Citrus Sinensis ID: 048080


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
NRPPSLGNCQNLILLTTCKNKLSGTVPRQLLRIITRSVLLDLFDNLLSGHFPAEVGNLKHLVSLDISSNMFSGEIPTTLGGCTSLEHLSMQDNSFTGSIPSTLSSLKSITELDLSRNNLSGHIPQYLENLSFLSFLNLSYNHFEGKVPIEAIFNSTKGISLVGNENLCGGSRKSKFSILIKVVIQVIVLCLILVVFFIVVYGRRRRSTQKSSNKLSMEQQYPM
cccccccccccccccccccccccccccHHHHHHHccccccccccccccccccHHHHccccccccccccccccccccccHHccccccEEEcccccccccccHHHHccccccEEcccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
cccHHHccccccEEEEcccccccccccHHHHcccHHcEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccccccccHHHHHHHHcccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc
nrppslgncqnlillttcknklsgtvprQLLRIITRSVLLDLFDnllsghfpaevgnlKHLVSldissnmfsgeipttlggctslehlsmqdnsftgsipstlsslKSITEldlsrnnlsghipqylenlSFLSFLNLSynhfegkvpIEAIfnstkgislvgnenlcggsrksKFSILIKVVIQVIVLCLILVVFFIVVYgrrrrstqkssnklsmeqqypm
nrppslgncQNLILLTTCKNKLSGTVPRQLLRIITRSVLLDLFDNLLSGHFPAEVGNLKHLVSLDISSNMFSGEIPTTLGGCTSLEHLSMQDNSFTGSIPSTLSSLKSITELDLSRNNLSGHIPQYLENLSFLSFLNLSYNHFEGKVPIEAIFNSTKGISLVGNENLCGGSRKSKFSILIKVVIQVIVLCLILVVFFIVVYgrrrrstqkssnklsmeqqypm
NRPPSLGNCQNLILLTTCKNKLSGTVPRQLLRIITRSVLLDLFDNLLSGHFPAEVGNLKHLVSLDISSNMFSGEIPTTLGGCTSLEHLSMQDNSFTGSIPSTLSSLKSITELDLSRNNLSGHIPQYlenlsflsflnlsynhfEGKVPIEAIFNSTKGISLVGNENLCGGSRKSKFSilikvviqvivlclilvvffivvYGRRRRSTQKSSNKLSMEQQYPM
*******NCQNLILLTTCKNKLSGTVPRQLLRIITRSVLLDLFDNLLSGHFPAEVGNLKHLVSLDISSNMFSGEIPTTLGGCTSLEHL*********************TELDLSRNNLSGHIPQYLENLSFLSFLNLSYNHFEGKVPIEAIFNSTKGISLVGNENLCGGSRKSKFSILIKVVIQVIVLCLILVVFFIVVYGR********************
NRPPSLGNCQNLILLTTCKNKLSGTVPRQLLRIITRSVLLDLFDNLLSGHFPAEVGNLKHLVSLDISSNMFSGEIPTTLGGCTSLEHLSMQDNSFTGSIPSTLSSLKSITELDLSRNNLSGHIPQYLENLSFLSFLNLSYNHFEGKVPIEAIFNSTKGISLVGNENLCGGSRKSKFSILIKVVIQVIVLCLILVVFFIVVY*******************YPM
NRPPSLGNCQNLILLTTCKNKLSGTVPRQLLRIITRSVLLDLFDNLLSGHFPAEVGNLKHLVSLDISSNMFSGEIPTTLGGCTSLEHLSMQDNSFTGSIPSTLSSLKSITELDLSRNNLSGHIPQYLENLSFLSFLNLSYNHFEGKVPIEAIFNSTKGISLVGNENLCGGSRKSKFSILIKVVIQVIVLCLILVVFFIVVYGRR*******************
NRPPSLGNCQNLILLTTCKNKLSGTVPRQLLRIITRSVLLDLFDNLLSGHFPAEVGNLKHLVSLDISSNMFSGEIPTTLGGCTSLEHLSMQDNSFTGSIPSTLSSLKSITELDLSRNNLSGHIPQYLENLSFLSFLNLSYNHFEGKVPIEAIFNSTKGISLVGNENLCGGSRKSKFSILIKVVIQVIVLCLILVVFFIVVYGRRRRST***************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NRPPSLGNCQNLILLTTCKNKLSGTVPRQLLRIITRSVLLDLFDNLLSGHFPAEVGNLKHLVSLDISSNMFSGEIPTTLGGCTSLEHLSMQDNSFTGSIPSTLSSLKSITELDLSRNNLSGHIPQYLENLSFLSFLNLSYNHFEGKVPIEAIFNSTKGISLVGNENLCGGSRKSKFSILIKVVIQVIVLCLILVVFFIVVYGRRRRSTQKSSNKLSMEQQYPM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query223 2.2.26 [Sep-21-2011]
C0LGT6 1031 LRR receptor-like serine/ yes no 0.928 0.200 0.412 1e-39
C0LGP4 1010 Probable LRR receptor-lik no no 0.937 0.206 0.386 4e-37
Q9SD62 1025 Putative receptor-like pr no no 0.744 0.161 0.482 4e-31
Q9ZUI0 980 Putative leucine-rich rep no no 0.910 0.207 0.350 3e-25
O49318 1124 Probable leucine-rich rep no no 0.766 0.152 0.381 1e-23
Q9LYN8 1192 Leucine-rich repeat recep no no 0.928 0.173 0.349 4e-23
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.860 0.153 0.323 7e-23
Q9LHP4 1141 Receptor-like protein kin no no 0.650 0.127 0.397 8e-23
Q9LP24 1120 Probable leucine-rich rep no no 0.771 0.153 0.385 1e-22
Q9FL28 1173 LRR receptor-like serine/ no no 0.775 0.147 0.336 2e-22
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function desciption
 Score =  162 bits (411), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 135/228 (59%), Gaps = 21/228 (9%)

Query: 3   PPSLGNCQNLILLTTCKNKLSGTVPRQLLRIITRSVLLDLFDNLLSGHFPAEVGNLKHLV 62
           P SLG C+ L+ L    N+L+GT+P+++L+I + + + DL +N L+GHFP EVG L+ LV
Sbjct: 458 PQSLGRCRYLLDLWMDTNRLNGTIPQEILQIPSLAYI-DLSNNFLTGHFPEEVGKLELLV 516

Query: 63  SLDISSNMFSGEIPTTLGGCTSLEHLSMQDNSFTGSIPSTLSSLKSITELDLSRNNLSGH 122
            L  S N  SG++P  +GGC S+E L MQ NSF G+IP  +S L S+  +D S NNLSG 
Sbjct: 517 GLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIPD-ISRLVSLKNVDFSNNNLSGR 575

Query: 123 IPQYLENLSFLSFLNLSYNHFEGKVPIEAIFNSTKGISLVGNENLCGGSR---------- 172
           IP+YL +L  L  LNLS N FEG+VP   +F +   +S+ GN N+CGG R          
Sbjct: 576 IPRYLASLPSLRNLNLSMNKFEGRVPTTGVFRNATAVSVFGNTNICGGVREMQLKPCIVQ 635

Query: 173 -----KSKFSILIKVV----IQVIVLCLILVVFFIVVYGRRRRSTQKS 211
                +   S+  KVV    I +  L LI++V  +  + +R++    S
Sbjct: 636 ASPRKRKPLSVRKKVVSGICIGIASLLLIIIVASLCWFMKRKKKNNAS 683




Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of elongation factor Tu (EF-Tu), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs). Reduces transformation by Rhizobium radiobacter probably by inducing plant defense during the interaction. Binding to the effector AvrPto1 from P.syringae blocks the downstream plant immune response.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function description
>sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
357497599 1002 CCP [Medicago truncatula] gi|355494103|g 0.964 0.214 0.450 2e-48
357484501 1006 Kinase-like protein [Medicago truncatula 0.973 0.215 0.438 3e-47
357497603 1027 CCP [Medicago truncatula] gi|355494105|g 0.964 0.209 0.442 3e-46
224115346 1017 predicted protein [Populus trichocarpa] 0.977 0.214 0.448 1e-44
449441592 1023 PREDICTED: probable LRR receptor-like se 0.973 0.212 0.429 2e-44
449499190 1023 PREDICTED: LOW QUALITY PROTEIN: probable 0.959 0.209 0.439 5e-44
224121660 774 predicted protein [Populus trichocarpa] 0.941 0.271 0.453 3e-43
224127492 1022 predicted protein [Populus trichocarpa] 0.986 0.215 0.417 4e-43
255581223 1015 receptor-kinase, putative [Ricinus commu 0.946 0.207 0.428 6e-43
357497597 1023 Receptor-like protein kinase [Medicago t 0.964 0.210 0.416 8e-43
>gi|357497599|ref|XP_003619088.1| CCP [Medicago truncatula] gi|355494103|gb|AES75306.1| CCP [Medicago truncatula] Back     alignment and taxonomy information
 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 152/233 (65%), Gaps = 18/233 (7%)

Query: 3   PPSLGNCQNLILLTTCKNKLSGTVPRQLLRIITRSVLLDLFDNLLSGHFPAEVGNLKHLV 62
           PPSLGNCQNL  L    NKL GT+P ++L + + S+LL+L  N LSG  P EVG LK++ 
Sbjct: 444 PPSLGNCQNLQYLDLSHNKLRGTIPVEVLNLFSLSILLNLSHNSLSGTLPREVGMLKNIA 503

Query: 63  SLDISSNMFSGEIPTTLGGCTSLEHLSMQDNSFTGSIPSTLSSLKSITELDLSRNNLSGH 122
            LD+S N  SG+IP  +G CTSLE++ +Q NSF G+IPS+L+SLK +  LDLSRN LSG 
Sbjct: 504 ELDVSENHLSGDIPREIGECTSLEYIHLQRNSFNGTIPSSLASLKGLRYLDLSRNQLSGS 563

Query: 123 IPQYLENLSFLSFLNLSYNHFEGKVPIEAIFNSTKGISLVGNENLCGG------------ 170
           IP  ++N+SFL + N+S+N  EG+VP + +F ++  I L+GN+ LCGG            
Sbjct: 564 IPDGMQNISFLEYFNVSFNMLEGEVPTKGLFGNSTQIELIGNKKLCGGISHLHLPPCSIK 623

Query: 171 ----SRKSKFSILIKVVIQVIVLCLILVVFFIVVYGRRRRSTQKSSNKLSMEQ 219
               +++ KF  LI V++ V+   LIL  F I +Y  R+R+ ++S +  +++Q
Sbjct: 624 GRKHAKQHKFR-LIAVIVSVVSFILIL-SFIITIYMMRKRNQKRSFDSPTIDQ 674




Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357484501|ref|XP_003612538.1| Kinase-like protein [Medicago truncatula] gi|355513873|gb|AES95496.1| Kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357497603|ref|XP_003619090.1| CCP [Medicago truncatula] gi|355494105|gb|AES75308.1| CCP [Medicago truncatula] Back     alignment and taxonomy information
>gi|224115346|ref|XP_002317009.1| predicted protein [Populus trichocarpa] gi|222860074|gb|EEE97621.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449441592|ref|XP_004138566.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449499190|ref|XP_004160745.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224121660|ref|XP_002330621.1| predicted protein [Populus trichocarpa] gi|222872225|gb|EEF09356.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127492|ref|XP_002329291.1| predicted protein [Populus trichocarpa] gi|222870745|gb|EEF07876.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255581223|ref|XP_002531424.1| receptor-kinase, putative [Ricinus communis] gi|223528974|gb|EEF30966.1| receptor-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357497597|ref|XP_003619087.1| Receptor-like protein kinase [Medicago truncatula] gi|355494102|gb|AES75305.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.757 0.163 0.432 2.5e-32
TAIR|locus:2079157 1011 AT3G47580 [Arabidopsis thalian 0.766 0.169 0.398 8.9e-30
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.744 0.164 0.404 1.1e-29
TAIR|locus:2075661 1025 AT3G47110 [Arabidopsis thalian 0.744 0.161 0.428 1.5e-29
TAIR|locus:2075631 1009 AT3G47090 [Arabidopsis thalian 0.766 0.169 0.398 1.9e-29
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.753 0.163 0.422 5.1e-29
UNIPROTKB|O24435 813 O24435 "Receptor kinase-like p 0.753 0.206 0.375 1.9e-25
TAIR|locus:2047525 980 AT2G24130 [Arabidopsis thalian 0.748 0.170 0.363 4.3e-22
TAIR|locus:2124147431 RLP51 "receptor like protein 5 0.717 0.371 0.347 6.3e-22
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.650 0.127 0.369 1.1e-21
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 365 (133.5 bits), Expect = 2.5e-32, P = 2.5e-32
 Identities = 74/171 (43%), Positives = 105/171 (61%)

Query:     3 PPSLGNCQNLILLTTCKNKLSGTVPRQLLRIITRSVLLDLFDNLLSGHFPAEVGNLKHLV 62
             P SLG C+ L+ L    N+L+GT+P+++L+I + + + DL +N L+GHFP EVG L+ LV
Sbjct:   458 PQSLGRCRYLLDLWMDTNRLNGTIPQEILQIPSLAYI-DLSNNFLTGHFPEEVGKLELLV 516

Query:    63 SLDISSNMFSGEIPTTLGGCTSLEHLSMQDNSFTGSIPSTLSSLKSITELDLSRNNLSGH 122
              L  S N  SG++P  +GGC S+E L MQ NSF G+IP  +S L S+  +D S NNLSG 
Sbjct:   517 GLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIPD-ISRLVSLKNVDFSNNNLSGR 575

Query:   123 IPQYXXXXXXXXXXXXXXXXXEGKVPIEAIFNSTKGISLVGNENLCGGSRK 173
             IP+Y                 EG+VP   +F +   +S+ GN N+CGG R+
Sbjct:   576 IPRYLASLPSLRNLNLSMNKFEGRVPTTGVFRNATAVSVFGNTNICGGVRE 626


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0010204 "defense response signaling pathway, resistance gene-independent" evidence=IMP
GO:0016045 "detection of bacterium" evidence=RCA;IDA
GO:0005515 "protein binding" evidence=IPI
GO:0002764 "immune response-regulating signaling pathway" evidence=IMP
GO:0009626 "plant-type hypersensitive response" evidence=IMP
GO:0019199 "transmembrane receptor protein kinase activity" evidence=TAS
GO:0010359 "regulation of anion channel activity" evidence=IMP
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009581 "detection of external stimulus" evidence=RCA
GO:0009595 "detection of biotic stimulus" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031347 "regulation of defense response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0042742 "defense response to bacterium" evidence=RCA
GO:0043900 "regulation of multi-organism process" evidence=RCA
GO:0050776 "regulation of immune response" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075631 AT3G47090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2047525 AT2G24130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124147 RLP51 "receptor like protein 51" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.XI.617.1
hypothetical protein (973 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-29
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-26
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-23
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-22
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-22
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-20
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-20
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-20
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-17
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-14
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  113 bits (284), Expect = 7e-29
 Identities = 67/209 (32%), Positives = 104/209 (49%), Gaps = 14/209 (6%)

Query: 12  LILLTTCKNKLSGTVPRQLLRIITRSVLLDLFDNLLSGHFPAEVGNLKHLVSLDISSNMF 71
           L +L+  +NK  G +P        R   LDL  N  SG  P ++G+L  L+ L +S N  
Sbjct: 454 LQMLSLARNKFFGGLPDSFGS--KRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKL 511

Query: 72  SGEIPTTLGGCTSLEHLSMQDNSFTGSIPSTLSSLKSITELDLSRNNLSGHIPQYLENLS 131
           SGEIP  L  C  L  L +  N  +G IP++ S +  +++LDLS+N LSG IP+ L N+ 
Sbjct: 512 SGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVE 571

Query: 132 FLSFLNLSYNHFEGKVPIEAIFNSTKGISLVGNENLCGGS-----------RKSKFSILI 180
            L  +N+S+NH  G +P    F +    ++ GN +LCGG            RK+      
Sbjct: 572 SLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGDTTSGLPPCKRVRKTPSWWFY 631

Query: 181 KVVIQVIVLCLILVVFFIVVYGRRRRSTQ 209
            +   +    ++ +V F  V+ R R + +
Sbjct: 632 -ITCTLGAFLVLALVAFGFVFIRGRNNLE 659


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 223
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.82
KOG4237498 consensus Extracellular matrix protein slit, conta 99.78
PLN03150623 hypothetical protein; Provisional 99.77
KOG0617264 consensus Ras suppressor protein (contains leucine 99.75
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.73
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
PLN03150623 hypothetical protein; Provisional 99.65
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.58
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.58
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.57
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.57
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.49
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.45
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.41
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.38
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.37
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.35
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.34
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.34
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.33
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.32
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.29
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.29
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.27
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.26
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.25
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.25
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.23
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.06
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.06
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.01
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.97
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.87
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.74
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.69
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.62
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.55
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.51
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.51
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.48
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.44
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.42
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.41
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.37
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.28
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.22
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.2
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.19
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.98
PRK15386 426 type III secretion protein GogB; Provisional 97.96
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.81
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.69
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.55
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.5
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.45
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.36
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.33
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.29
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.24
PRK15386 426 type III secretion protein GogB; Provisional 97.17
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.94
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.9
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.46
smart0037026 LRR Leucine-rich repeats, outliers. 96.36
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 96.36
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.26
PF15102146 TMEM154: TMEM154 protein family 95.86
KOG0473326 consensus Leucine-rich repeat protein [Function un 95.63
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.48
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.37
KOG0473 326 consensus Leucine-rich repeat protein [Function un 95.17
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 95.14
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 95.1
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 94.93
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.58
smart0037026 LRR Leucine-rich repeats, outliers. 94.58
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 94.18
PF08374 221 Protocadherin: Protocadherin; InterPro: IPR013585 94.02
TIGR01478295 STEVOR variant surface antigen, stevor family. Thi 94.0
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 93.62
PTZ00370296 STEVOR; Provisional 93.1
PF02009299 Rifin_STEVOR: Rifin/stevor family; InterPro: IPR00 92.9
PF05454290 DAG1: Dystroglycan (Dystrophin-associated glycopro 92.05
PF0539394 Hum_adeno_E3A: Human adenovirus early E3A glycopro 91.74
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.59
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 91.31
PF01299306 Lamp: Lysosome-associated membrane glycoprotein (L 91.16
PTZ00046358 rifin; Provisional 89.78
TIGR01477353 RIFIN variant surface antigen, rifin family. This 89.61
PF14991118 MLANA: Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 88.96
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 88.86
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.66
PF15330107 SIT: SHP2-interacting transmembrane adaptor protei 87.72
PF15050133 SCIMP: SCIMP protein 87.37
PF0103464 Syndecan: Syndecan domain; InterPro: IPR001050 The 87.31
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 87.0
KOG1947482 consensus Leucine rich repeat proteins, some prote 86.38
KOG4308 478 consensus LRR-containing protein [Function unknown 85.68
PF0596168 Chordopox_A13L: Chordopoxvirus A13L protein; Inter 85.66
PHA03265402 envelope glycoprotein D; Provisional 84.99
KOG1947482 consensus Leucine rich repeat proteins, some prote 84.66
KOG4308478 consensus LRR-containing protein [Function unknown 83.91
PF08374 221 Protocadherin: Protocadherin; InterPro: IPR013585 82.99
PF12768281 Rax2: Cortical protein marker for cell polarity 82.78
KOG3864221 consensus Uncharacterized conserved protein [Funct 82.34
PF1457575 EphA2_TM: Ephrin type-A receptor 2 transmembrane d 81.92
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 81.51
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 81.07
PHA0304968 IMV membrane protein; Provisional 81.06
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 81.05
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.94  E-value=7.6e-26  Score=208.93  Aligned_cols=162  Identities=37%  Similarity=0.641  Sum_probs=132.6

Q ss_pred             CCCCCCCeeecccCccccCCChhhhhccCCceEEEccCCcccccCCcCCCCCCCCCeEeccCccccccCCccccCCCCCc
Q 048080            7 GNCQNLILLTTCKNKLSGTVPRQLLRIITRSVLLDLFDNLLSGHFPAEVGNLKHLVSLDISSNMFSGEIPTTLGGCTSLE   86 (223)
Q Consensus         7 ~~l~~L~~L~l~~n~i~~~~p~~~~~~~~~l~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~   86 (223)
                      ..+++|+.|++++|++.+.+|...  ....|+.|++++|.+++..|..|..+++|+.|++++|.+.+..|+.+..+++|+
T Consensus       449 ~~l~~L~~L~L~~n~~~~~~p~~~--~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~  526 (968)
T PLN00113        449 WDMPSLQMLSLARNKFFGGLPDSF--GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLV  526 (968)
T ss_pred             ccCCCCcEEECcCceeeeecCccc--ccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCC
Confidence            334444444444444444444322  224567888888888888888888899999999999999999999999999999


Q ss_pred             EEEcccCcccccCCccccCCCCCCEEECCCCccccccchhhhCCCCCCEEeccCCcCcccCCchhhhcCCcceeecCCCC
Q 048080           87 HLSMQDNSFTGSIPSTLSSLKSITELDLSRNNLSGHIPQYLENLSFLSFLNLSYNHFEGKVPIEAIFNSTKGISLVGNEN  166 (223)
Q Consensus        87 ~L~L~~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~l~l~~N~l~~~~~~~~~~~~l~~l~~~~n~~  166 (223)
                      .|++++|.+++.+|..|..+++|+.|+|++|++++.+|..+..+++|+.+++++|++.+.+|....+..+....+.+|+.
T Consensus       527 ~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~  606 (968)
T PLN00113        527 SLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNID  606 (968)
T ss_pred             EEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999777777777778889999


Q ss_pred             CCCC
Q 048080          167 LCGG  170 (223)
Q Consensus       167 ~C~~  170 (223)
                      .|+.
T Consensus       607 lc~~  610 (968)
T PLN00113        607 LCGG  610 (968)
T ss_pred             ccCC
Confidence            9974



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF15102 TMEM154: TMEM154 protein family Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PF08374 Protocadherin: Protocadherin; InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains Back     alignment and domain information
>TIGR01478 STEVOR variant surface antigen, stevor family Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>PTZ00370 STEVOR; Provisional Back     alignment and domain information
>PF02009 Rifin_STEVOR: Rifin/stevor family; InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world Back     alignment and domain information
>PF05454 DAG1: Dystroglycan (Dystrophin-associated glycoprotein 1); InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5 Back     alignment and domain information
>PF05393 Hum_adeno_E3A: Human adenovirus early E3A glycoprotein; InterPro: IPR008652 This family consists of several early glycoproteins (E3A), from human adenovirus type 2 Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>PF01299 Lamp: Lysosome-associated membrane glycoprotein (Lamp); InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear Back     alignment and domain information
>PTZ00046 rifin; Provisional Back     alignment and domain information
>TIGR01477 RIFIN variant surface antigen, rifin family Back     alignment and domain information
>PF14991 MLANA: Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 2GUO_C 3MRQ_P 2GTW_C 3L6F_C 3MRP_P Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15330 SIT: SHP2-interacting transmembrane adaptor protein, SIT Back     alignment and domain information
>PF15050 SCIMP: SCIMP protein Back     alignment and domain information
>PF01034 Syndecan: Syndecan domain; InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF05961 Chordopox_A13L: Chordopoxvirus A13L protein; InterPro: IPR009236 This family consists of A13L proteins from the Chordopoxviruses Back     alignment and domain information
>PHA03265 envelope glycoprotein D; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF08374 Protocadherin: Protocadherin; InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14575 EphA2_TM: Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>PHA03049 IMV membrane protein; Provisional Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-16
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-16
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-08
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 62.4 bits (150), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 55/215 (25%), Positives = 78/215 (36%), Gaps = 47/215 (21%) Query: 1 NRPPSLGNCQNLILLTTCKNKLSGTVP--------------------------------- 27 N P LG+C++LI L N +GT+P Sbjct: 526 NIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECH 585 Query: 28 -------------RQLLRIITRSVLLDLFDNLLSGHFPAEVGNLKHLVSLDISSNMFSGE 74 QL R+ TR+ ++ + GH N ++ LD+S NM SG Sbjct: 586 GAGNLLEFQGIRSEQLNRLSTRNPC-NITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGY 644 Query: 75 IPTTLGGCTSLEHLSMQDNSFTGSIPSTLSSLKSITELDLSRNNLSGHIPQYXXXXXXXX 134 IP +G L L++ N +GSIP + L+ + LDLS N L G IPQ Sbjct: 645 IPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLT 704 Query: 135 XXXXXXXXXEGKVPIEAIFNSTKGISLVGNENLCG 169 G +P F + + N LCG Sbjct: 705 EIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCG 739
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-58
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-38
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-26
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-17
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-48
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-40
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-39
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-36
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-34
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-33
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-33
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-31
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-30
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-30
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-26
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-22
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-25
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-19
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-19
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-23
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-22
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-07
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-14
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 7e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-14
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-13
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-10
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-08
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-13
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-11
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-11
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-07
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-09
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-06
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-09
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-06
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 5e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-06
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-07
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 9e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-07
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  185 bits (472), Expect = 3e-58
 Identities = 47/168 (27%), Positives = 77/168 (45%), Gaps = 2/168 (1%)

Query: 3   PPSLGNCQNLILLTTCKNKLSGTVPRQLLRIITRSVLLDLFDNLLSGHFPAEVGNLKHLV 62
           PPS+ +  NL+ +T   N++SG +P            + +  N L+G  P    NL  L 
Sbjct: 142 PPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LA 200

Query: 63  SLDISSNMFSGEIPTTLGGCTSLEHLSMQDNSFTGSIPSTLSSLKSITELDLSRNNLSGH 122
            +D+S NM  G+     G   + + + +  NS    +   +   K++  LDL  N + G 
Sbjct: 201 FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGK-VGLSKNLNGLDLRNNRIYGT 259

Query: 123 IPQYLENLSFLSFLNLSYNHFEGKVPIEAIFNSTKGISLVGNENLCGG 170
           +PQ L  L FL  LN+S+N+  G++P           +   N+ LCG 
Sbjct: 260 LPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGS 307


>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.93
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.93
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.91
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.91
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.91
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.9
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.9
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.89
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.89
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.89
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.88
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.87
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.87
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.87
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.85
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.85
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.85
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.85
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.85
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.85
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.85
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.85
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.85
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.84
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.84
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.84
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.84
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.83
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.83
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.83
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.82
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.82
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.82
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.82
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.81
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.81
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.81
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.81
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.81
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.81
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.81
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.8
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.8
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.8
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.79
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.79
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.79
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.79
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.79
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.79
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.79
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.78
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.77
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.76
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.76
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.75
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.75
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.74
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.73
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.71
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.7
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.7
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.69
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.69
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.69
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.69
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.68
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.68
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.68
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.67
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.67
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.66
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.66
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.65
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.65
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.64
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.64
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.62
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.6
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.57
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.57
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.57
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.56
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.51
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.51
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.42
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.38
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.28
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.2
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.19
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.17
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.01
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.94
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.88
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.84
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.8
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.79
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.75
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.71
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.61
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.55
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.51
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.49
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.42
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.36
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.34
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.33
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.12
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.65
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.64
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 97.24
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.13
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 96.77
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 96.41
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 95.23
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 86.96
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
Probab=99.94  E-value=1.3e-25  Score=178.11  Aligned_cols=168  Identities=23%  Similarity=0.210  Sum_probs=151.6

Q ss_pred             CCCCCCCCCCeeecccCccccCCChhhhhccCCceEEEccCCcccccCCcCCCCCCCCCeEeccCccccccCCccccCCC
Q 048080            4 PSLGNCQNLILLTTCKNKLSGTVPRQLLRIITRSVLLDLFDNLLSGHFPAEVGNLKHLVSLDISSNMFSGEIPTTLGGCT   83 (223)
Q Consensus         4 ~~~~~l~~L~~L~l~~n~i~~~~p~~~~~~~~~l~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~   83 (223)
                      .+|+++++|++|++++|.+. .+|...|...+.|++|++++|.+....+..|..+++|++|++++|.+++..+..|..++
T Consensus        55 ~~~~~l~~L~~L~l~~n~l~-~i~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~  133 (270)
T 2o6q_A           55 KAFHRLTKLRLLYLNDNKLQ-TLPAGIFKELKNLETLWVTDNKLQALPIGVFDQLVNLAELRLDRNQLKSLPPRVFDSLT  133 (270)
T ss_dssp             TSSSSCTTCCEEECCSSCCS-CCCTTTTSSCTTCCEEECCSSCCCCCCTTTTTTCSSCCEEECCSSCCCCCCTTTTTTCT
T ss_pred             HHhcCCCCCCEEECCCCccC-eeChhhhcCCCCCCEEECCCCcCCcCCHhHcccccCCCEEECCCCccCeeCHHHhCcCc
Confidence            47999999999999999998 89988888888999999999999988888899999999999999999988888899999


Q ss_pred             CCcEEEcccCcccccCCccccCCCCCCEEECCCCccccccchhhhCCCCCCEEeccCCcCcccCCc-hhhhcCCcceeec
Q 048080           84 SLEHLSMQDNSFTGSIPSTLSSLKSITELDLSRNNLSGHIPQYLENLSFLSFLNLSYNHFEGKVPI-EAIFNSTKGISLV  162 (223)
Q Consensus        84 ~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~l~l~~N~l~~~~~~-~~~~~~l~~l~~~  162 (223)
                      +|++|++++|.+++..+..|..+++|+.|++++|.+++..+..|..+++|+.|++++|++++..+. ......++.+++.
T Consensus       134 ~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~l~  213 (270)
T 2o6q_A          134 KLTYLSLGYNELQSLPKGVFDKLTSLKELRLYNNQLKRVPEGAFDKLTELKTLKLDNNQLKRVPEGAFDSLEKLKMLQLQ  213 (270)
T ss_dssp             TCCEEECCSSCCCCCCTTTTTTCTTCCEEECCSSCCSCCCTTTTTTCTTCCEEECCSSCCSCCCTTTTTTCTTCCEEECC
T ss_pred             CCCEEECCCCcCCccCHhHccCCcccceeEecCCcCcEeChhHhccCCCcCEEECCCCcCCcCCHHHhccccCCCEEEec
Confidence            999999999999977777799999999999999999988888899999999999999999865443 2446778899999


Q ss_pred             CCCCCCCCCC
Q 048080          163 GNENLCGGSR  172 (223)
Q Consensus       163 ~n~~~C~~~~  172 (223)
                      +|++.|+|..
T Consensus       214 ~N~~~c~c~~  223 (270)
T 2o6q_A          214 ENPWDCTCNG  223 (270)
T ss_dssp             SSCBCCSSSS
T ss_pred             CCCeeCCCcc
Confidence            9999999953



>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 223
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-07
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-04
d1ogqa_ 313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.003
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-07
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-06
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-06
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.003
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 72.7 bits (177), Expect = 1e-15
 Identities = 39/159 (24%), Positives = 62/159 (38%), Gaps = 29/159 (18%)

Query: 3   PPSLGNCQNLILLTTCKNKLSGTVPRQLLRIITRSVLLDLFDNLLSGHFP---------- 52
             +L +  NL  L    N++S   P   L  +T    L L  N +S   P          
Sbjct: 234 IGTLASLTNLTDLDLANNQISNLAPLSGLTKLTE---LKLGANQISNISPLAGLTALTNL 290

Query: 53  ----------AEVGNLKHLVSLDISSNMFSGEIPTTLGGCTSLEHLSMQDNSFTGSIPST 102
                     + + NLK+L  L +  N  S   P  +   T L+ L   +N  +    S+
Sbjct: 291 ELNENQLEDISPISNLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSS 346

Query: 103 LSSLKSITELDLSRNNLSGHIPQYLENLSFLSFLNLSYN 141
           L++L +I  L    N +S   P  L NL+ ++ L L+  
Sbjct: 347 LANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.79
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.78
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.76
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.69
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.69
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.63
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.62
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.62
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.59
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.57
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.55
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.55
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.49
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.46
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.19
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.1
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.93
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.92
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.89
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.79
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.75
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.69
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.68
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.66
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.16
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.89
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.56
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.25
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=2.1e-24  Score=168.96  Aligned_cols=164  Identities=27%  Similarity=0.247  Sum_probs=115.1

Q ss_pred             CCCCCCCCCCCCeeecccCccccCCChhhhhccCCceEEEccCCcccccCCcCCCCCCCCCeEeccCcccc---------
Q 048080            2 RPPSLGNCQNLILLTTCKNKLSGTVPRQLLRIITRSVLLDLFDNLLSGHFPAEVGNLKHLVSLDISSNMFS---------   72 (223)
Q Consensus         2 ip~~~~~l~~L~~L~l~~n~i~~~~p~~~~~~~~~l~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~---------   72 (223)
                      ||+.+.  +++++|+|++|+|+ .+|...|..++.|++|+|++|.++...  .+..+++|++|++++|.++         
T Consensus        25 iP~~lp--~~l~~L~Ls~N~i~-~l~~~~f~~l~~L~~L~L~~N~l~~l~--~~~~l~~L~~L~Ls~N~l~~~~~~~~~l   99 (266)
T d1p9ag_          25 LPPDLP--KDTTILHLSENLLY-TFSLATLMPYTRLTQLNLDRAELTKLQ--VDGTLPVLGTLDLSHNQLQSLPLLGQTL   99 (266)
T ss_dssp             CCSCCC--TTCCEEECTTSCCS-EEEGGGGTTCTTCCEEECTTSCCCEEE--CCSCCTTCCEEECCSSCCSSCCCCTTTC
T ss_pred             eCcCcC--cCCCEEECcCCcCC-CcCHHHhhccccccccccccccccccc--cccccccccccccccccccccccccccc
Confidence            455443  45666666666666 566555555666666666666665332  2344555555555555554         


Q ss_pred             --------------ccCCccccCCCCCcEEEcccCcccccCCccccCCCCCCEEECCCCccccccchhhhCCCCCCEEec
Q 048080           73 --------------GEIPTTLGGCTSLEHLSMQDNSFTGSIPSTLSSLKSITELDLSRNNLSGHIPQYLENLSFLSFLNL  138 (223)
Q Consensus        73 --------------~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~l~l  138 (223)
                                    +..+..+..+.+++.|++++|.++...+..+..++.++.+++++|++++..+..|..+++|+.|++
T Consensus       100 ~~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N~l~~~~~~~~~~l~~L~~L~L  179 (266)
T d1p9ag_         100 PALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLL  179 (266)
T ss_dssp             TTCCEEECCSSCCCCCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTSCCSCCCTTTTTTCTTCCEEEC
T ss_pred             cccccccccccccceeeccccccccccccccccccccceeccccccccccchhcccccccccccCccccccccccceeec
Confidence                          344444455555666666666666566667778899999999999999888888999999999999


Q ss_pred             cCCcCcccCCc-hhhhcCCcceeecCCCCCCCCC
Q 048080          139 SYNHFEGKVPI-EAIFNSTKGISLVGNENLCGGS  171 (223)
Q Consensus       139 ~~N~l~~~~~~-~~~~~~l~~l~~~~n~~~C~~~  171 (223)
                      ++|+++ .+|. ......++.+++.+|||.|+|.
T Consensus       180 s~N~L~-~lp~~~~~~~~L~~L~L~~Np~~CdC~  212 (266)
T d1p9ag_         180 QENSLY-TIPKGFFGSHLLPFAFLHGNPWLCNCE  212 (266)
T ss_dssp             CSSCCC-CCCTTTTTTCCCSEEECCSCCBCCSGG
T ss_pred             ccCCCc-ccChhHCCCCCCCEEEecCCCCCCCcc
Confidence            999999 5553 3456778999999999999984



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure