+|.   .+..+++|+.|+++++.--..+|..++         .+++|++|+++++.--..+|.
T Consensus       632 ~~L~~LdLs~N~-l~g~ip~---~l~~l~~L~~L~Ls~N~l~g~ip~~l~---------~L~~L~~LdLs~N~l~g~ip~  698 (768)
T 3rgz_A          632 GSMMFLDMSYNM-LSGYIPK---EIGSMPYLFILNLGHNDISGSIPDEVG---------DLRGLNILDLSSNKLDGRIPQ  698 (768)
T ss_dssp             BCCCEEECCSSC-CBSCCCG---GGGGCTTCCEEECCSSCCCSCCCGGGG---------GCTTCCEEECCSSCCEECCCG
T ss_pred             ccccEEECcCCc-ccccCCH---HHhccccCCEEeCcCCccCCCCChHHh---------CCCCCCEEECCCCcccCcCCh
Confidence            578899999998 7667776   788999999999999644447887774         778999999999655558899


Q ss_pred             ccCCCCCcCEEeecCCCCCCcCCCCCCcCccceeeecCChhHH----HHhhcCCCCCccccCCcceEE
Q 048062          612 SIVDLQYLTSLYLLECPKLKYFPEKGLPSSLLLLIIWECPLIV----EKCRKDGGQYWDLLTHIPRVE  675 (686)
Q Consensus       612 ~~~~l~~L~~L~i~~c~~l~~l~~~~~~~~L~~L~i~~c~~l~----~~~~~~~~~~~~~i~~i~~~~  675 (686)
                      .+..+++|++|++++|+--..+|..+.+.++....+.|||.|-    ..|....+++|++++|+|+++
T Consensus       699 ~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~~~~~~~~  766 (768)
T 3rgz_A          699 AMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRSHHHH  766 (768)
T ss_dssp             GGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSCCCCSCC--------------
T ss_pred             HHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCcCCCCCccCCCCCCCCccccC
Confidence            9999999999999998777789988777888888888876432    268889999999999999864



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query686
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.71
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.7
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.69
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.69
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.65
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.6
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.55
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.51
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.46
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.44
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.42
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.42
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.38
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.38
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.36
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.36
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.35
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.32
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.31
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.05
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.0
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.96
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.95
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.95
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.94
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.92
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.84
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.69
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.56
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.35
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.26
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.26
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.63
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.95
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.09
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.49
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.69
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.85  E-value=1.6e-19  Score=187.04  Aligned_cols=343  Identities=18%  Similarity=0.207  Sum_probs=162.0

Q ss_pred             hcCcCccEeecccccccccccchhhHHHHHHhhhcCCCccEEEccCCCCCccccccccCCCCccEEeccCCCCCccCCCC
Q 048062          213 QDICSLKSLEIRSCPKLQSLVAEEEKDQQQQLCELSCRLEYLALSGCEGLVKLPQSSLSLSSLREIEIYKCSSLVSFPEV  292 (686)
Q Consensus       213 ~~~~~L~~L~L~~~~~l~~lp~~~~~~~l~~l~~~~~~L~~L~l~~~~~l~~~p~~~~~l~~L~~L~l~~~~~l~~lp~~  292 (686)
                      ..+.+|++|+++++. ++.+.      ++..+    ++|++|++++|. ++.+|. ++.+++|++|++++|. +..++++
T Consensus        41 ~~l~~l~~L~l~~~~-I~~l~------gl~~L----~nL~~L~Ls~N~-l~~l~~-l~~L~~L~~L~L~~n~-i~~i~~l  106 (384)
T d2omza2          41 TDLDQVTTLQADRLG-IKSID------GVEYL----NNLTQINFSNNQ-LTDITP-LKNLTKLVDILMNNNQ-IADITPL  106 (384)
T ss_dssp             HHHTTCCEEECCSSC-CCCCT------TGGGC----TTCCEEECCSSC-CCCCGG-GTTCTTCCEEECCSSC-CCCCGGG
T ss_pred             HHhCCCCEEECCCCC-CCCcc------ccccC----CCCCEEeCcCCc-CCCCcc-ccCCcccccccccccc-ccccccc
Confidence            345677777777764 66652      24555    777777777764 466653 6677777777777764 5666666


Q ss_pred             CCCCCCcEEeccccccccccchhhhcccCCCccEEeEecCCCCcccccccCCCcccEEeeccccCccccccccccccccc
Q 048062          293 ALPSKLKKIQIRECDALKSLPQAWMCDNNSSLEILKIWDCHSLTYIAGVQLPPSLKRLEIYLCYNLRTLTVEEGIQCSSS  372 (686)
Q Consensus       293 ~~l~~L~~L~l~~~~~l~~l~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~~~~  372 (686)
                      +.+++|+.|+++++ .+..++....   ...+.......+. +..+..............                    
T Consensus       107 ~~l~~L~~L~~~~~-~~~~~~~~~~---~~~~~~~~~~~~~-l~~~~~~~~~~~~~~~~~--------------------  161 (384)
T d2omza2         107 ANLTNLTGLTLFNN-QITDIDPLKN---LTNLNRLELSSNT-ISDISALSGLTSLQQLSF--------------------  161 (384)
T ss_dssp             TTCTTCCEEECCSS-CCCCCGGGTT---CTTCSEEEEEEEE-ECCCGGGTTCTTCSEEEE--------------------
T ss_pred             cccccccccccccc-cccccccccc---ccccccccccccc-cccccccccccccccccc--------------------
Confidence            67777777777663 3333333222   2334444333221 111111100000000000                    


Q ss_pred             ccccCCCccEEeccCCccccccccCCCchhhhhhhhccCCCCCCceEEecCCCCccchHHhhcCCCCCCeeeecccCCcc
Q 048062          373 RRYASSLLEELEISGCLSLTCIFSKNELPATLESLEVGNLPPSLKSLRVGGCSKLESIAERLDNNTSLETIAVSFCRNLK  452 (686)
Q Consensus       373 ~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~l~~~~~~~~L~~L~l~~~~~~~~l~~~l~~l~~L~~L~l~~~~~~~  452 (686)
                                 .... ..+..               .... +.........+.  .........+++++.+++++|....
T Consensus       162 -----------~~~~-~~~~~---------------~~~~-~~~~~~~~~~~~--~~~~~~~~~l~~~~~l~l~~n~i~~  211 (384)
T d2omza2         162 -----------GNQV-TDLKP---------------LANL-TTLERLDISSNK--VSDISVLAKLTNLESLIATNNQISD  211 (384)
T ss_dssp             -----------EESC-CCCGG---------------GTTC-TTCCEEECCSSC--CCCCGGGGGCTTCSEEECCSSCCCC
T ss_pred             -----------cccc-chhhh---------------hccc-cccccccccccc--cccccccccccccceeeccCCccCC
Confidence                       0000 00000               0000 111111111111  1112223444555555555443222


Q ss_pred             cccccccCCCCCcEEEecCceeeecCCCCCCCCCccEEeeccccccccccccccCCCCCCeEEecCCCCCCCCCCCCCCC
Q 048062          453 ILPSGLHNLRQLQEIGIWECDLVSFPQGGLPCAKLMRLEISYCKRLQVLPKGLHNLTSLQQLRIGKGVELPSLEEDGLPT  532 (686)
Q Consensus       453 ~~~~~l~~l~~L~~L~l~~~~l~~l~~~~~~~~~L~~L~l~~~~~l~~l~~~l~~l~~L~~L~l~~c~~l~~~~~~~~~~  532 (686)
                      ..|  ...+++|++|++++|.++.++. ...+++|+.+++.+| .+..++ .+..+++|++|+++++ .+..++.....+
T Consensus       212 ~~~--~~~~~~L~~L~l~~n~l~~~~~-l~~l~~L~~L~l~~n-~l~~~~-~~~~~~~L~~L~l~~~-~l~~~~~~~~~~  285 (384)
T d2omza2         212 ITP--LGILTNLDELSLNGNQLKDIGT-LASLTNLTDLDLANN-QISNLA-PLSGLTKLTELKLGAN-QISNISPLAGLT  285 (384)
T ss_dssp             CGG--GGGCTTCCEEECCSSCCCCCGG-GGGCTTCSEEECCSS-CCCCCG-GGTTCTTCSEEECCSS-CCCCCGGGTTCT
T ss_pred             CCc--ccccCCCCEEECCCCCCCCcch-hhcccccchhccccC-ccCCCC-cccccccCCEeeccCc-ccCCCCcccccc
Confidence            211  2334455555555555444432 223345555555553 233333 2455555666655553 233333333444


Q ss_pred             CCceeeccCCcchhhhhhhcccccCCCCCccEEEeccCCCceEcCCCcCCCCCCCCCCCccccceeeccccccccccccc
Q 048062          533 NLHSLEINSNKEIWKSMIERGRGFHRFSSLRQLTIINCDDVVSFPLKADDKGSGTTLPLPASLTTLWIFNFPNLERLSSS  612 (686)
Q Consensus       533 ~L~~L~l~~~~~l~~~~~~~~~~l~~l~~L~~L~i~~c~~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~L~~l~~~  612 (686)
                      .++.+.+.+|. +.+ ++    .+..+++++.|+++++ +++.++. .         ..+++|++|++++| .++.++ .
T Consensus       286 ~l~~l~~~~n~-l~~-~~----~~~~~~~l~~L~ls~n-~l~~l~~-l---------~~l~~L~~L~L~~n-~l~~l~-~  346 (384)
T d2omza2         286 ALTNLELNENQ-LED-IS----PISNLKNLTYLTLYFN-NISDISP-V---------SSLTKLQRLFFANN-KVSDVS-S  346 (384)
T ss_dssp             TCSEEECCSSC-CSC-CG----GGGGCTTCSEEECCSS-CCSCCGG-G---------GGCTTCCEEECCSS-CCCCCG-G
T ss_pred             ccccccccccc-ccc-cc----ccchhcccCeEECCCC-CCCCCcc-c---------ccCCCCCEEECCCC-CCCCCh-h
Confidence            55555555554 321 11    2455566666666663 4444432 1         14456666666664 556555 3


Q ss_pred             cCCCCCcCEEeecCCCCCCcCCCCCCcCccceeeecCC
Q 048062          613 IVDLQYLTSLYLLECPKLKYFPEKGLPSSLLLLIIWEC  650 (686)
Q Consensus       613 ~~~l~~L~~L~i~~c~~l~~l~~~~~~~~L~~L~i~~c  650 (686)
                      +..+++|++|++++| +++.+++-.-+++|+.|+++++
T Consensus       347 l~~l~~L~~L~l~~N-~l~~l~~l~~l~~L~~L~L~~N  383 (384)
T d2omza2         347 LANLTNINWLSAGHN-QISDLTPLANLTRITQLGLNDQ  383 (384)
T ss_dssp             GGGCTTCCEEECCSS-CCCBCGGGTTCTTCSEEECCCE
T ss_pred             HcCCCCCCEEECCCC-cCCCChhhccCCCCCEeeCCCC
Confidence            566677777777654 4666554334556777776653



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure