Citrus Sinensis ID: 048108
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 193 | ||||||
| 357512127 | 1084 | Chaperone protein dnaJ [Medicago truncat | 0.761 | 0.135 | 0.395 | 1e-16 | |
| 255564086 | 753 | conserved hypothetical protein [Ricinus | 0.870 | 0.223 | 0.351 | 2e-16 | |
| 168046221 | 184 | predicted protein [Physcomitrella patens | 0.585 | 0.614 | 0.396 | 6e-16 | |
| 255542478 | 1131 | protein with unknown function [Ricinus c | 0.626 | 0.106 | 0.442 | 2e-15 | |
| 147772268 | 723 | hypothetical protein VITISV_018091 [Viti | 0.906 | 0.242 | 0.348 | 3e-15 | |
| 255559889 | 1130 | protein with unknown function [Ricinus c | 0.626 | 0.107 | 0.442 | 3e-15 | |
| 359485819 | 656 | PREDICTED: uncharacterized protein LOC10 | 0.906 | 0.266 | 0.348 | 3e-15 | |
| 298204992 | 804 | unnamed protein product [Vitis vinifera] | 0.772 | 0.185 | 0.331 | 6e-15 | |
| 359487946 | 1169 | PREDICTED: uncharacterized protein LOC10 | 0.569 | 0.094 | 0.406 | 6e-15 | |
| 359473614 | 1168 | PREDICTED: uncharacterized protein LOC10 | 0.611 | 0.101 | 0.398 | 7e-15 |
| >gi|357512127|ref|XP_003626352.1| Chaperone protein dnaJ [Medicago truncatula] gi|124360144|gb|ABN08160.1| Heat shock protein DnaJ [Medicago truncatula] gi|355501367|gb|AES82570.1| Chaperone protein dnaJ [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Score = 91.7 bits (226), Expect = 1e-16, Method: Compositional matrix adjust.
Identities = 64/162 (39%), Positives = 89/162 (54%), Gaps = 15/162 (9%)
Query: 13 AEKARDAAEEYFKLQNIDMAIKTLKAAKEFNPDLPNIDDYFTACRVH-----QLSETKST 67
A KA+ AE+ K + A+K K A+ P++ NI TAC VH +LS +
Sbjct: 8 ALKAKQIAEDRMKSGDFVGALKFAKKAQRLFPEIQNITQILTACEVHCAAQNKLSMSDMD 67
Query: 68 LYKILAITDPQVDISVIKKQFKKMALMLHPDKNSSVAADGAFKLIRSANNVLTDPGKRKA 127
Y IL +TD D + IKKQ+KK+AL+LHPDKN S A+ AFKLI AN VL+D KR
Sbjct: 68 WYGIL-LTDKFTDEATIKKQYKKLALLLHPDKNKSAGAEAAFKLIVDANRVLSDQTKRSL 126
Query: 128 FDNRIRLNKVKLMSCSCCRPQGA---GDNNSPRASTYKANNT 166
++ +I +L+ + PQG D N+ S Y ++T
Sbjct: 127 YNAKIS----RLVGITA--PQGPPYQADRNNYNTSFYSHSHT 162
|
Source: Medicago truncatula Species: Medicago truncatula Genus: Medicago Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255564086|ref|XP_002523041.1| conserved hypothetical protein [Ricinus communis] gi|223537724|gb|EEF39345.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|168046221|ref|XP_001775573.1| predicted protein [Physcomitrella patens subsp. patens] gi|162673128|gb|EDQ59656.1| predicted protein [Physcomitrella patens subsp. patens] | Back alignment and taxonomy information |
|---|
| >gi|255542478|ref|XP_002512302.1| protein with unknown function [Ricinus communis] gi|223548263|gb|EEF49754.1| protein with unknown function [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|147772268|emb|CAN67351.1| hypothetical protein VITISV_018091 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255559889|ref|XP_002520963.1| protein with unknown function [Ricinus communis] gi|223539800|gb|EEF41380.1| protein with unknown function [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359485819|ref|XP_002269946.2| PREDICTED: uncharacterized protein LOC100240890 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|298204992|emb|CBI34299.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359487946|ref|XP_002266568.2| PREDICTED: uncharacterized protein LOC100255461 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359473614|ref|XP_002271091.2| PREDICTED: uncharacterized protein LOC100257476 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 193 | ||||||
| TAIR|locus:2114880 | 1165 | AT3G04980 [Arabidopsis thalian | 0.523 | 0.086 | 0.415 | 1.7e-15 | |
| TAIR|locus:2122950 | 558 | AT4G19570 [Arabidopsis thalian | 0.839 | 0.290 | 0.300 | 6.7e-15 | |
| TAIR|locus:2169170 | 431 | AT5G37380 [Arabidopsis thalian | 0.642 | 0.287 | 0.356 | 1.7e-14 | |
| TAIR|locus:2122970 | 345 | AT4G19590 [Arabidopsis thalian | 0.450 | 0.252 | 0.466 | 3.1e-14 | |
| TAIR|locus:2081046 | 673 | AT3G06340 [Arabidopsis thalian | 0.611 | 0.175 | 0.379 | 1.8e-13 | |
| TAIR|locus:2151714 | 241 | AT5G37750 [Arabidopsis thalian | 0.849 | 0.680 | 0.289 | 5.6e-13 | |
| TAIR|locus:2182508 | 287 | AT5G37440 [Arabidopsis thalian | 0.621 | 0.418 | 0.325 | 2.1e-12 | |
| TAIR|locus:2065393 | 311 | AT2G01710 "AT2G01710" [Arabido | 0.880 | 0.546 | 0.304 | 6.3e-12 | |
| TAIR|locus:2040110 | 656 | AT2G25560 [Arabidopsis thalian | 0.772 | 0.227 | 0.298 | 1.9e-11 | |
| TAIR|locus:2180024 | 884 | AT5G18750 [Arabidopsis thalian | 0.611 | 0.133 | 0.354 | 3.7e-11 |
| TAIR|locus:2114880 AT3G04980 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 194 (73.4 bits), Expect = 1.7e-15, Sum P(2) = 1.7e-15
Identities = 44/106 (41%), Positives = 59/106 (55%)
Query: 32 AIKTLKAAKEFNPDLPNIDDYFTACRVHQLSETK----STLYKILAITDPQVDISVIKKQ 87
A K + A+ P+L NI T C VH + K Y +L + P D IKKQ
Sbjct: 9 AHKFVTKAQRLFPNLENIVQMMTICDVHSSAIKKIKGLDDWYGVLQV-QPYADADTIKKQ 67
Query: 88 FKKMALMLHPDKNSSVAADGAFKLIRSANNVLTDPGKRKAFDNRIR 133
++K+AL+LHPDKN A+ AFKL+ AN +L+D KR +DNR R
Sbjct: 68 YRKLALLLHPDKNKFAGAEAAFKLVGEANRLLSDQIKRSQYDNRYR 113
|
|
| TAIR|locus:2122950 AT4G19570 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2169170 AT5G37380 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122970 AT4G19590 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2081046 AT3G06340 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151714 AT5G37750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2182508 AT5G37440 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2065393 AT2G01710 "AT2G01710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040110 AT2G25560 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2180024 AT5G18750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| JGI17769 | hypothetical protein (184 aa) | ||||||||||
(Physcomitrella patens) | |||||||||||
| JGI73185 | • | 0.525 | |||||||||
| JGI38771 | • | 0.525 | |||||||||
| JGI19268 | • | 0.525 | |||||||||
| JGI145400 | • | 0.524 | |||||||||
| JGI171101 | • | 0.523 | |||||||||
| JGI39180 | • | 0.522 | |||||||||
| JGI17229 | • | 0.519 | |||||||||
| JGI167873 | • | 0.517 | |||||||||
| JGI187874 | • | 0.515 | |||||||||
| JGI161703 | • | 0.515 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 193 | |||
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 7e-15 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 5e-11 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 9e-11 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 2e-10 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 1e-09 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 1e-09 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 4e-09 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 5e-09 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 8e-09 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 2e-08 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 3e-08 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 6e-08 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 1e-07 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 1e-07 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 4e-07 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 7e-07 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 9e-07 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 2e-06 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 2e-06 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 4e-06 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 9e-06 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 1e-05 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 1e-05 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 1e-05 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 1e-05 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 2e-05 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 2e-05 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 2e-05 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 3e-05 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 4e-05 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 6e-05 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 1e-04 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 2e-04 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 3e-04 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 6e-04 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 6e-04 |
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
Score = 65.6 bits (161), Expect = 7e-15
Identities = 27/64 (42%), Positives = 35/64 (54%), Gaps = 2/64 (3%)
Query: 67 TLYKILAITDPQVDISVIKKQFKKMALMLHPDKNSS-VAADGAFKLIRSANNVLTDPGKR 125
Y+IL + IKK ++K+AL HPDKN AA+ FK I A VL+DP KR
Sbjct: 1 DYYEILGV-PRDASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEKR 59
Query: 126 KAFD 129
+D
Sbjct: 60 AIYD 63
|
DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63 |
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 193 | |||
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.96 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.92 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.89 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.89 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.88 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.87 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.87 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.87 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.86 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.86 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.86 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.86 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.86 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.85 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.85 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.85 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.84 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.84 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.84 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.84 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.84 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.84 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.84 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.84 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.84 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.83 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.83 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.83 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.82 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.82 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.82 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.81 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.81 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.8 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.79 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.79 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 99.78 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.78 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.76 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.74 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 99.73 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.7 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.7 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.69 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.68 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.68 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.65 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.65 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.61 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.6 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.54 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.52 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.48 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.48 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.43 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.38 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 99.37 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.35 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.29 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 99.25 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 99.21 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 99.18 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 99.18 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 99.07 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 98.47 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.42 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.29 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 97.69 | |
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 97.53 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.18 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 97.16 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 97.15 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 96.72 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 96.38 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 96.34 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 96.21 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 96.0 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 95.98 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 95.94 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 95.92 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 95.72 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 95.64 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 95.54 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 95.31 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 95.0 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 94.84 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 94.8 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 94.66 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 94.66 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 94.57 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 94.45 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 94.26 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 94.16 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 93.97 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 93.91 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 93.89 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 93.46 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 93.15 | |
| PF14863 | 141 | Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB | 93.04 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 92.81 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 92.73 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 92.7 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 92.48 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 92.24 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 92.21 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 91.79 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 91.65 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 91.42 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 91.17 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 90.61 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 90.42 | |
| TIGR03504 | 44 | FimV_Cterm FimV C-terminal domain. This protein is | 90.2 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 90.02 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 89.9 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 89.77 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 89.54 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 89.5 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 89.2 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 88.68 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 88.37 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 88.18 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 88.12 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 88.09 | |
| PF14901 | 94 | Jiv90: Cleavage inducing molecular chaperone | 87.6 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 87.0 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 86.29 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 86.29 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 86.25 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 86.1 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 86.08 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 85.89 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 85.71 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 85.51 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 85.39 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 84.98 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 84.41 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 84.3 | |
| PF13446 | 62 | RPT: A repeated domain in UCH-protein | 83.59 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 83.44 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 83.41 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 83.28 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 83.18 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 82.95 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 82.71 | |
| PF10475 | 291 | DUF2450: Protein of unknown function N-terminal do | 82.67 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 82.52 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 81.58 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 81.54 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 81.5 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 81.32 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 80.38 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 80.3 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 80.26 |
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.96 E-value=1.3e-29 Score=220.31 Aligned_cols=69 Identities=38% Similarity=0.569 Sum_probs=66.9
Q ss_pred ccchhhhhcCCCCCCCHHHHHHHHHHHHHhcCCCCCC-CchHHHHHHHHHHHHHHcCCCchhhhhhhhhhh
Q 048108 65 KSTLYKILAITDPQVDISVIKKQFKKMALMLHPDKNS-SVAADGAFKLIRSANNVLTDPGKRKAFDNRIRL 134 (193)
Q Consensus 65 ~~d~Y~vLgv~~~~a~~~~Ik~aYr~l~~~~HPDk~~-~~~a~~~f~~i~~Ay~vLsd~~~R~~YD~~~~~ 134 (193)
+.|||+|||| +++||.+|||+|||+||++||||+++ +++|+++|++|++||+|||||++|+.||+++..
T Consensus 3 ~~dyYeiLGV-~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~ 72 (371)
T COG0484 3 KRDYYEILGV-SKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHA 72 (371)
T ss_pred ccchhhhcCC-CCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCcc
Confidence 4799999999 99999999999999999999999999 889999999999999999999999999999876
|
|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >TIGR03504 FimV_Cterm FimV C-terminal domain | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF14901 Jiv90: Cleavage inducing molecular chaperone | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13446 RPT: A repeated domain in UCH-protein | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PF10475 DUF2450: Protein of unknown function N-terminal domain (DUF2450) ; InterPro: IPR019515 This entry represents Vacuolar protein sorting-associated protein 54, and is thought to be involved in retrograde transport from early and late endosomes to late Golgi found in eukaryotes, but its function is not known | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 193 | ||||
| 2ctp_A | 78 | Solution Structure Of J-Domain From Human Dnaj Subf | 1e-07 | ||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 3e-07 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 2e-06 | ||
| 2ctw_A | 109 | Solution Structure Of J-Domain From Mouse Dnaj Subf | 2e-06 | ||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 6e-06 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 8e-06 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 1e-05 | ||
| 2y4u_A | 450 | Crystal Structure Of Human P58(Ipk) In Space Group | 2e-05 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 3e-05 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 4e-05 | ||
| 2y4t_A | 450 | Crystal Structure Of The Human Co-Chaperone P58(Ipk | 5e-05 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 9e-05 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 1e-04 | ||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 3e-04 | ||
| 2ej7_A | 82 | Solution Structure Of The Dnaj Domain Of The Human | 4e-04 | ||
| 2cug_A | 88 | Solution Structure Of The J Domain Of The Pseudo Dn | 5e-04 | ||
| 2kqx_A | 73 | Nmr Structure Of The J-Domain (Residues 2-72) In Th | 8e-04 |
| >pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 | Back alignment and structure |
|
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 | Back alignment and structure |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
| >pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
| >pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 | Back alignment and structure |
| >pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 | Back alignment and structure |
| >pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 193 | |||
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 5e-15 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 7e-13 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 8e-12 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 9e-12 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 2e-11 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 2e-11 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 4e-11 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 4e-11 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 4e-11 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 6e-11 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 6e-11 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 9e-11 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 1e-10 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 2e-10 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 2e-10 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 3e-10 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 3e-10 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 4e-10 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 5e-10 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 5e-10 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 9e-10 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 1e-09 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 4e-09 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 1e-08 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 5e-08 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 7e-08 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 1e-07 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 5e-07 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 3e-06 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 4e-06 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 2e-05 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 8e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-04 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 4e-04 |
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
Score = 71.3 bits (175), Expect = 5e-15
Identities = 35/115 (30%), Positives = 51/115 (44%), Gaps = 5/115 (4%)
Query: 20 AEEYFKLQNIDMAIKTLKAAKEFNPDLPNIDDYFTACRVHQLSETKSTLYKILAITDPQV 79
AE Y + D AI+ + A+E N + I + + K YKIL +
Sbjct: 336 AEAYLIEEMYDEAIQDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGV-KRNA 394
Query: 80 DISVIKKQFKKMALMLHPDKNSSV----AADGAFKLIRSANNVLTDPGKRKAFDN 130
I K ++K+AL HPD + A+ F I +A VL+DP RK FD+
Sbjct: 395 KKQEIIKAYRKLALQWHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDD 449
|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 193 | |||
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.9 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.86 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.86 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.85 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.85 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.85 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.84 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.84 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.84 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.84 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.83 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.82 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.82 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.82 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.81 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.81 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.81 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.79 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.75 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.74 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.73 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.73 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.72 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.72 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.72 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.71 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 99.71 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.71 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.71 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.7 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.69 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.65 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.64 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.55 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 98.95 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 97.85 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 97.3 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 96.75 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 96.62 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 96.55 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 96.43 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 96.3 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 96.24 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 95.99 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 95.82 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 95.79 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 95.66 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 95.47 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 95.44 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 95.43 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 95.35 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 95.34 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 95.31 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 95.19 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 95.12 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 95.09 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 95.09 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 95.06 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 95.02 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 95.01 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 94.91 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 94.82 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 94.73 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 94.55 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 94.39 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 94.38 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 94.35 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 94.28 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 94.23 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 94.17 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 94.15 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 94.09 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 94.06 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 94.03 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 93.91 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 93.84 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 93.82 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 93.76 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 93.75 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 93.73 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 93.68 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 93.62 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 93.56 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 93.36 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 93.33 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 93.21 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 93.15 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 93.14 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 93.09 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 93.08 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 92.96 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 92.91 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 92.9 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 92.82 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 92.71 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 92.64 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 92.61 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 92.57 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 92.43 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 92.32 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 92.26 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 92.19 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 92.17 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 92.17 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 92.1 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 92.04 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 91.88 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 91.71 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 91.68 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 91.67 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 91.66 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 91.57 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 91.57 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 91.48 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 91.47 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 91.35 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 91.2 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 91.16 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 90.88 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 90.86 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 90.83 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 90.81 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 90.71 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 90.56 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 90.37 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 90.09 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 89.76 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 89.71 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 89.68 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 89.63 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 89.59 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 89.53 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 89.47 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 88.88 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 88.82 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 88.68 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 88.24 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 88.08 | |
| 2bx9_A | 53 | Anti-trap, AT, tryptophan RNA-binding attenuator p | 87.82 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 87.7 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 87.49 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 87.31 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 87.24 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 87.2 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 87.14 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 87.04 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 87.04 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 86.87 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 86.7 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 86.48 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 86.44 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 86.39 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 86.33 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 86.09 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 85.93 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 85.89 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 85.59 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 85.22 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 85.17 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 84.57 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 84.42 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 84.07 | |
| 3ax2_A | 73 | Mitochondrial import receptor subunit TOM20 homol; | 83.97 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 83.7 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 83.59 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 83.35 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 83.32 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 83.28 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 83.27 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 83.17 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 83.11 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 83.03 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 82.72 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 82.59 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 82.51 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 81.98 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 81.8 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 81.35 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 81.25 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 80.39 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 80.18 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 80.12 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 80.12 |
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.90 E-value=2.5e-24 Score=167.05 Aligned_cols=110 Identities=25% Similarity=0.377 Sum_probs=88.6
Q ss_pred cccchhhhhcCCCCCCCHHHHHHHHHHHHHhcCCCCCCCch-------HHHHHHHHHHHHHHcCCCchhhhhhhhhhh--
Q 048108 64 TKSTLYKILAITDPQVDISVIKKQFKKMALMLHPDKNSSVA-------ADGAFKLIRSANNVLTDPGKRKAFDNRIRL-- 134 (193)
Q Consensus 64 ~~~d~Y~vLgv~~~~a~~~~Ik~aYr~l~~~~HPDk~~~~~-------a~~~f~~i~~Ay~vLsd~~~R~~YD~~~~~-- 134 (193)
...|||+|||| +++++.++||++||+|++++|||+++... +.+.|+.|++||++|+||.+|+.||..+..
T Consensus 8 ~~~~~y~iLgv-~~~a~~~eIk~aYr~l~~~~HPDk~~~~~~~~~~~~a~~~f~~i~~Ay~~L~dp~~R~~Yd~~~~~~~ 86 (155)
T 2l6l_A 8 PKKDWYSILGA-DPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCEDD 86 (155)
T ss_dssp CCSHHHHHHTC-CTTCCHHHHHHHHHHHHHHHSCCCCCCCCTTHHHHHHHHHHHHHHHHHHHSSSHHHHCHHHHHHHHHH
T ss_pred CCCChhHhcCC-CCCCCHHHHHHHHHHHHHHHCcCCCCCCCchhHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHcchhh
Confidence 45899999999 99999999999999999999999987542 578999999999999999999999987643
Q ss_pred ---------------------cccccccCCCCCCCCCCCCCCcccccccCcceeeCCCCccccccCccCCCcceEec
Q 048108 135 ---------------------NKVKLMSCSCCRPQGAGDNNSPRASTYKANNTSCPRKYRAKAIFCQCQGRRKIVIL 190 (193)
Q Consensus 135 ---------------------~~~f~~~c~~c~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~C~~C~~~~~v~~ 190 (193)
...||+.|+ |+..+. +.+...+.. ..+.|++|+.-=.|+.
T Consensus 87 ~~~~~~~~~~~~~~~m~~~e~~~~f~~~Cr-CG~~f~------i~~~~l~~~---------~~v~C~sCSl~~~v~~ 147 (155)
T 2l6l_A 87 LRNVGPVDAQVYLEEMSWNEGDHSFYLSCR-CGGKYS------VSKDEAEEV---------SLISCDTCSLIIELLH 147 (155)
T ss_dssp HHTTCSSSEEEETTTSEEETTTTEEEEECS-SSCEEE------EETTHHHHC---------CEEECSSSSCEEEEEC
T ss_pred ccccccccceeeHHHhccccCCcEEEEcCC-CCCeEE------ecHHHhCCC---------CEEECCCCceEEEEEE
Confidence 346889996 997776 444433210 4577888877666654
|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 193 | ||||
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 8e-07 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 2e-06 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 2e-06 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 2e-06 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 1e-05 | |
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 3e-05 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 9e-05 |
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: HSP40 species: Human (Homo sapiens) [TaxId: 9606]
Score = 43.2 bits (101), Expect = 8e-07
Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 1/62 (1%)
Query: 69 YKILAITDPQVDISVIKKQFKKMALMLHPDKNSSVAADGAFKLIRSANNVLTDPGKRKAF 128
Y+ L + IK+ +++ AL HPDKN A+ FK I A +VL+DP KR+ F
Sbjct: 6 YQTLGL-ARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIF 64
Query: 129 DN 130
D
Sbjct: 65 DR 66
|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 193 | |||
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.89 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.87 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.85 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.8 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.75 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.74 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.71 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.64 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 96.93 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.52 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 96.52 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.5 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 96.47 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 96.47 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 96.37 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 96.32 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 96.22 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.11 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 96.04 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 95.5 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 95.34 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 95.23 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 95.13 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 94.99 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 94.92 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 94.6 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 94.37 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 94.25 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 94.15 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 94.11 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 93.86 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 93.46 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 93.19 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 92.75 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 92.37 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 92.1 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 90.67 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 89.52 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 88.73 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 88.65 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 88.39 | |
| d2cfua2 | 505 | Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI | 87.09 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 86.88 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 86.46 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 85.01 | |
| d2crba1 | 83 | Nuclear receptor binding factor 2, NRBF2, N-termin | 84.73 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 84.63 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 83.18 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 83.05 | |
| d1wfda_ | 93 | Hypothetical protein 1500032H18Rik {Mouse (Mus mus | 81.22 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 80.93 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 80.22 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 80.04 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Probab=99.89 E-value=9.2e-24 Score=143.65 Aligned_cols=69 Identities=36% Similarity=0.589 Sum_probs=64.4
Q ss_pred ccchhhhhcCCCCCCCHHHHHHHHHHHHHhcCCCCCCC-chHHHHHHHHHHHHHHcCCCchhhhhhhhhhh
Q 048108 65 KSTLYKILAITDPQVDISVIKKQFKKMALMLHPDKNSS-VAADGAFKLIRSANNVLTDPGKRKAFDNRIRL 134 (193)
Q Consensus 65 ~~d~Y~vLgv~~~~a~~~~Ik~aYr~l~~~~HPDk~~~-~~a~~~f~~i~~Ay~vLsd~~~R~~YD~~~~~ 134 (193)
+.|||+|||| +++||.++||++||++++++|||+++. +.+++.|..|++||+||+||.+|..||.+|..
T Consensus 2 k~dyY~vLgv-~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~ 71 (75)
T d1xbla_ 2 KQDYYEILGV-SKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHA 71 (75)
T ss_dssp CCCTTTTTCC-SSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTS
T ss_pred CCCHHHHcCC-CCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcc
Confidence 4799999999 999999999999999999999999874 66788899999999999999999999998853
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|