Citrus Sinensis ID: 048085

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MEDIGLVKQGWKWLQSQKHVFSRAQTRLGCFRDKMGVLIERHWPMVCSGCAKSGALLLLLLVHWKDCLVRGVQSMIKLGSSSLFIIMWSCFLSLTSMSCLLYVLLSMGAAGAAVRYLGYTPGLFIVGLFAILVLWMFANFWITGTLFIVGGYLFSLSHARLVVLMATFYSVYCVKVSVGWFGVFLSINLAFFSSDLLNYLLQLCDNVSENSHIEEQKESETVTEDGFSGGSEYSIPTDEPERVHSFKSSTKSAATSSVINLPKECSSSKFVKEETSSNDEMKRIINCMDHYETLGFPRHKKIDAAVLKKEYRKKAMLVHPDKNMGSPLASESFKKLQCAYE
cccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccEEEccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcc
MEDIGLVKQGWKWLQSQKHVFSRAQTRLgcfrdkmgvlierhwpmvcsgcAKSGALLLLLLVHWKDCLVRGVQSMIKLGSSSLFIIMWSCFLSLTSMSCLLYVLLSMGAAGAAVRYLGYTPGLFIVGLFAILVLWMFANFWITGTLFIVGGYLFSLSHARLVVLMATFYSVYCVKVSVGWFGVFLSINLAFFSSDLLNYLLQLCDnvsenshieeqkesetvtedgfsggseysiptdepervhsfksstksaatssvinlpkecssskfvkeetssnDEMKRIINCMDhyetlgfprhkkiDAAVLKKEYRKKAmlvhpdknmgsplasESFKKLQCAYE
MEDIGLVKQGWKWLQSQKHVFSRAQTRLGCFRDKMGVLIERHWPMVCSGCAKSGALLLLLLVHWKDCLVRGVQSMIKLGSSSLFIIMWSCFLSLTSMSCLLYVLLSMGAAGAAVRYLGYTPGLFIVGLFAILVLWMFANFWITGTLFIVGGYLFSLSHARLVVLMATFYSVYCVKVSVGWFGVFLSINLAFFSSDLLNYLLQLCDNVSENshieeqkesetvtedgfsgGSEYSIPTDEPERVHSFKSstksaatssvinlpkecssskfvkeetssndemKRIINCMDHyetlgfprhkKIDAAVLKKEYRKKAMlvhpdknmgsplasesfkklqcaye
MEDIGLVKQGWKWLQSQKHVFSRAQTRLGCFRDKMGVLIERHWPMVCSGCAKSGAllllllVHWKDCLVRGVQSMIKLGSSSLFIIMWSCFLSLTSMSCLLYVLLSMGAAGAAVRYLGYTPGLFIVGLFAILVLWMFANFWITGTLFIVGGYLFSLSHARLVVLMATFYSVYCVKVSVGWFGVFLSINLAFFSSDLLNYLLQLCDNVSENSHIEEQKESETVTEDGFSGGSEYSIPTDEPERVHSFksstksaatssVINLPKECSSSKFVKEETSSNDEMKRIINCMDHYETLGFPRHKKIDAAVLKKEYRKKAMLVHPDKNMGSPLASESFKKLQCAYE
***IGLVKQGWKWLQSQKHVFSRAQTRLGCFRDKMGVLIERHWPMVCSGCAKSGALLLLLLVHWKDCLVRGVQSMIKLGSSSLFIIMWSCFLSLTSMSCLLYVLLSMGAAGAAVRYLGYTPGLFIVGLFAILVLWMFANFWITGTLFIVGGYLFSLSHARLVVLMATFYSVYCVKVSVGWFGVFLSINLAFFSSDLLNYLLQLCDNV***************************************************************************RIINCMDHYETLGFPRHKKIDAAVLKKEYRK****************************
**DIGLVKQGWKWLQSQKHVFSRAQTRLGCFRDKMGVLIERHWPMVCSGCAKSGALLLLLLVHWKDCLVRGVQSMIKLGSSSLFIIMWSCFLSLTSMSCLLYVLLSMGAAGAAVRYLGYTPGLFIVGLFAILVLWMFANFWITGTLFIVGGYLFSLSHARLVVLMATFYSVYCVKVSVGWFGVFLSINLAFFSSDLLNYLL***********************************************************************************INCMDHYETLGFPRHKKIDAAVLKKEYRKKAMLVHPDKNMGSPLASESFKKLQCAYE
MEDIGLVKQGWKWLQSQKHVFSRAQTRLGCFRDKMGVLIERHWPMVCSGCAKSGALLLLLLVHWKDCLVRGVQSMIKLGSSSLFIIMWSCFLSLTSMSCLLYVLLSMGAAGAAVRYLGYTPGLFIVGLFAILVLWMFANFWITGTLFIVGGYLFSLSHARLVVLMATFYSVYCVKVSVGWFGVFLSINLAFFSSDLLNYLLQLCDNVSENS******************GSEYSI***********************INLPKEC*************DEMKRIINCMDHYETLGFPRHKKIDAAVLKKEYRKKAMLVHPDKNMGSPLAS***********
*EDIGLVKQGWKWLQSQKHVFSRAQTRLGCFRDKMGVLIERHWPMVCSGCAKSGALLLLLLVHWKDCLVRGVQSMIKLGSSSLFIIMWSCFLSLTSMSCLLYVLLSMGAAGAAVRYLGYTPGLFIVGLFAILVLWMFANFWITGTLFIVGGYLFSLSHARLVVLMATFYSVYCVKVSVGWFGVFLSINLAFFSSDLLNYLLQLCDNV*********************************************************************SNDEMKRIINCMDHYETLGFPRHKKIDAAVLKKEYRKKAMLVHPDKNMGSPLASESFKKLQC*YE
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDIGLVKQGWKWLQSQKHVFSRAQTRLGCFRDKMGVLIERHWPMVCSGCAKSGALLLLLLVHWKDCLVRGVQSMIKLGSSSLFIIMWSCFLSLTSMSCLLYVLLSMGAAGAAVRYLGYTPGLFIVGLFAILVLWMFANFWITGTLFIVGGYLFSLSHARLVVLMATFYSVYCVKVSVGWFGVFLSINLAFFSSDLLNYLLQLCDNVSENSHIEEQKESETVTEDGFSGGSEYSIPTDEPERVHSFKSSTKSAATSSVINLPKECSSSKFVKEETSSNDEMKRIINCMDHYETLGFPRHKKIDAAVLKKEYRKKAMLVHPDKNMGSPLASESFKKLQCAYE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query341 2.2.26 [Sep-21-2011]
Q58DR2 370 DnaJ homolog subfamily B yes no 0.284 0.262 0.330 4e-07
Q9QYI4 376 DnaJ homolog subfamily B yes no 0.293 0.265 0.355 5e-06
Q0AIY0 369 Chaperone protein DnaJ OS yes no 0.149 0.138 0.509 6e-06
Q3ZBA6 358 DnaJ homolog subfamily B no no 0.164 0.156 0.448 8e-06
Q9NXW2 375 DnaJ homolog subfamily B yes no 0.284 0.258 0.311 8e-06
O06431 369 Chaperone protein DnaJ OS yes no 0.149 0.138 0.509 8e-06
B1ZUS0 382 Chaperone protein DnaJ OS yes no 0.149 0.133 0.528 8e-06
Q3AQP5 400 Chaperone protein DnaJ OS yes no 0.149 0.127 0.509 8e-06
Q5RAJ6 358 DnaJ homolog subfamily B no no 0.164 0.156 0.448 9e-06
Q9UBS4 358 DnaJ homolog subfamily B yes no 0.164 0.156 0.448 9e-06
>sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 Back     alignment and function desciption
 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 9/106 (8%)

Query: 238 DEPERVHSFKSSTKSAATSSVINLPKEC---SSSKFVKEETSSNDEMKRIINCMDHYETL 294
           D+P+   +  ++ + AA ++  +   E    S+  +  E+ ++   +KR+  C D+YE L
Sbjct: 59  DQPQPTEATHTTHRKAAGANTASANGEAGGESTKGYTAEQVAA---VKRVKQCKDYYEIL 115

Query: 295 GFPRHKKIDAAVLKKEYRKKAMLVHPDKNMGSPLASESFKKLQCAY 340
           G  R    +   LKK YRK A+  HPDKN  +P A+E+FK +  AY
Sbjct: 116 GVSRGASDED--LKKAYRKLALKFHPDKNH-APGATEAFKAIGTAY 158

Bos taurus (taxid: 9913)
>sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=2 SV=2 Back     alignment and function description
>sp|Q0AIY0|DNAJ_NITEC Chaperone protein DnaJ OS=Nitrosomonas eutropha (strain C91) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q3ZBA6|DJB11_BOVIN DnaJ homolog subfamily B member 11 OS=Bos taurus GN=DNAJB11 PE=2 SV=1 Back     alignment and function description
>sp|Q9NXW2|DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens GN=DNAJB12 PE=1 SV=4 Back     alignment and function description
>sp|O06431|DNAJ_NITEU Chaperone protein DnaJ OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dnaJ PE=3 SV=2 Back     alignment and function description
>sp|B1ZUS0|DNAJ_OPITP Chaperone protein DnaJ OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q3AQP5|DNAJ_CHLCH Chaperone protein DnaJ OS=Chlorobium chlorochromatii (strain CaD3) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q5RAJ6|DJB11_PONAB DnaJ homolog subfamily B member 11 OS=Pongo abelii GN=DNAJB11 PE=2 SV=1 Back     alignment and function description
>sp|Q9UBS4|DJB11_HUMAN DnaJ homolog subfamily B member 11 OS=Homo sapiens GN=DNAJB11 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
255578160 554 heat shock protein binding protein, puta 1.0 0.615 0.730 1e-150
449460044 557 PREDICTED: uncharacterized protein LOC10 0.997 0.610 0.733 1e-144
449529493 557 PREDICTED: uncharacterized LOC101216675 0.997 0.610 0.733 1e-144
356556949 561 PREDICTED: uncharacterized protein LOC10 1.0 0.607 0.680 1e-134
359494470 553 PREDICTED: uncharacterized protein LOC10 1.0 0.616 0.685 1e-134
356525817 562 PREDICTED: uncharacterized protein LOC10 1.0 0.606 0.669 1e-132
297842693 537 hypothetical protein ARALYDRAFT_340056 [ 1.0 0.635 0.684 1e-130
334182627 554 puttaive S-locus protein 5 [Arabidopsis 1.0 0.615 0.667 1e-123
3152572 577 Contains homology to DNAJ heatshock prot 1.0 0.590 0.684 1e-122
334184007 561 DNAJ heat shock N-terminal domain-contai 1.0 0.607 0.684 1e-122
>gi|255578160|ref|XP_002529949.1| heat shock protein binding protein, putative [Ricinus communis] gi|223530547|gb|EEF32426.1| heat shock protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  537 bits (1384), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 249/341 (73%), Positives = 295/341 (86%)

Query: 1   MEDIGLVKQGWKWLQSQKHVFSRAQTRLGCFRDKMGVLIERHWPMVCSGCAKSGALLLLL 60
           MEDIGLVKQGWKWLQSQK+ + R +T   C RDK+GV IERHWP+V SG  + G L+  L
Sbjct: 1   MEDIGLVKQGWKWLQSQKYAYLRVKTTALCLRDKIGVFIERHWPLVSSGFVRFGWLVSFL 60

Query: 61  LVHWKDCLVRGVQSMIKLGSSSLFIIMWSCFLSLTSMSCLLYVLLSMGAAGAAVRYLGYT 120
           L++WKDC +RG+QS++KLGS++L +IMWSCFLSLTSMSC+LYVLLSMG AGAAV+YLGYT
Sbjct: 61  LIYWKDCFIRGLQSVVKLGSAALLLIMWSCFLSLTSMSCVLYVLLSMGTAGAAVQYLGYT 120

Query: 121 PGLFIVGLFAILVLWMFANFWITGTLFIVGGYLFSLSHARLVVLMATFYSVYCVKVSVGW 180
           PGLFIVGLFAIL+LWM+ANFWITGTLFIVGGYLFSL+HARLVVLMAT Y++YCVKV VGW
Sbjct: 121 PGLFIVGLFAILILWMYANFWITGTLFIVGGYLFSLNHARLVVLMATIYAIYCVKVRVGW 180

Query: 181 FGVFLSINLAFFSSDLLNYLLQLCDNVSENSHIEEQKESETVTEDGFSGGSEYSIPTDEP 240
            GVFLSINL F S+D +N+LLQ CDN++E +HIEEQKESETV +D FS   E+S+PTDE 
Sbjct: 181 HGVFLSINLTFLSNDAVNFLLQWCDNINERTHIEEQKESETVMQDEFSTECEFSLPTDES 240

Query: 241 ERVHSFKSSTKSAATSSVINLPKECSSSKFVKEETSSNDEMKRIINCMDHYETLGFPRHK 300
           E++ S KSS+K A TS+V+N   E SS K V+EET+S DEM+RI+N +DHYE LGFPRHK
Sbjct: 241 EKLQSCKSSSKPATTSTVVNNQNESSSRKVVREETNSADEMRRILNSVDHYEALGFPRHK 300

Query: 301 KIDAAVLKKEYRKKAMLVHPDKNMGSPLASESFKKLQCAYE 341
           +IDA +L+KEYRKKAMLVHPDKNMGSPLASESFKK+QCAYE
Sbjct: 301 RIDATILRKEYRKKAMLVHPDKNMGSPLASESFKKIQCAYE 341

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449460044|ref|XP_004147756.1| PREDICTED: uncharacterized protein LOC101216675 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449529493|ref|XP_004171734.1| PREDICTED: uncharacterized LOC101216675 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356556949|ref|XP_003546782.1| PREDICTED: uncharacterized protein LOC100779992 [Glycine max] Back     alignment and taxonomy information
>gi|359494470|ref|XP_002270123.2| PREDICTED: uncharacterized protein LOC100242245 [Vitis vinifera] gi|296082786|emb|CBI21791.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356525817|ref|XP_003531518.1| PREDICTED: uncharacterized protein LOC100817237 [Glycine max] Back     alignment and taxonomy information
>gi|297842693|ref|XP_002889228.1| hypothetical protein ARALYDRAFT_340056 [Arabidopsis lyrata subsp. lyrata] gi|297335069|gb|EFH65487.1| hypothetical protein ARALYDRAFT_340056 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|334182627|ref|NP_173112.2| puttaive S-locus protein 5 [Arabidopsis thaliana] gi|332191361|gb|AEE29482.1| puttaive S-locus protein 5 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|3152572|gb|AAC17053.1| Contains homology to DNAJ heatshock protein gb|U32803 from Haemophilus influenzae [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334184007|ref|NP_178024.3| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|332198074|gb|AEE36195.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
TAIR|locus:2157804 695 AT5G49580 [Arabidopsis thalian 0.665 0.326 0.276 3.1e-46
WB|WBGene00001019 401 dnj-1 [Caenorhabditis elegans 0.398 0.339 0.295 5.6e-06
ZFIN|ZDB-GENE-070410-128 369 dnajb12b "DnaJ (Hsp40) homolog 0.211 0.195 0.417 5e-05
MGI|MGI:1931881 376 Dnajb12 "DnaJ (Hsp40) homolog, 0.202 0.183 0.4 5.1e-05
UNIPROTKB|Q58DR2 370 DNAJB12 "DnaJ homolog subfamil 0.202 0.186 0.4 8.4e-05
UNIPROTKB|J9P8A9 269 DNAJB11 "DnaJ homolog subfamil 0.158 0.200 0.464 0.00012
TAIR|locus:2202725 414 ARL2 "ARG1-like 2" [Arabidopsi 0.202 0.166 0.373 0.00013
ZFIN|ZDB-GENE-061110-138 380 zgc:153638 "zgc:153638" [Danio 0.222 0.2 0.395 0.00015
UNIPROTKB|Q9NXW2 375 DNAJB12 "DnaJ homolog subfamil 0.202 0.184 0.386 0.00019
UNIPROTKB|Q5T657 155 DNAJB5 "DnaJ homolog subfamily 0.146 0.322 0.452 0.00026
TAIR|locus:2157804 AT5G49580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 285 (105.4 bits), Expect = 3.1e-46, Sum P(2) = 3.1e-46
 Identities = 65/235 (27%), Positives = 117/235 (49%)

Query:    12 KWLQSQKHVFSRAQTRLGCFRDKMGVLIERHWPMVCSGCAKSGAXXXXXXVHWKDCLVRG 71
             K ++  + +    + R+   RD +   + + +P+V       G+      + W DC +RG
Sbjct:   159 KCMERHRPLIDSVKLRVYKGRDLVLTKMRQVFPVVFRWLMHFGSIILLLSLVWLDCAIRG 218

Query:    72 VQSMIKLGSSSLFIIMWSCFLSLTSMSCLL-YVLLSMGAAGAAVRYLGYTPGLFIVGLFA 130
               S I++G++S F IMW    S  SM  +  ++L+S+     A+ ++G+  G   + +  
Sbjct:   219 FDSFIRMGTASFFSIMWCGLFSAFSMFGMTKFILISVATVLVAL-FIGFVVGSVTLAISG 277

Query:   131 ILVLWMFANFWITGTLFIVGGYLFSLSHARLVVLMATFYSVYCVKVSVGWFGVFLSINLA 190
             +++LW++ +FW T      GG  F + H R+ + + T YSVY     VGW G+ L+ NLA
Sbjct:   278 LVLLWLYGSFWTTLLFLFFGGLAFMMKHERVALFIITVYSVYSALSYVGWLGLLLAFNLA 337

Query:   191 FFSSDLLNYLLQLCDNVSENSHIEEQKESETVTEDGFSGGSEYSIPTDEPERVHS 245
             F S+D L Y  +  + +++ S  +  + +E V +  F  G  +  P D    V S
Sbjct:   338 FISTDALIYFFK--NKINQQSTAD--RPTEPVNDSSFENGPGF--PGDRGPGVAS 386
GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
WB|WBGene00001019 dnj-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070410-128 dnajb12b "DnaJ (Hsp40) homolog, subfamily B, member 12b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1931881 Dnajb12 "DnaJ (Hsp40) homolog, subfamily B, member 12" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DR2 DNAJB12 "DnaJ homolog subfamily B member 12" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P8A9 DNAJB11 "DnaJ homolog subfamily B member 11" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TAIR|locus:2202725 ARL2 "ARG1-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061110-138 zgc:153638 "zgc:153638" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NXW2 DNAJB12 "DnaJ homolog subfamily B member 12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T657 DNAJB5 "DnaJ homolog subfamily B member 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00025780001
SubName- Full=Chromosome chr19 scaffold_35, whole genome shotgun sequence; (553 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
pfam0022663 pfam00226, DnaJ, DnaJ domain 1e-16
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 2e-14
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 2e-13
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 2e-11
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 7e-10
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 9e-09
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 1e-08
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 2e-08
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 5e-08
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 2e-07
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 3e-07
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 3e-07
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 5e-07
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 6e-07
COG2214 237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 2e-06
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 2e-06
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 2e-06
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 1e-05
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 1e-05
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 2e-05
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 3e-05
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 3e-05
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 4e-05
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 7e-05
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 1e-04
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 2e-04
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-04
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 2e-04
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 2e-04
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 3e-04
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 4e-04
PRK03578 176 PRK03578, hscB, co-chaperone HscB; Provisional 5e-04
COG1076 174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 0.001
PHA02624 647 PHA02624, PHA02624, large T antigen; Provisional 0.003
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 0.004
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information 
 Score = 72.9 bits (180), Expect = 1e-16
 Identities = 27/53 (50%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 289 DHYETLGFPRHKKIDAAVLKKEYRKKAMLVHPDKNMGSPLASESFKKLQCAYE 341
           D+YE LG PR        +KK YRK A+  HPDKN G P A E FK++  AYE
Sbjct: 1   DYYEILGVPRD--ASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYE 51

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|235133 PRK03578, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222912 PHA02624, PHA02624, large T antigen; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 341
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.5
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.49
PRK14279 392 chaperone protein DnaJ; Provisional 99.48
PRK14295 389 chaperone protein DnaJ; Provisional 99.43
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.42
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.41
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.35
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.29
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.26
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.21
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.18
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.16
PHA03102153 Small T antigen; Reviewed 99.12
PTZ00100116 DnaJ chaperone protein; Provisional 99.12
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.09
KOG1150 250 consensus Predicted molecular chaperone (DnaJ supe 99.02
PRK03578 176 hscB co-chaperone HscB; Provisional 98.99
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 98.97
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.84
PHA02624 647 large T antigen; Provisional 98.76
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.68
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.59
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.5
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 97.7
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 97.66
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.87
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 96.67
KOG0431453 consensus Auxilin-like protein and related protein 96.65
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 86.62
KOG3192 168 consensus Mitochondrial J-type chaperone [Posttran 86.15
PF14687112 DUF4460: Domain of unknown function (DUF4460) 82.78
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 81.53
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1e-41  Score=339.63  Aligned_cols=281  Identities=35%  Similarity=0.532  Sum_probs=224.2

Q ss_pred             hchhhHHHHHHhhhhhhhhhhhhHhhhhhhHhHHH-HhhhHHHHHHHHHhhhhhhhhhhHHHhhchhHHHHHHHHHHHHH
Q 048085           16 SQKHVFSRAQTRLGCFRDKMGVLIERHWPMVCSGC-AKSGALLLLLLVHWKDCLVRGVQSMIKLGSSSLFIIMWSCFLSL   94 (341)
Q Consensus        16 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~v~~~~-~~~~~~~~~~~~~w~~~~~rg~~s~~~~g~~~~~~~~w~~~~s~   94 (341)
                      +..|.+-.++...++.||.    ++++||.|+..+ +++|++.|++ .+|+||++||||+++|+|++++|+||||+++|.
T Consensus         3 ~~~~~~~~~~~~~~k~~~~----~~~~~p~~~~~~~~~~g~~~l~~-k~~~~~~~r~~~~~~~~~~a~~~s~~~s~~~s~   77 (490)
T KOG0720|consen    3 RHVPFIGVVKLRVYKGRDL----VLTKMPLVFSVVFMHNGSPILLL-KVWLDCAIRGFQSFIRMGTAPFFSIMWSTLVSA   77 (490)
T ss_pred             CCccceeeecccccchhhh----hhhcCCcccchhhccccCchhHh-HhhccccccCCcchhccCCcchhheeeeeeeec
Confidence            4455555566677777775    567788887776 5678888777 999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhccchhHHHHHHHHHHHHHHHhhhHhHHHHHhhccccccccchhHHHHHHHHHHHHHH
Q 048085           95 TSMSCLLYVLLSMGAAGAAVRYLGYTPGLFIVGLFAILVLWMFANFWITGTLFIVGGYLFSLSHARLVVLMATFYSVYCV  174 (341)
Q Consensus        95 ~~~~~~~~~l~~~~~~~~~~~~~g~~~~~~~v~~~~~~~lw~y~~fw~t~~~~~~gg~~~~~~h~r~~~~~~~~y~~y~~  174 (341)
                      +||.|+.|+++.|+++..++.|.|.++|..++++||+++||+| +||.+..+-.-  .+|+++|+     +.+.|+.|.+
T Consensus        78 ~s~~ql~~~~~~~~a~~~~~~~~g~~~~~~~l~~~g~~~l~l~-~~w~~~~~~~~--~~~~~~~~-----~~~~~~~~~~  149 (490)
T KOG0720|consen   78 NSMGQLTKFILIMVATVSVALYIGRVVGSVTLALFGLLLLWLY-SFWGTVLFSFN--LAFLSKDE-----LITVYSVYSA  149 (490)
T ss_pred             cccccccccccchhhhhhhheeccccCcceeeccchHHHHHHH-HhhcchhhhHH--HHHhhhhh-----eeccccceee
Confidence            9999999999999999999999999999999999999999999 99999888776  89999999     7899999999


Q ss_pred             hhhhhHHHHHHHHHHhhhhhHHHHHHhhhccCCCcCCcccccccccccccCCCCCCCCcCCCCCCcccccCCCCCCCCCC
Q 048085          175 KVSVGWFGVFLSINLAFFSSDLLNYLLQLCDNVSENSHIEEQKESETVTEDGFSGGSEYSIPTDEPERVHSFKSSTKSAA  254 (341)
Q Consensus       175 ~~~~gw~g~~l~~nl~f~s~d~l~~~Lq~~~n~~e~~~~erqk~~e~~~~d~F~g~~e~s~P~s~~E~~~s~~SSS~~as  254 (341)
                      -++.+|.+..+.+|+.++.-+...++-....+.+.--.     .-+.                        .+.+..+..
T Consensus       150 ~s~kt~w~~~~k~l~~~i~l~f~~~f~~~~~~~~~~~r-----~l~~------------------------vk~~~~e~g  200 (490)
T KOG0720|consen  150 LSYKTWWGLTLKLLRAVILLDFSIYFERNKIIQQTADR-----PLEP------------------------VKDSGAEEG  200 (490)
T ss_pred             eccchhhhhcchhhhhhhhhhcceeeeeehhhHHHHhh-----hcch------------------------hhhhccccC
Confidence            99999999999999999887766655543333220000     0000                        001111111


Q ss_pred             CccccCCCCCCCCcccccccCCc-hHHHHHhhccCCchhhcCCCCCCCCCHHHHHHHHHHHHHhhCCCCCCCChhHHHHH
Q 048085          255 TSSVINLPKECSSSKFVKEETSS-NDEMKRIINCMDHYETLGFPRHKKIDAAVLKKEYRKKAMLVHPDKNMGSPLASESF  333 (341)
Q Consensus       255 s~~~~~~~~e~s~s~~~~s~~~s-~~ei~ril~~~d~YeVLGV~~~~~as~~eIKkAYRkLALk~HPDKn~g~~~A~E~F  333 (341)
                      ..++..+..+..+....+.+.+. .+++.|.++..|+|.+|||+.+  +++++|||.|||+|..+|||||+ .|.|+|+|
T Consensus       201 ~~tv~~~~~g~~~e~~va~n~t~~adrl~re~~~~daYsvlGl~~d--~sd~~lKk~Yrk~A~LVhPDKn~-~~~A~Eaf  277 (490)
T KOG0720|consen  201 DETVESRDYGCKKEIPVATNATSFADRLSRELNILDAYSALGLPSD--CSDADLKKNYRKKAMLVHPDKNM-IPRAEEAF  277 (490)
T ss_pred             CCchhcCCcccccccccccchhhHHHhhhhhhcCCCchhhcCCCCC--CCHHHHHHHHHhhceEeCCCccC-ChhHHHHH
Confidence            11122222222223334444444 7788888899999999999998  99999999999999999999999 99999999


Q ss_pred             HHHHhhhC
Q 048085          334 KKLQCAYE  341 (341)
Q Consensus       334 k~L~~AYE  341 (341)
                      |.++.|||
T Consensus       278 k~Lq~Afe  285 (490)
T KOG0720|consen  278 KKLQVAFE  285 (490)
T ss_pred             HHHHHHHH
Confidence            99999996

>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 1e-04
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 1e-04
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-04
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-04
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 2e-04
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 3e-04
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 5e-04
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 5e-04
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 9e-04
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure 
Iteration: 1

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 3/53 (5%)
Query: 289 DHYETLGFPRHKKIDAAVLKKEYRKKAMLVHPDKNMGSPLASESFKKLQCAYE 341
           D+Y+TLG  R    +   +K+ YR++A+  HPDKN   P A E FK++  AY+
Sbjct: 4   DYYQTLGLARGASDEE--IKRAYRRQALRYHPDKNK-EPGAEEKFKEIAEAYD 53
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 4e-16
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 2e-14
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 8e-14
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 3e-13
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 6e-13
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 7e-13
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 9e-13
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 4e-12
3hho_A 174 CO-chaperone protein HSCB homolog; structural geno 5e-12
1fpo_A 171 HSC20, chaperone protein HSCB; molecular chaperone 6e-12
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 1e-11
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 2e-11
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 2e-11
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 3e-11
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 4e-11
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 5e-11
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 5e-11
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 6e-11
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 6e-11
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 7e-11
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 8e-11
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 1e-10
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 2e-10
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 4e-10
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 1e-09
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 4e-08
3uo3_A 181 J-type CO-chaperone JAC1, mitochondrial; structura 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 8e-08
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 9e-08
3bvo_A 207 CO-chaperone protein HSCB, mitochondrial precurso; 2e-07
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 1e-06
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 2e-05
2guz_A71 Mitochondrial import inner membrane translocase su 1e-04
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
 Score = 71.7 bits (176), Expect = 4e-16
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 6/80 (7%)

Query: 262 PKECSSSKFVKEETSSNDEMKRIINCMDHYETLGFPRHKKIDAAVLKKEYRKKAMLVHPD 321
               SS+ F KE+    D ++RI N  D ++ LG       D   + K YRK A+L+HPD
Sbjct: 4   GSSGSSASFTKEQA---DAIRRIRNSKDSWDMLGVKPGASRDE--VNKAYRKLAVLLHPD 58

Query: 322 KNMGSPLASESFKKLQCAYE 341
           K   +P + ++FK +  A  
Sbjct: 59  KC-VAPGSEDAFKAVVNART 77
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.65
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.58
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.57
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.55
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.54
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.54
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.54
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.53
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.53
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.53
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.52
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.52
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.52
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.52
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.49
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.47
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.47
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.44
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.43
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.39
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.37
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.36
2guz_A71 Mitochondrial import inner membrane translocase su 99.36
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.35
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.32
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.29
3bvo_A 207 CO-chaperone protein HSCB, mitochondrial precurso; 99.26
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.15
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.1
3uo3_A 181 J-type CO-chaperone JAC1, mitochondrial; structura 99.07
2guz_B65 Mitochondrial import inner membrane translocase su 98.23
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.22
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.65  E-value=1.2e-16  Score=127.57  Aligned_cols=62  Identities=34%  Similarity=0.553  Sum_probs=56.2

Q ss_pred             chHHHHHhhccCCchhhcCCCCCCCCCHHHHHHHHHHHHHhhCCCCCCCChhHHHHHHHHHhhhC
Q 048085          277 SNDEMKRIINCMDHYETLGFPRHKKIDAAVLKKEYRKKAMLVHPDKNMGSPLASESFKKLQCAYE  341 (341)
Q Consensus       277 s~~ei~ril~~~d~YeVLGV~~~~~as~~eIKkAYRkLALk~HPDKn~g~~~A~E~Fk~L~~AYE  341 (341)
                      ..+.+.++....|+|++|||+++  ++.+|||++||+++++|||||++ +++++++|++|++|||
T Consensus        16 ~~~~~~~~~~~~~~y~iLgv~~~--as~~eIk~aYr~la~~~HPDk~~-~~~~~~~f~~i~~Ay~   77 (90)
T 2ys8_A           16 QADAIRRIRNSKDSWDMLGVKPG--ASRDEVNKAYRKLAVLLHPDKCV-APGSEDAFKAVVNART   77 (90)
T ss_dssp             HHHHHHHHHTCSSHHHHHTCCTT--CCHHHHHHHHHHHHHHHCTTTCC-CTTHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhcCCCHHHHcCcCCC--CCHHHHHHHHHHHHHHHCcCCCC-CccHHHHHHHHHHHHH
Confidence            34556677788999999999999  99999999999999999999998 6789999999999996
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 341
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 9e-09
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 6e-08
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 3e-07
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 9e-06
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 1e-05
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 1e-05
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 4e-04
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 4e-04
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: HSC20 (HSCB), N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

 Score = 49.6 bits (118), Expect = 9e-09
 Identities = 12/59 (20%), Positives = 22/59 (37%), Gaps = 5/59 (8%)

Query: 288 MDHYETLGFPRHKKIDAAVLKKEYRKKAMLVHPDKNMGSPLAS-----ESFKKLQCAYE 341
           MD++   G P   ++D   L   ++      HPDK      A      +    +  A++
Sbjct: 1   MDYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATINQAWQ 59
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.63
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.52
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.5
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.45
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.39
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.35
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.26
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.63  E-value=1.4e-16  Score=121.89  Aligned_cols=53  Identities=38%  Similarity=0.644  Sum_probs=50.5

Q ss_pred             cCCchhhcCCCCCCCCCHHHHHHHHHHHHHhhCCCCCCCChhHHHHHHHHHhhhC
Q 048085          287 CMDHYETLGFPRHKKIDAAVLKKEYRKKAMLVHPDKNMGSPLASESFKKLQCAYE  341 (341)
Q Consensus       287 ~~d~YeVLGV~~~~~as~~eIKkAYRkLALk~HPDKn~g~~~A~E~Fk~L~~AYE  341 (341)
                      .+|||++|||+++  +|.+|||+|||++++++||||+++++++++.|++|++||+
T Consensus         2 k~dyY~vLgv~~~--As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~   54 (75)
T d1xbla_           2 KQDYYEILGVSKT--AEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYE   54 (75)
T ss_dssp             CCCTTTTTCCSSS--CCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHH
T ss_pred             CCCHHHHcCCCCC--cCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHH
Confidence            4699999999999  9999999999999999999999988899999999999995
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure