Citrus Sinensis ID: 048174
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1303 | 2.2.26 [Sep-21-2011] | |||||||
| P54697 | 2245 | Myosin-J heavy chain OS=D | yes | no | 0.673 | 0.390 | 0.396 | 0.0 | |
| Q9ULV0 | 1848 | Unconventional myosin-Vb | yes | no | 0.801 | 0.564 | 0.364 | 0.0 | |
| Q99104 | 1853 | Unconventional myosin-Va | yes | no | 0.645 | 0.453 | 0.419 | 0.0 | |
| P21271 | 1818 | Unconventional myosin-Vb | no | no | 0.627 | 0.449 | 0.413 | 0.0 | |
| Q9QYF3 | 1828 | Unconventional myosin-Va | yes | no | 0.645 | 0.460 | 0.417 | 0.0 | |
| Q9Y4I1 | 1855 | Unconventional myosin-Va | no | no | 0.645 | 0.453 | 0.417 | 0.0 | |
| P70569 | 1846 | Unconventional myosin-Vb | no | no | 0.626 | 0.442 | 0.408 | 0.0 | |
| Q02440 | 1829 | Unconventional myosin-Va | yes | no | 0.629 | 0.448 | 0.420 | 0.0 | |
| P08799 | 2116 | Myosin-2 heavy chain OS=D | no | no | 0.544 | 0.335 | 0.423 | 1e-178 | |
| Q875X3 | 1567 | Myosin-2A OS=Naumovozyma | yes | no | 0.652 | 0.542 | 0.392 | 1e-177 |
| >sp|P54697|MYOJ_DICDI Myosin-J heavy chain OS=Dictyostelium discoideum GN=myoJ PE=4 SV=2 | Back alignment and function desciption |
|---|
Score = 673 bits (1737), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 394/993 (39%), Positives = 571/993 (57%), Gaps = 116/993 (11%)
Query: 7 GADDMTKLSYLHEPGVLHNLATRYEINEIYTYTGNILIALNPFQPLSHLYDAYMMERYKG 66
G DD++ LS+LHEP +LHNL RY +N+IYTY G ILIA+NP+ L LY M+ Y G
Sbjct: 82 GVDDLSFLSHLHEPAILHNLHHRYNLNQIYTYIGKILIAINPYTSLP-LYGKEMISAYYG 140
Query: 67 VPFGKLSPHVFAIADAAYREMINEGKSNSILVSGESGAGKTETTKMIMRYLAYLGG---- 122
G L+PHV+A+A+ A+++M +G S SILVSGESGAGKTETTK +++Y A +G
Sbjct: 141 KQLGTLAPHVYAVAEDAFKDMRYDGTSQSILVSGESGAGKTETTKFLLQYFAAMGNMIKE 200
Query: 123 ----------HTAAEG----------------RSVEQQVLESNPVLEAFGNAKTVKNNNS 156
+T+++G +SVE++VLES P+LEAFGNAKT++N+NS
Sbjct: 201 STSSSSINGINTSSDGIPVTPPPSPMKKSPVDKSVEERVLESTPLLEAFGNAKTLRNDNS 260
Query: 157 SRFGKFVEIQFDKRGRISGAAIRTYLLERSRVCKISDPERNYHCFYLLCAAPPDEI-ERY 215
SRFGKF+EI F++ G I GA I TYLLE+SR+ + ERNYH FY L + +E+ E+
Sbjct: 261 SRFGKFIEIHFNEMGSIIGAKILTYLLEKSRIVRQVYNERNYHIFYQLLSGASEELKEKL 320
Query: 216 KLGNPTSFHYLNQSNCYELVGVNDANDYLATRRAMDVIGISRKEQDAIFGVVAAILHLGN 275
L + YLN+S C+E+ GV+D + T AM V GI+ EQ+ +F +++AIL +GN
Sbjct: 321 NLKTIEEYSYLNKSGCFEIEGVSDEEHFNKTCHAMQVAGITLVEQENVFRILSAILLIGN 380
Query: 276 IEFEK---GEEDSSVVKDNESKFHLQMTAKLLMC-DPGELEDALCKRVMITPEEIIKKSL 331
EFE +DS + D + L+ + LL C P EL +++ R ++T +E
Sbjct: 381 FEFENIAGSNDDSCQLIDRDP---LEKVSVLLGCAQPDELLNSMLTRKVVTGKESYISHN 437
Query: 332 DPVAATVSRDGLAKTIYSRLFDWLVDKIN--VSIGQDPHSKCLIGVLDIYGFESFESNSF 389
A +RD L+ +Y +FDWLV KIN +SI SK IGVLDIYGFESFE N F
Sbjct: 438 TKERAENARDSLSMFLYGMMFDWLVVKINSSMSISTQQKSKSFIGVLDIYGFESFEVNGF 497
Query: 390 EQFCINFTNEKLQQHFNQNVFKMEQNDYRNEEIDWSYVHFVDNQDVLDLIEKKPGGIIAL 449
EQFCIN+ NEKLQQ FNQ+VFK EQ +Y E+IDWSY+ F DNQD LDLIEKKP I+ L
Sbjct: 498 EQFCINYANEKLQQLFNQHVFKEEQQEYIKEKIDWSYIDFNDNQDTLDLIEKKPICILTL 557
Query: 450 LDEACMFPKSTHENFSQKLYQTFKDHKRFIKPKLTRSDFTIVHYAGEVHYQSDLFLDKNK 509
LDE MFPK+T + + KLY H +F KP+ + + FTI HYAG+V Y++D FLDKNK
Sbjct: 558 LDEETMFPKATPQTLATKLYSKMTSHSKFEKPRFSSTAFTINHYAGKVTYETDQFLDKNK 617
Query: 510 DYVVAEHQDLLSASECSFVSGLFP------------------PISEET-----TKSSKFS 546
D+++ E +L S SF+ L P S T + S KF
Sbjct: 618 DFIIPEQISILQRSNFSFIKVLMSHSDKFTQSPGGHPQGNGGPTSSNTKGTSGSSSMKFL 677
Query: 547 SIGSRFKLQLQQLMDTLNSTEPHYIRCVKPNNELKPVILDSNNVMQQLRSGGVLEAIRVK 606
S+GS+F L LM T+++T PHY+RC+KPN E P + +V+ QLR GGV+E++R+
Sbjct: 678 SVGSQFSTSLATLMKTISTTTPHYVRCIKPNPEKLPQTFNKQDVIHQLRCGGVMESVRIC 737
Query: 607 CAGYPTRKTFSEFLDRFGIL-LPEIRKQNY------------DEKIACKWILEKMDLKG- 652
CAG+PTR+ SEF R+ IL + +I + D KI + +L ++L
Sbjct: 738 CAGFPTRRLLSEFYQRYKILYVKDINTGSGGGKKGSNNNKIKDPKILVQNLLTGIELSDD 797
Query: 653 -YQIGKTKVFLKAGQMAELDAKRAKLLGHSAEVIQSQHRRRVTQKHYITLVQAAVCIQSS 711
Y+IG TKVFL+AGQ+A L+ R + L SA VIQ + + + +K Y L A++ IQ+
Sbjct: 798 KYKIGLTKVFLRAGQLASLEDMRLEQLDRSATVIQKRWKGYLYRKRYKQLRDASLIIQTK 857
Query: 712 CRGILARRYCKVKKKEAAAVKIQKNSRTMMTRKAYSNVKAAAIVLQAWLRARAAVRAMAA 771
R + A++ ++ +A+ IQK R R Y ++ A++ LQ +R
Sbjct: 858 LRSVHAKQQLSALQRTHSAILIQKVWRAHRDRVQYQKIRDASLQLQTVMRRH-------L 910
Query: 772 LSELRHRKHAK-GALSIQTSWR---GHRDFSYYKRLRKASVFSQSRWRGIAARREFRKLK 827
SE HR+ + A+ +QT R R+ K+LR + Q+RWR A+R + +L+
Sbjct: 911 FSEQVHRERCENAAIILQTKIRQILSKREVD--KKLR-GIILIQARWRMKLAKRVYIQLR 967
Query: 828 MTA-----------KKEERGQEI-----TESQESQEAVQYIVDETSEVKECDITNKGIEV 871
A K +E+ +E+ +E++ Q+ V + + E N +E+
Sbjct: 968 AEARSLRTVQEQKNKLQEKLEELQWRLTSEAKRKQQLEDQKVKSDTTISELSSNNDHLEL 1027
Query: 872 HVKECDTTDRAIEVYVKECDTKDRATEVHVEDC 904
+ E I++ +E D ++++++ + +C
Sbjct: 1028 QLSE-------IQLKYQELDKSNQSSQLQLSEC 1053
|
Processive motor protein that can move over long distances along F-actin without disassociating; processiveness depends on high physiological Mg(2+) concentrations. Presents a high actin affinity in the presence of ADP, fast ATP hydrolysis, and a high steady-state ATPase activity in the presence of actin that is rate limited by ADP release. Physiological decrease of free Mg(2+) ions leads to an increased rate of ADP release and shortening of the fraction of time it spends in the strong acting binding states. Dictyostelium discoideum (taxid: 44689) |
| >sp|Q9ULV0|MYO5B_HUMAN Unconventional myosin-Vb OS=Homo sapiens GN=MYO5B PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q99104|MYO5A_MOUSE Unconventional myosin-Va OS=Mus musculus GN=Myo5a PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P21271|MYO5B_MOUSE Unconventional myosin-Vb OS=Mus musculus GN=Myo5b PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9QYF3|MYO5A_RAT Unconventional myosin-Va OS=Rattus norvegicus GN=Myo5a PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Y4I1|MYO5A_HUMAN Unconventional myosin-Va OS=Homo sapiens GN=MYO5A PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P70569|MYO5B_RAT Unconventional myosin-Vb OS=Rattus norvegicus GN=Myo5b PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q02440|MYO5A_CHICK Unconventional myosin-Va OS=Gallus gallus GN=MYO5A PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P08799|MYS2_DICDI Myosin-2 heavy chain OS=Dictyostelium discoideum GN=mhcA PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q875X3|MYO2A_NAUCC Myosin-2A OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=MYO2A PE=3 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1303 | ||||||
| 225437826 | 1204 | PREDICTED: myosin-J heavy chain-like [Vi | 0.805 | 0.871 | 0.670 | 0.0 | |
| 147787627 | 1594 | hypothetical protein VITISV_019007 [Viti | 0.745 | 0.609 | 0.692 | 0.0 | |
| 359488002 | 1567 | PREDICTED: myosin-H heavy chain-like [Vi | 0.745 | 0.620 | 0.692 | 0.0 | |
| 296087917 | 1630 | unnamed protein product [Vitis vinifera] | 0.721 | 0.576 | 0.677 | 0.0 | |
| 255559995 | 1129 | myosin XI, putative [Ricinus communis] g | 0.794 | 0.916 | 0.669 | 0.0 | |
| 255561889 | 1533 | myosin XI, putative [Ricinus communis] g | 0.741 | 0.630 | 0.671 | 0.0 | |
| 449442963 | 1530 | PREDICTED: unconventional myosin-Vc-like | 0.762 | 0.649 | 0.662 | 0.0 | |
| 449483036 | 1530 | PREDICTED: LOW QUALITY PROTEIN: unconven | 0.762 | 0.649 | 0.661 | 0.0 | |
| 449465250 | 1122 | PREDICTED: myosin-J heavy chain-like [Cu | 0.780 | 0.906 | 0.642 | 0.0 | |
| 356574886 | 1537 | PREDICTED: myosin-Vc-like [Glycine max] | 0.747 | 0.633 | 0.669 | 0.0 |
| >gi|225437826|ref|XP_002263354.1| PREDICTED: myosin-J heavy chain-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1454 bits (3763), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 728/1085 (67%), Positives = 854/1085 (78%), Gaps = 36/1085 (3%)
Query: 1 MVSPAGGADDMTKLSYLHEPGVLHNLATRYEINEIYTYTGNILIALNPFQPLSHLYDAYM 60
M PA G DMTKLSYLHEPGVL NLA RYE+++IYTYTGNILIA+NPFQ L HLYD +
Sbjct: 127 MEFPAHGVADMTKLSYLHEPGVLQNLAIRYELSQIYTYTGNILIAINPFQGLPHLYDTHA 186
Query: 61 MERYKGVPFGKLSPHVFAIADAAYREMINEGKSNSILVSGESGAGKTETTKMIMRYLAYL 120
ME+YKG P G+LSPHVFAIAD AYR+M NEGK NSILVSGESGAGKTETTKM+MRYLAYL
Sbjct: 187 MEKYKGAPLGELSPHVFAIADVAYRDMANEGKGNSILVSGESGAGKTETTKMLMRYLAYL 246
Query: 121 GGHTAAEGRSVEQQVLESNPVLEAFGNAKTVKNNNSSRFGKFVEIQFDKRGRISGAAIRT 180
GG+T EGRSVEQ+VLESNPVLEAFGNAKTV+NNNSSRFGKFV IQFDK GRISGAAIRT
Sbjct: 247 GGNTVTEGRSVEQKVLESNPVLEAFGNAKTVRNNNSSRFGKFVVIQFDKHGRISGAAIRT 306
Query: 181 YLLERSRVCKISDPERNYHCFYLLCAAPPDEIERYKLGNPTSFHYLNQSNCYELVGVNDA 240
YLLERSRVC+ISDPERNYHCFY LCAAPP+EIERYKLGNP SFHYLNQSNC+EL+ VNDA
Sbjct: 307 YLLERSRVCQISDPERNYHCFYHLCAAPPEEIERYKLGNPKSFHYLNQSNCHELLDVNDA 366
Query: 241 NDYLATRRAMDVIGISRKEQDAIFGVVAAILHLGNIEFEKGEE-DSSVVKDNESKFHLQM 299
YLATRRAMD++GIS KEQ+AIF VVAAILHLGNI+F KGEE DSSV+KD+++KFHLQM
Sbjct: 367 QYYLATRRAMDIVGISEKEQEAIFRVVAAILHLGNIDFAKGEEVDSSVLKDDKAKFHLQM 426
Query: 300 TAKLLMCDPGELEDALCKRVMITPEEIIKKSLDPVAATVSRDGLAKTIYSRLFDWLVDKI 359
T++LLMCDP LEDALCKRVM+TPEE+IK+SLDP+ A VSRDGLAKTIYSRLFDWLV+KI
Sbjct: 427 TSELLMCDPHALEDALCKRVMVTPEEVIKRSLDPLGAAVSRDGLAKTIYSRLFDWLVNKI 486
Query: 360 NVSIGQDPHSKCLIGVLDIYGFESFESNSFEQFCINFTNEKLQQHFNQNVFKMEQNDYRN 419
N SIGQDP+SK IGVLDIYGFESF++NSFEQFCINFTNEKLQQHFNQ+VFKMEQ +Y
Sbjct: 487 NFSIGQDPNSKSTIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYSK 546
Query: 420 EEIDWSYVHFVDNQDVLDLIEKKPGGIIALLDEACMFPKSTHENFSQKLYQTFKDHKRFI 479
E IDWSY+ F+DNQDVLDLIEKKPGGIIALLDEACMFPKSTHE FS KLYQTFK HKRFI
Sbjct: 547 EGIDWSYIEFIDNQDVLDLIEKKPGGIIALLDEACMFPKSTHETFSNKLYQTFKVHKRFI 606
Query: 480 KPKLTRSDFTIVHYAGEVHYQSDLFLDKNKDYVVAEHQDLLSASECSFVSGLFPPISEET 539
KPKL R+DFTI HYAGEV YQSD FLDKNKDYVV EHQDLLSAS+C FV+GLFP +SEET
Sbjct: 607 KPKLARTDFTIAHYAGEVQYQSDQFLDKNKDYVVPEHQDLLSASKCCFVAGLFPLLSEET 666
Query: 540 TKSSKFSSIGSRFKLQLQQLMDTLNSTEPHYIRCVKPNNELKPVILDSNNVMQQLRSGGV 599
KSSKFSSIGS FKLQLQ LMDTLNST+PHYIRCVKPN LKP I ++ NVMQQLRSGGV
Sbjct: 667 MKSSKFSSIGSHFKLQLQHLMDTLNSTQPHYIRCVKPNTLLKPAIFENANVMQQLRSGGV 726
Query: 600 LEAIRVKCAGYPTRKTFSEFLDRFGILLPEIRKQNYDEKIACKWILEKMDLKGYQIGKTK 659
LEAIR+ CAGYPT +TFSEF++RF IL PE+ +N++EK C+ ILEK+ G+QIG TK
Sbjct: 727 LEAIRISCAGYPTHRTFSEFVNRFHILSPEVLTENHEEKFVCQKILEKLGFTGFQIGNTK 786
Query: 660 VFLKAGQMAELDAKRAKLLGHSAEVIQSQHRRRVTQKHYITLVQAAVCIQSSCRGILARR 719
VFL+AGQMAELDA+RA++ G++ ++IQ + R + +K Y+ L A + QS R +A +
Sbjct: 787 VFLRAGQMAELDARRAEVQGNAIKIIQRRTRTHIARKQYVALRVATIHAQSLWREKVACK 846
Query: 720 YCKVKKKEAAAVKIQKNSRTMMTRKAYSNVKAAAIVLQAWLRARAAVRAMAALSELRHRK 779
++E AA+KIQKN R + RK Y+ + + A+VLQ L RAMAA E R+RK
Sbjct: 847 LYAHMRQEGAAIKIQKNLRRHLARKVYTKLMSCALVLQTGL------RAMAAHDEFRYRK 900
Query: 780 HAKGALSIQTSWRGHRDFSYYKRLRKASVFSQSRWRGIAARREFRKLKMTAKK------- 832
K A+ IQ WR HRDFS YK+L++AS+ SQ WRG AR+E R+L + AK+
Sbjct: 901 ETKAAIIIQARWRCHRDFSCYKKLKRASIISQCGWRGRIARKELRQLSIAAKETGALQEA 960
Query: 833 ----EERGQEITESQESQEAVQYIVDETSEVKECDITNKGIEVHVKECDTTDRAIEVYVK 888
E++ +E+T S + + ++ ++E +E +E + + E D T+ + VK
Sbjct: 961 KAKLEKQVEELTRSLQLERRLRAELEEANE-QEITKLQQSLRAMRNEVDETN---ALLVK 1016
Query: 889 ECDTKDRATEVHVEDCDDIDRAIEPHPITGKIPCSNEEEEKIENLSAEVEKLKALLQAEK 948
EC+ +R+ E E PI + E+ +KI NLSAEVEKLKALLQ+EK
Sbjct: 1017 ECEAAERSFE-------------EAPPIIKETLSLVEDTDKINNLSAEVEKLKALLQSEK 1063
Query: 949 QRADDSARKCAEARVLSEKRLKKLEETERRVYQLQDSLNRLLYCMSEQFSQLKMILRSSS 1008
QRADD RK EA SE R K+LEETERRV QLQ+SLNR++Y MSEQ S LKMIL +SS
Sbjct: 1064 QRADDFERKLEEAEESSEARRKRLEETERRVQQLQESLNRMIYSMSEQVSALKMILHTSS 1123
Query: 1009 TSTSTSIPIVKEETFD-TSDNSDASSTDSDFTFPAPAPASANFSSFKPNALQLIVQDLSA 1067
S+STS I + + D S SDA+ST SDFTFP P P+S +SSF P+ALQ+IVQDLS
Sbjct: 1124 NSSSTSGSIARYDRVDVVSSTSDATSTASDFTFPTPVPSSVTYSSFHPDALQMIVQDLSV 1183
Query: 1068 TEITA 1072
TEI+
Sbjct: 1184 TEISG 1188
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147787627|emb|CAN71597.1| hypothetical protein VITISV_019007 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359488002|ref|XP_002263591.2| PREDICTED: myosin-H heavy chain-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296087917|emb|CBI35200.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255559995|ref|XP_002521016.1| myosin XI, putative [Ricinus communis] gi|223539853|gb|EEF41433.1| myosin XI, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255561889|ref|XP_002521953.1| myosin XI, putative [Ricinus communis] gi|223538757|gb|EEF40357.1| myosin XI, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449442963|ref|XP_004139250.1| PREDICTED: unconventional myosin-Vc-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449483036|ref|XP_004156476.1| PREDICTED: LOW QUALITY PROTEIN: unconventional myosin-Vc-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449465250|ref|XP_004150341.1| PREDICTED: myosin-J heavy chain-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356574886|ref|XP_003555574.1| PREDICTED: myosin-Vc-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1303 | ||||||
| TAIR|locus:2199449 | 1529 | XIE [Arabidopsis thaliana (tax | 0.748 | 0.637 | 0.618 | 0.0 | |
| TAIR|locus:2025535 | 1538 | XIC [Arabidopsis thaliana (tax | 0.752 | 0.637 | 0.618 | 0.0 | |
| TAIR|locus:2149932 | 1545 | XIK [Arabidopsis thaliana (tax | 0.757 | 0.638 | 0.593 | 2.4e-312 | |
| TAIR|locus:2085340 | 1242 | XIJ [Arabidopsis thaliana (tax | 0.686 | 0.720 | 0.641 | 2.8e-311 | |
| TAIR|locus:2007938 | 1520 | MYA1 "myosin 1" [Arabidopsis t | 0.745 | 0.638 | 0.594 | 1.1e-307 | |
| TAIR|locus:2020270 | 1500 | XIB "myosin XI B" [Arabidopsis | 0.755 | 0.656 | 0.554 | 2.7e-290 | |
| TAIR|locus:2197773 | 1730 | XIA "myosin XI A" [Arabidopsis | 0.728 | 0.548 | 0.570 | 5.8e-288 | |
| TAIR|locus:2045198 | 1556 | XIF "myosin-like protein XIF" | 0.766 | 0.642 | 0.541 | 7.6e-286 | |
| TAIR|locus:2046570 | 1770 | XID "myosin XI D" [Arabidopsis | 0.720 | 0.530 | 0.573 | 9.4e-286 | |
| TAIR|locus:2117768 | 1516 | XIH [Arabidopsis thaliana (tax | 0.722 | 0.620 | 0.553 | 3.9e-282 |
| TAIR|locus:2199449 XIE [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3126 (1105.5 bits), Expect = 0., P = 0.
Identities = 614/992 (61%), Positives = 748/992 (75%)
Query: 1 MVSPAGGADDMTKLSYLHEPGVLHNLATRYEINEIYTYTGNILIALNPFQPLSHLYDAYM 60
M +PAGG DDMTKLSYLHEPGVL NL RYE+NEIYTYTGNILIA+NPFQ L H+YDA+M
Sbjct: 60 MEAPAGGVDDMTKLSYLHEPGVLQNLKIRYELNEIYTYTGNILIAINPFQRLPHIYDAHM 119
Query: 61 MERYKGVPFGKLSPHVFAIADAAYREMINEGKSNSILVSGESGAGKTETTKMIMRYLAYL 120
M++YKG PFG+LSPHVFA+AD AYR MINEGKSNSILVSGESGAGKTETTKM+MRYLAYL
Sbjct: 120 MQQYKGAPFGELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMRYLAYL 179
Query: 121 GGHTAAEGRSVEQQVLESNPVLEAFGNAKTVKNNNSSRFGKFVEIQFDKRGRISGAAIRT 180
GG EGR+VEQQVLESNPVLEAFGNAKTV+NNNSSRFGKFVEIQFDK+GRISGAA+RT
Sbjct: 180 GGRAVTEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAVRT 239
Query: 181 YLLERSRVCKISDPERNYHCFYLLCAAPPDEIERYKLGNPTSFHYLNQSNCYELVGVNDA 240
YLLERSRVC+ISDPERNYHCFYLLCAAP +E+E+YKLG+P +FHYLNQS C+ELVG++DA
Sbjct: 240 YLLERSRVCQISDPERNYHCFYLLCAAPQEELEKYKLGHPKTFHYLNQSKCFELVGISDA 299
Query: 241 NDYLATRRAMDVIGISRKEQDAIFGVVAAILHLGNIEFEKGEE-DSSVVKDNESKFHLQM 299
+DY+ATRRAMD++G+S KEQ+AIF VVAAILHLGN+EF KG+E DSSV KD++SKFHL
Sbjct: 300 HDYIATRRAMDIVGMSEKEQEAIFRVVAAILHLGNVEFTKGKEVDSSVPKDDKSKFHLNT 359
Query: 300 TAKLLMCDPGELEDALCKRVMITPEEIIKKSLDPVAATVSRDGLAKTIYSRLFDWLVDKI 359
A+LLMCD LEDALCKRVM+TPEE+IK+SLDP +A +SRDGLAKTIYSRLFDWLV+KI
Sbjct: 360 VAELLMCDVKALEDALCKRVMVTPEEVIKRSLDPQSALISRDGLAKTIYSRLFDWLVEKI 419
Query: 360 NVSIGQDPHSKCLIGVLDIYGXXXXXXXXXXQFCINFTNEKLQQHFNQNVFKMEQNDYRN 419
NVSIGQD S+ LIGVLDIYG QFCINFTNEKLQQHFNQ+VFKMEQ +Y
Sbjct: 420 NVSIGQDATSRSLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYTK 479
Query: 420 EEIDWSYVHFVDNQDVLDLIEKKPGGIIALLDEACMFPKSTHENFSQKLYQTFKDHKRFI 479
E IDWSY+ FVDNQDVLDLIEKKPGGI+ALLDEACMFPKSTHE F+ KLYQTFK HKRFI
Sbjct: 480 EAIDWSYIEFVDNQDVLDLIEKKPGGIVALLDEACMFPKSTHETFANKLYQTFKTHKRFI 539
Query: 480 KPKLTRSDFTIVHYAGEVHYQSDLFLDKNKDYVVAEHQDLLSASECSFVSGLFPPXXXXX 539
KPKL+R+DF + HYAGEV YQSDLFLDKNKDYV+ EHQDLL AS+C FV GLFPP
Sbjct: 540 KPKLSRTDFAVAHYAGEVQYQSDLFLDKNKDYVIPEHQDLLGASKCPFVVGLFPPLPEET 599
Query: 540 XXXXXXXXXGSRFKLQLQQLMDTLNSTEPHYIRCVKPNNELKPVILDSNNVMQQLRSGGV 599
GSRFKLQLQQLM+TLNSTEPHYIRCVKPNN LKP + ++ N+MQQLR GGV
Sbjct: 600 SKSSKFSSIGSRFKLQLQQLMETLNSTEPHYIRCVKPNNLLKPAVFENVNIMQQLRCGGV 659
Query: 600 LEAIRVKCAGYPTRKTFSEFLDRFGILLPEIRKQNYDEKIACKWILEKMDLKGYQIGKTK 659
LEAIR+ CAGYPTRK F EF++RFG+L P + NY+EK A + IL+ + LKGYQ+GKTK
Sbjct: 660 LEAIRISCAGYPTRKPFFEFINRFGLLYPRALEGNYEEKAAAQKILDNIGLKGYQVGKTK 719
Query: 660 VFLKAGQMAELDAKRAKLLGHSAEVIQSQHRRRVTQKHYITLVQAAVCIQSSCRGILARR 719
VFL+AGQMAELDA+R +L +A+ IQ + R Q+ +I L +A + +Q+ CRG L+ +
Sbjct: 720 VFLRAGQMAELDARRTMVLSAAAKKIQRRIRTHQAQRRFILLRKATISLQALCRGRLSSK 779
Query: 720 YCXXXXXXXXXXXIQKNSRTMMTRKAYSNVKAAAIVXXXXXXXXXXXXXXXXXSELRHRK 779
IQKN+R + +RK+Y N+ AA+V + R RK
Sbjct: 780 IFDNLRRQAAAVKIQKNARRLHSRKSYKNLHVAALVVQTGLRAMAAH------KQFRFRK 833
Query: 780 HAKGALSIQTSWRGHRDFSYYKRLRKASVFSQSRWRGIAARREFRKLKMTAKKEERGQEI 839
K A +IQ +R HR Y+K+L+K + SQ+RWRG ARRE R+LKM ++ E G
Sbjct: 834 QTKAATTIQAQFRCHRATLYFKKLKKGVILSQTRWRGKLARRELRQLKMASR--ETGA-- 889
Query: 840 TESQESQEAVQYIVDETSEVKECDITNKGIEVHVKECDTTDRAIEVYVKECDTK-DRATE 898
+E+++ ++ V+E + + + ++ +++ +E + + ++ ++E K D
Sbjct: 890 --LKEAKDMLEKKVEELTYRAQLEKRSR-VDLE-EEKNQEIKKLQSSLEEMRKKVDETNG 945
Query: 899 VHVEDCDDIDRAIEPHP-ITGKIPCSNEEEEKIENLSAEVEKLKALLQAEKQRADDSARK 957
+ V++ + +AIE P + + E+ +KIE L+ EVE LKA L+ EKQRADD+ RK
Sbjct: 946 LLVKEREAAKKAIEEAPPVVTETQVLVEDTQKIEALTEEVEGLKANLEQEKQRADDATRK 1005
Query: 958 CAEARVXXXXXXXXXXXXXXXVYQLQDSLNRL 989
EA+ QLQ+S+ RL
Sbjct: 1006 FDEAQESSEDRKKKLEDTEKKAQQLQESVTRL 1037
|
|
| TAIR|locus:2025535 XIC [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2149932 XIK [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2085340 XIJ [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2007938 MYA1 "myosin 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2020270 XIB "myosin XI B" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2197773 XIA "myosin XI A" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2045198 XIF "myosin-like protein XIF" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046570 XID "myosin XI D" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2117768 XIH [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1303 | |||
| cd01384 | 674 | cd01384, MYSc_type_XI, Myosin motor domain, plant- | 0.0 | |
| smart00242 | 677 | smart00242, MYSc, Myosin | 0.0 | |
| cd00124 | 679 | cd00124, MYSc, Myosin motor domain | 0.0 | |
| COG5022 | 1463 | COG5022, COG5022, Myosin heavy chain [Cytoskeleton | 0.0 | |
| cd01380 | 691 | cd01380, MYSc_type_V, Myosin motor domain, type V | 0.0 | |
| pfam00063 | 679 | pfam00063, Myosin_head, Myosin head (motor domain) | 0.0 | |
| cd01377 | 693 | cd01377, MYSc_type_II, Myosin motor domain, type I | 0.0 | |
| cd01378 | 674 | cd01378, MYSc_type_I, Myosin motor domain, type I | 0.0 | |
| cd01381 | 671 | cd01381, MYSc_type_VII, Myosin motor domain, type | 0.0 | |
| cd01383 | 677 | cd01383, MYSc_type_VIII, Myosin motor domain, plan | 0.0 | |
| cd01382 | 717 | cd01382, MYSc_type_VI, Myosin motor domain, type V | 0.0 | |
| cd01387 | 677 | cd01387, MYSc_type_XV, Myosin motor domain, type X | 0.0 | |
| cd01385 | 692 | cd01385, MYSc_type_IX, Myosin motor domain, type I | 1e-172 | |
| PTZ00014 | 821 | PTZ00014, PTZ00014, myosin-A; Provisional | 1e-167 | |
| cd01379 | 653 | cd01379, MYSc_type_III, Myosin motor domain, type | 1e-159 | |
| cd01386 | 767 | cd01386, MYSc_type_XVIII, Myosin motor domain, typ | 9e-75 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 5e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-05 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| pfam13912 | 27 | pfam13912, zf-C2H2_6, C2H2-type zinc finger | 0.004 | |
| pfam06098 | 288 | pfam06098, Radial_spoke_3, Radial spoke protein 3 | 0.004 |
| >gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
Score = 1363 bits (3530), Expect = 0.0
Identities = 540/674 (80%), Positives = 602/674 (89%), Gaps = 1/674 (0%)
Query: 6 GGADDMTKLSYLHEPGVLHNLATRYEINEIYTYTGNILIALNPFQPLSHLYDAYMMERYK 65
G DDMTKLSYLHEPGVL NL TRYE+NEIYTYTGNILIA+NPFQ L HLYD +MME+YK
Sbjct: 1 EGVDDMTKLSYLHEPGVLQNLKTRYELNEIYTYTGNILIAVNPFQRLPHLYDVHMMEQYK 60
Query: 66 GVPFGKLSPHVFAIADAAYREMINEGKSNSILVSGESGAGKTETTKMIMRYLAYLGGHTA 125
G G+LSPHVFAIADAAYR MINEGKS SILVSGESGAGKTETTKM+MRYLAY+GG
Sbjct: 61 GAALGELSPHVFAIADAAYRAMINEGKSQSILVSGESGAGKTETTKMLMRYLAYMGGRAG 120
Query: 126 AEGRSVEQQVLESNPVLEAFGNAKTVKNNNSSRFGKFVEIQFDKRGRISGAAIRTYLLER 185
EGR+VEQQVLESNPVLEAFGNAKTV+NNNSSRFGKFVEIQFD GRISGAAIRTYLLER
Sbjct: 121 VEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDDYGRISGAAIRTYLLER 180
Query: 186 SRVCKISDPERNYHCFYLLCAAPPDEIERYKLGNPTSFHYLNQSNCYELVGVNDANDYLA 245
SRVC+ISDPERNYHCFY LCAAPP+++++YKLG+P FHYLNQSNC+EL GV+DA +YLA
Sbjct: 181 SRVCQISDPERNYHCFYQLCAAPPEDVKKYKLGDPKEFHYLNQSNCFELDGVDDAEEYLA 240
Query: 246 TRRAMDVIGISRKEQDAIFGVVAAILHLGNIEFEKGEE-DSSVVKDNESKFHLQMTAKLL 304
TRRAMDV+GIS +EQDAIF VVAAILHLGNIEF KGEE DSSV+KD +S+FHL+ A+LL
Sbjct: 241 TRRAMDVVGISEEEQDAIFRVVAAILHLGNIEFAKGEEIDSSVLKDEKSEFHLKTAAELL 300
Query: 305 MCDPGELEDALCKRVMITPEEIIKKSLDPVAATVSRDGLAKTIYSRLFDWLVDKINVSIG 364
MCD LEDALCKRVM+TPEE+I K LDP +A +SRD LAKTIYSRLFDWLV+KIN SIG
Sbjct: 301 MCDEKALEDALCKRVMVTPEEVITKPLDPDSAELSRDALAKTIYSRLFDWLVNKINSSIG 360
Query: 365 QDPHSKCLIGVLDIYGFESFESNSFEQFCINFTNEKLQQHFNQNVFKMEQNDYRNEEIDW 424
QDP SK LIGVLDIYGFESF++NSFEQFCIN TNEKLQQHFNQ+VFKMEQ +Y EEIDW
Sbjct: 361 QDPDSKSLIGVLDIYGFESFKTNSFEQFCINLTNEKLQQHFNQHVFKMEQEEYTKEEIDW 420
Query: 425 SYVHFVDNQDVLDLIEKKPGGIIALLDEACMFPKSTHENFSQKLYQTFKDHKRFIKPKLT 484
SY+ FVDNQDVLDLIEKKPGGIIALLDEACMFPKSTHE F+QKLYQTFKDHKRF KPKL+
Sbjct: 421 SYIEFVDNQDVLDLIEKKPGGIIALLDEACMFPKSTHETFAQKLYQTFKDHKRFEKPKLS 480
Query: 485 RSDFTIVHYAGEVHYQSDLFLDKNKDYVVAEHQDLLSASECSFVSGLFPPISEETTKSSK 544
R+ FTI HYAG+V YQ+D FLDKNKDYVVAEHQ LL+AS CSFV+GLFPP+ EET+KSSK
Sbjct: 481 RTAFTIDHYAGDVTYQTDQFLDKNKDYVVAEHQALLNASNCSFVAGLFPPLPEETSKSSK 540
Query: 545 FSSIGSRFKLQLQQLMDTLNSTEPHYIRCVKPNNELKPVILDSNNVMQQLRSGGVLEAIR 604
FSSIGSRFK QLQ LM+TL++TEPHYIRC+KPNN LKP I ++ NV+QQLR GGVLEAIR
Sbjct: 541 FSSIGSRFKQQLQSLMETLSTTEPHYIRCIKPNNVLKPGIFENENVLQQLRCGGVLEAIR 600
Query: 605 VKCAGYPTRKTFSEFLDRFGILLPEIRKQNYDEKIACKWILEKMDLKGYQIGKTKVFLKA 664
+ CAGYPTR+TF EFLDRFGIL PE+ K + D+K ACK IL+KM LKGYQIGKTKVFL+A
Sbjct: 601 ISCAGYPTRRTFDEFLDRFGILAPEVLKGSSDDKAACKKILDKMGLKGYQIGKTKVFLRA 660
Query: 665 GQMAELDAKRAKLL 678
GQMAELDA+R ++L
Sbjct: 661 GQMAELDARRTEVL 674
|
This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 674 |
| >gnl|CDD|214580 smart00242, MYSc, Myosin | Back alignment and domain information |
|---|
| >gnl|CDD|238071 cd00124, MYSc, Myosin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins | Back alignment and domain information |
|---|
| >gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) | Back alignment and domain information |
|---|
| >gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata | Back alignment and domain information |
|---|
| >gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins | Back alignment and domain information |
|---|
| >gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238682 cd01386, MYSc_type_XVIII, Myosin motor domain, type XVIII myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206083 pfam13912, zf-C2H2_6, C2H2-type zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|218896 pfam06098, Radial_spoke_3, Radial spoke protein 3 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1303 | |||
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 100.0 | |
| PTZ00014 | 821 | myosin-A; Provisional | 100.0 | |
| cd01384 | 674 | MYSc_type_XI Myosin motor domain, plant-specific t | 100.0 | |
| cd01380 | 691 | MYSc_type_V Myosin motor domain, type V myosins. M | 100.0 | |
| cd01381 | 671 | MYSc_type_VII Myosin motor domain, type VII myosin | 100.0 | |
| KOG0164 | 1001 | consensus Myosin class I heavy chain [Cytoskeleton | 100.0 | |
| cd01377 | 693 | MYSc_type_II Myosin motor domain, type II myosins. | 100.0 | |
| cd01378 | 674 | MYSc_type_I Myosin motor domain, type I myosins. M | 100.0 | |
| cd01383 | 677 | MYSc_type_VIII Myosin motor domain, plant-specific | 100.0 | |
| cd01387 | 677 | MYSc_type_XV Myosin motor domain, type XV myosins. | 100.0 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 100.0 | |
| cd01385 | 692 | MYSc_type_IX Myosin motor domain, type IX myosins. | 100.0 | |
| cd01382 | 717 | MYSc_type_VI Myosin motor domain, type VI myosins. | 100.0 | |
| KOG0160 | 862 | consensus Myosin class V heavy chain [Cytoskeleton | 100.0 | |
| cd01379 | 653 | MYSc_type_III Myosin motor domain, type III myosin | 100.0 | |
| smart00242 | 677 | MYSc Myosin. Large ATPases. ATPase; molecular moto | 100.0 | |
| KOG0162 | 1106 | consensus Myosin class I heavy chain [Cytoskeleton | 100.0 | |
| cd00124 | 679 | MYSc Myosin motor domain. This catalytic (head) do | 100.0 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 100.0 | |
| cd01386 | 767 | MYSc_type_XVIII Myosin motor domain, type XVIII my | 100.0 | |
| PF00063 | 689 | Myosin_head: Myosin head (motor domain); InterPro: | 100.0 | |
| KOG4229 | 1062 | consensus Myosin VII, myosin IXB and related myosi | 100.0 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 99.37 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 98.7 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 98.42 | |
| KOG0160 | 862 | consensus Myosin class V heavy chain [Cytoskeleton | 98.36 | |
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 98.25 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 98.17 | |
| KOG4229 | 1062 | consensus Myosin VII, myosin IXB and related myosi | 98.15 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 97.61 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 97.55 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 97.47 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 97.47 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.41 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 97.28 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.21 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 97.19 | |
| KOG0164 | 1001 | consensus Myosin class I heavy chain [Cytoskeleton | 97.16 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 97.15 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.14 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.14 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 97.13 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.1 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.1 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.04 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 96.96 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 96.95 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 96.93 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 96.93 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 96.92 | |
| KOG1074 | 958 | consensus Transcriptional repressor SALM [Transcri | 96.91 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 96.89 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 96.86 | |
| PRK11637 | 428 | AmiB activator; Provisional | 96.86 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 96.82 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 96.79 | |
| PHA00616 | 44 | hypothetical protein | 96.77 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 96.75 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 96.75 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 96.72 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.66 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 96.64 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 96.59 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.58 | |
| KOG1074 | 958 | consensus Transcriptional repressor SALM [Transcri | 96.58 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 96.54 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 96.5 | |
| PF00612 | 21 | IQ: IQ calmodulin-binding motif; InterPro: IPR0000 | 96.49 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 96.47 | |
| PF00612 | 21 | IQ: IQ calmodulin-binding motif; InterPro: IPR0000 | 96.46 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 96.45 | |
| KOG0925 | 699 | consensus mRNA splicing factor ATP-dependent RNA h | 96.43 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.42 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.4 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.33 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 96.33 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 96.31 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 96.3 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.3 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 96.28 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 96.19 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 96.13 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 96.11 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 96.1 | |
| KOG3576 | 267 | consensus Ovo and related transcription factors [T | 96.09 | |
| KOG2128 | 1401 | consensus Ras GTPase-activating protein family - I | 95.99 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 95.96 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 95.94 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 95.94 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 95.93 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 95.92 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 95.9 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 95.89 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 95.88 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 95.87 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 95.86 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 95.86 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 95.85 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 95.85 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 95.83 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 95.68 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 95.66 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 95.65 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 95.58 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 95.57 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 95.57 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 95.45 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 95.45 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 95.4 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 95.35 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 95.34 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 95.32 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 95.31 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 95.3 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 95.28 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 95.27 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 95.27 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 95.25 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 95.2 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 95.17 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 95.11 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 95.1 | |
| PTZ00014 | 821 | myosin-A; Provisional | 95.05 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 95.01 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 94.99 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 94.94 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 94.91 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 94.87 | |
| smart00015 | 26 | IQ Short calmodulin-binding motif containing conse | 94.87 | |
| PRK09039 | 343 | hypothetical protein; Validated | 94.86 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 94.79 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 94.79 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 94.78 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 94.78 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 94.77 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 94.76 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 94.75 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 94.66 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 94.65 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 94.62 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 94.6 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 94.59 | |
| PTZ00121 | 2084 | MAEBL; Provisional | 94.58 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 94.57 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 94.55 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 94.55 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 94.52 | |
| smart00015 | 26 | IQ Short calmodulin-binding motif containing conse | 94.52 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 94.49 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 94.47 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 94.45 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 94.42 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 94.34 | |
| KOG2128 | 1401 | consensus Ras GTPase-activating protein family - I | 94.16 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 94.14 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 94.14 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 94.1 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 94.06 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 94.05 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 94.0 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 93.91 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 93.9 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 93.89 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 93.88 | |
| KOG3576 | 267 | consensus Ovo and related transcription factors [T | 93.86 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 93.83 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 93.73 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 93.68 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 93.62 | |
| KOG4403 | 575 | consensus Cell surface glycoprotein STIM, contains | 93.54 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 93.52 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 93.48 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 93.45 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 93.45 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 93.34 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 93.32 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 93.25 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 93.23 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 93.21 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 93.13 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 93.13 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 93.11 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 93.11 | |
| KOG2008 | 426 | consensus BTK-associated SH3-domain binding protei | 93.11 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 93.03 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 93.01 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 92.98 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 92.8 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 92.77 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 92.76 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 92.75 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 92.66 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 92.63 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 92.62 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 92.59 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 92.56 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 92.54 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 92.43 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 92.34 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 92.33 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 92.32 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 92.31 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 92.23 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 92.21 | |
| KOG3993 | 500 | consensus Transcription factor (contains Zn finger | 92.09 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 92.07 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 92.02 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 92.0 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 91.93 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 91.9 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 91.83 | |
| PHA00732 | 79 | hypothetical protein | 91.82 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 91.69 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 91.64 | |
| PRK06696 | 223 | uridine kinase; Validated | 91.6 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 91.57 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 91.54 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 91.49 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 91.48 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 91.47 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 91.44 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 91.39 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 91.33 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 91.31 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 91.24 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 91.22 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 91.22 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 91.2 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 91.16 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 91.1 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 91.1 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 91.1 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 91.07 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 90.97 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 90.95 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 90.89 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 90.88 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 90.88 | |
| PTZ00121 | 2084 | MAEBL; Provisional | 90.87 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 90.83 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 90.82 | |
| cd01918 | 149 | HprK_C HprK/P, the bifunctional histidine-containi | 90.82 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 90.78 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 90.72 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 90.69 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 90.67 | |
| PHA00733 | 128 | hypothetical protein | 90.6 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 90.59 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 90.48 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 90.4 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 90.38 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 90.36 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 90.33 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 90.33 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 90.31 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 90.29 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 90.28 | |
| KOG3608 | 467 | consensus Zn finger proteins [General function pre | 90.23 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 90.22 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 90.21 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 90.19 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 90.15 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 90.11 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 90.06 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 90.06 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 90.04 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 89.98 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 89.97 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 89.96 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 89.87 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 89.86 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 89.75 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 89.75 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 89.73 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 89.69 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 89.69 | |
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 89.63 | |
| PF13514 | 1111 | AAA_27: AAA domain | 89.6 | |
| PF03668 | 284 | ATP_bind_2: P-loop ATPase protein family; InterPro | 89.56 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 89.53 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 89.52 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 89.51 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 89.5 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 89.47 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 89.33 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 89.29 | |
| PF05729 | 166 | NACHT: NACHT domain | 89.25 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 89.24 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 89.23 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 89.22 | |
| PF06637 | 442 | PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th | 89.18 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 89.17 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 89.17 | |
| COG1660 | 286 | Predicted P-loop-containing kinase [General functi | 89.13 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 89.11 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 89.02 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 89.02 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 88.99 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 88.87 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 88.81 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 88.8 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 88.78 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 88.76 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 88.64 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 88.63 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 88.63 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 88.62 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 88.55 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 88.53 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 88.42 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 88.4 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 88.4 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 88.4 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 88.38 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 88.37 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 88.33 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 88.32 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 88.28 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 88.15 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 88.15 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 88.14 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 88.11 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 88.06 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 88.03 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 88.01 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 87.97 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 87.86 | |
| PRK06217 | 183 | hypothetical protein; Validated | 87.8 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 87.76 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 87.76 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 87.75 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 87.72 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 87.67 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 87.59 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 87.57 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 87.52 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 87.51 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 87.41 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 87.37 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 87.36 | |
| PRK12377 | 248 | putative replication protein; Provisional | 87.34 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 87.32 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 87.3 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 87.26 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 87.18 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 87.17 | |
| KOG3993 | 500 | consensus Transcription factor (contains Zn finger | 87.1 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 87.09 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 87.06 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 87.06 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 87.04 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 87.01 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 86.96 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 86.95 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 86.94 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 86.93 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 86.92 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 86.9 | |
| KOG4677 | 554 | consensus Golgi integral membrane protein [Intrace | 86.87 | |
| PHA00733 | 128 | hypothetical protein | 86.61 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 86.53 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 86.47 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 86.44 | |
| PF14992 | 280 | TMCO5: TMCO5 family | 86.36 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 86.33 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 86.29 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 86.21 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 86.16 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 86.16 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 86.16 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 86.14 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 86.04 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 85.95 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 85.86 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 85.85 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 85.81 | |
| PF10205 | 102 | KLRAQ: Predicted coiled-coil domain-containing pro | 85.49 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 85.46 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 85.43 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 85.39 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 85.39 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 85.35 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 85.33 | |
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 85.26 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 85.21 | |
| PRK13764 | 602 | ATPase; Provisional | 85.21 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 85.17 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 85.09 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 85.08 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 85.04 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 84.96 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 84.83 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 84.8 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 84.75 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 84.68 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 84.63 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 84.62 | |
| PRK07667 | 193 | uridine kinase; Provisional | 84.61 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 84.6 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 84.59 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 84.58 | |
| KOG0056 | 790 | consensus Heavy metal exporter HMT1, ABC superfami | 84.57 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 84.53 | |
| PRK14732 | 196 | coaE dephospho-CoA kinase; Provisional | 84.48 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 84.46 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 84.46 | |
| PF06637 | 442 | PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th | 84.37 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 84.26 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 84.24 | |
| PF10205 | 102 | KLRAQ: Predicted coiled-coil domain-containing pro | 84.22 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 84.06 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 83.97 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 83.94 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 83.89 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 83.86 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 83.85 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 83.78 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 83.78 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 83.77 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 83.73 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 83.72 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 83.71 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 83.71 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 83.7 | |
| PF10226 | 195 | DUF2216: Uncharacterized conserved proteins (DUF22 | 83.69 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 83.68 | |
| PF13514 | 1111 | AAA_27: AAA domain | 83.67 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 83.62 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 83.62 | |
| PRK05416 | 288 | glmZ(sRNA)-inactivating NTPase; Provisional | 83.6 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 83.6 | |
| PF07475 | 171 | Hpr_kinase_C: HPr Serine kinase C-terminal domain; | 83.57 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 83.53 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 83.51 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 83.43 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 83.41 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 83.33 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 83.29 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 83.27 | |
| PRK08727 | 233 | hypothetical protein; Validated | 83.27 | |
| PF06548 | 488 | Kinesin-related: Kinesin-related; InterPro: IPR010 | 83.22 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 83.22 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 83.17 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 83.16 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 83.16 | |
| PRK08116 | 268 | hypothetical protein; Validated | 83.12 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 83.06 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 83.04 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 83.01 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 83.0 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 82.88 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 82.85 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 82.79 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 82.76 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 82.75 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 82.69 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 82.69 | |
| KOG4403 | 575 | consensus Cell surface glycoprotein STIM, contains | 82.65 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 82.61 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 82.58 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 82.56 | |
| PF01920 | 106 | Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 | 82.56 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 82.55 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 82.53 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 82.51 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 82.5 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 82.47 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 82.46 | |
| PHA00732 | 79 | hypothetical protein | 82.44 | |
| PF05769 | 181 | DUF837: Protein of unknown function (DUF837); Inte | 82.44 | |
| PF05278 | 269 | PEARLI-4: Arabidopsis phospholipase-like protein ( | 82.43 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 82.36 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 82.35 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 82.3 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 82.19 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 82.19 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 82.19 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 82.17 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 82.13 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 82.13 | |
| PRK03839 | 180 | putative kinase; Provisional | 82.03 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 82.01 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 81.98 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 81.97 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 81.94 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 81.93 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 81.91 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 81.89 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 81.89 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 81.85 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 81.84 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 81.82 | |
| PRK13729 | 475 | conjugal transfer pilus assembly protein TraB; Pro | 81.78 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 81.73 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 81.63 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 81.62 | |
| COG0802 | 149 | Predicted ATPase or kinase [General function predi | 81.61 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 81.55 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 81.51 | |
| cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 81.43 |
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.7e-217 Score=1992.36 Aligned_cols=820 Identities=45% Similarity=0.703 Sum_probs=770.6
Q ss_pred CCCCCCccCCCCCChHHHHHHHHHHhhcCceeeeccCeeEeeCCCCCCCCCCcHHHHHHhcCCCCCCCCchHHHHHHHHH
Q 048174 5 AGGADDMTKLSYLHEPGVLHNLATRYEINEIYTYTGNILIALNPFQPLSHLYDAYMMERYKGVPFGKLSPHVFAIADAAY 84 (1303)
Q Consensus 5 ~~~~~Dl~~L~~l~E~~vL~~L~~Ry~~~~iYT~~G~iLiavNP~~~l~~ly~~~~~~~y~~~~~~~~~PHifavA~~Ay 84 (1303)
.++|||||.|+|||||+|||||++||..++||||+|.||||||||+.|| ||++++|+.|.+++..+++|||||||+.||
T Consensus 65 ~~~vdDLt~LSyLNEpsVl~nL~kRY~n~~IYTYSGlvLIAvNPy~~L~-iYt~d~i~~Y~~K~r~el~PHvfAIAe~aY 143 (1463)
T COG5022 65 FDGVDDLTELSYLNEPAVLHNLEKRYNNGQIYTYSGLVLIAVNPYRDLG-IYTDDIIQSYSGKNRLELEPHVFAIAEEAY 143 (1463)
T ss_pred ccCchhhhhhhccCcHHHHHHHHHHhhcCceeEEeeeEEEEecCcccCC-CccHHHHHHhccCccccCCchHHHHHHHHH
Confidence 4689999999999999999999999999999999999999999999998 999999999999999999999999999999
Q ss_pred HHHHHcCCCeEEEEeCCcCCCchhhHHHHHHHHHHHhCCCCcCCCcHHHHHHhhchHHHhhcccccccCCCCCcccceEE
Q 048174 85 REMINEGKSNSILVSGESGAGKTETTKMIMRYLAYLGGHTAAEGRSVEQQVLESNPVLEAFGNAKTVKNNNSSRFGKFVE 164 (1303)
Q Consensus 85 ~~m~~~~~~QsIiisGESGaGKTe~~k~i~~yLa~~~~~~~~~~~~ie~~il~snpiLEAFGNAkT~rN~NSSRfGK~i~ 164 (1303)
++|...++||||||||||||||||+||+||+|||.+++.++...++||++||++||||||||||||+||||||||||||+
T Consensus 144 ~~lls~~eNQtIiISGESGAGKTe~aK~ImqYlasv~~s~~~~~~~iE~~ILaTNPILEAFGNAkTvRNdNSSRFGKyik 223 (1463)
T COG5022 144 RNLLSEKENQTIIISGESGAGKTENAKRIMQYLASVTSSSTVEISSIEKQILATNPILEAFGNAKTVRNDNSSRFGKYIK 223 (1463)
T ss_pred HHHHhcCCCceEEEecCCCCCchHHHHHHHHHHHHhccCCcchHHHHHHHHHhcchHHHHhccccccccCCcccccceEE
Confidence 99999999999999999999999999999999999998776667799999999999999999999999999999999999
Q ss_pred EEEcCCCCeeeeEEeeeeecccceeecCCCCCceeeeeecccC-ChhhHhhcCCCCCCCCccccCCCcccccCCCCHHHH
Q 048174 165 IQFDKRGRISGAAIRTYLLERSRVCKISDPERNYHCFYLLCAA-PPDEIERYKLGNPTSFHYLNQSNCYELVGVNDANDY 243 (1303)
Q Consensus 165 l~f~~~g~i~Ga~i~~yLLEksRvv~q~~~ERNfHIFYqll~~-~~~~~~~l~L~~~~~~~yl~~~~~~~~~~~dd~~~f 243 (1303)
|.||.+|.|+||+|++|||||||||+|+.+|||||||||||++ ++..++.|++..|.+|.||++++|..++|+||+++|
T Consensus 224 I~Fd~~g~I~GA~I~~YLLEKSRVV~Q~~~ERNYHIFYQll~G~~~~~k~~~~~~~~~dY~Yl~~~~~~~I~gIdD~kef 303 (1463)
T COG5022 224 IEFDENGEICGAKIETYLLEKSRVVHQNKNERNYHIFYQLLAGDPEELKKLLLLQNPKDYIYLSQGGCDKIDGIDDAKEF 303 (1463)
T ss_pred EEECCCCceechhhhhhhhhhhhhccCCCCccchhhhhhHhcCChHHHHHHhhccChHhhHhHhhcCCCcCCCcccHHHH
Confidence 9999999999999999999999999999999999999999995 444556677789999999999999999999999999
Q ss_pred HHHHhhhhhccCCHHHHHHHHHHHHHHHHhcCeeeeecCCccceecCcccHHHHHHHHHhcCCCHHHHHHHHhhceeeeC
Q 048174 244 LATRRAMDVIGISRKEQDAIFGVVAAILHLGNIEFEKGEEDSSVVKDNESKFHLQMTAKLLMCDPGELEDALCKRVMITP 323 (1303)
Q Consensus 244 ~~~~~Al~~lG~~~~~~~~I~~ilaaILhLGni~F~~~~~d~~~~~~~~~~~~l~~~a~LLgv~~~~L~~~L~~~~~~~~ 323 (1303)
..|+.||++|||+.++|.+||+|||||||||||+|..+.++++.+.+. ..++.+|.|||||+..|.+||+.|.++++
T Consensus 304 k~t~~AlktiGi~~eeq~~IF~iLAaILhiGNIef~~~r~g~a~~~~~---~~~~~~c~LLgId~~~f~k~lvk~~ikt~ 380 (1463)
T COG5022 304 KITLDALKTIGIDEEEQDQIFKILAAILHIGNIEFKEDRNGAAIFSDN---SVLDKACYLLGIDPSLFVKWLVKRQIKTG 380 (1463)
T ss_pred HHHHHHHHHhCCChHHHHHHHHHHHHHHhhcceeeeecccchhhcCCc---hHHHHHHHHhCCCHHHHHHHHHHhHhhcC
Confidence 999999999999999999999999999999999999988887777765 35999999999999999999999999999
Q ss_pred CceeeccCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcCcCCCCceEEEeeeccccccCCCCCHHHHHHHhhhHHHHh
Q 048174 324 EEIIKKSLDPVAATVSRDGLAKTIYSRLFDWLVDKINVSIGQDPHSKCLIGVLDIYGFESFESNSFEQFCINFTNEKLQQ 403 (1303)
Q Consensus 324 ~e~i~~~l~~~~A~~~Rdalak~LY~~LF~wiV~~iN~~l~~~~~~~~~IgiLDI~GFE~f~~NsfEQlcINyaNEkLq~ 403 (1303)
||+|.++++..||..+||||||+||++||+|||++||.+|...+...+|||||||||||+|+.|||||||||||||||||
T Consensus 381 ~E~i~~~~n~~QA~~irdslAK~lY~~lFdwiV~rIN~sL~~~~~~~~fIGVLDIyGFEiFEkNSFEQlCINYtNEKLQQ 460 (1463)
T COG5022 381 GEWIVVPLNLEQALAIRDSLAKALYSNLFDWIVDRINKSLDHSAAASNFIGVLDIYGFEIFEKNSFEQLCINYTNEKLQQ 460 (1463)
T ss_pred ceEEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCccccccceeEEeecchhhhccCcHHHHHHhhhhHHHHH
Confidence 99999999999999999999999999999999999999998776677899999999999999999999999999999999
Q ss_pred HHhHhhHHhhHhhhhccCCCcccccccChHHHHHhhhc-CCCcccccchhhhcCCCCchHHHHHHHHHHhc--CCCCccc
Q 048174 404 HFNQNVFKMEQNDYRNEEIDWSYVHFVDNQDVLDLIEK-KPGGIIALLDEACMFPKSTHENFSQKLYQTFK--DHKRFIK 480 (1303)
Q Consensus 404 ~f~~~vf~~eq~ey~~EgI~w~~i~~~dn~~~ldlie~-~p~Gil~lLdee~~~p~~td~~f~~kl~~~~~--~~~~f~~ 480 (1303)
+||+|||++||+||.+|||+|++|+|.|||+||||||+ .|.|||++|||||.+|.|||++|.+||++.+. .++.|.+
T Consensus 461 ~Fn~h~FklEQEeY~kE~IeW~~Idy~DnQ~~IDLIE~~~p~GIlslLDEE~~~p~atd~s~~sKL~~~l~~~~~~~f~~ 540 (1463)
T COG5022 461 FFNQHMFKLEQEEYVKEGIEWSFIDYFDNQPCIDLIEKKNPLGILSLLDEECVMPHATDESFTSKLAQRLNKNSNPKFKK 540 (1463)
T ss_pred HHHHHHHHHHHHHHHHhcCcccccccccCcchhHHHhccCCCchHhhhcHHhcCCCCCchHHHHHHHHHhccccCccccc
Confidence 99999999999999999999999999999999999997 36699999999999999999999999999986 4678999
Q ss_pred CCCCCCCcEEEccCCCcchhhhhhhhhccchhHHHHHHHHhhchhhhhhccCCCCcccccCCCCccchhHhhHhhHHHHH
Q 048174 481 PKLTRSDFTIVHYAGEVHYQSDLFLDKNKDYVVAEHQDLLSASECSFVSGLFPPISEETTKSSKFSSIGSRFKLQLQQLM 560 (1303)
Q Consensus 481 p~~~~~~F~I~HyaG~V~Y~~~gflekN~D~l~~~~~~ll~~S~~~~i~~lf~~~~~~~~~~~~~~tv~~~fk~sL~~Lm 560 (1303)
||+....|+|+||||+|+|+++||++||+|++++++++||..|+|+||..||+.... ..+.++++|+|+.||.||++||
T Consensus 541 ~rf~~~~FvvkHYAgDVeY~veg~ldKNkD~l~~~ll~Ll~~StNe~vs~Lf~~~~~-~~~K~~~pT~gs~~K~sl~~Lm 619 (1463)
T COG5022 541 SRFRDNKFVVKHYAGDVEYDVEGFLDKNKDPLNDDLLELLKASTNEFVSTLFDDEEN-IESKGRFPTLGSRFKESLNSLM 619 (1463)
T ss_pred cccCCCceEEEeecccceeeccchhhhCcchhhHHHHHHHhhccchHHHHhhhhhhh-ccccCCCCcHHHHHHHHHHHHH
Confidence 999999999999999999999999999999999999999999999999999995433 3334689999999999999999
Q ss_pred HHHccCCCeeEEecCCCCCCCCCcCCccccccceecccHHHHHHHHhhCCCcccCHHHHHHhhcccccchhc-----ccc
Q 048174 561 DTLNSTEPHYIRCVKPNNELKPVILDSNNVMQQLRSGGVLEAIRVKCAGYPTRKTFSEFLDRFGILLPEIRK-----QNY 635 (1303)
Q Consensus 561 ~~L~~t~~hfIrCIkPN~~~~p~~fd~~~V~~QLr~~gvle~iri~~~Gyp~r~~~~eF~~Ry~~L~~~~~~-----~~~ 635 (1303)
++|++|+||||||||||..|+|+.||+.+|++|||||||||+|||+|+|||.||+|++|+.||++|.|.... +..
T Consensus 620 ~tl~sTqphyIRCIkPN~~K~p~~fD~~mVL~QLr~~GVlE~IRIsraGFP~R~~f~EFv~RY~IL~p~~~~~~~~~~~~ 699 (1463)
T COG5022 620 STLNSTQPHYIRCIKPNEEKSPWTFDNQMVLSQLRCCGVLETIRISRAGFPSRWTFDEFVQRYRILSPSKSWTGEYTWKE 699 (1463)
T ss_pred HHHHhcCCceeEeeCCCcccCccccchHHHHHHHHhcchhhheeeccccCchhhhHHHHHHHHHHhcccccccccccchh
Confidence 999999999999999999999999999999999999999999999999999999999999999999997432 234
Q ss_pred chHHHHHHHHHhcCCC--CcccccccceeccchhhHHHHHHHhhhchhHHHHhhhhhhhhhhhhhhhhhhHHHHHHhhcc
Q 048174 636 DEKIACKWILEKMDLK--GYQIGKTKVFLKAGQMAELDAKRAKLLGHSAEVIQSQHRRRVTQKHYITLVQAAVCIQSSCR 713 (1303)
Q Consensus 636 ~~~~~~~~il~~~~~~--~~~iGkTkVFlr~~~~~~LE~~R~~~l~~aA~~IQ~~~R~~~~Rk~y~~~r~aai~IQa~~R 713 (1303)
+.+.+|..||..+.++ .||+|.|||||++|+++.||.+|...++.+++.||+.|||++.|++|.+..+.+..+|...+
T Consensus 700 ~~~~~~~~IL~~~~id~~~YqiG~TKvFfKagvL~~LE~~Rd~~~~~~~~~iq~aiR~~~~rrr~~~~~k~i~~~~~~~~ 779 (1463)
T COG5022 700 DTKNAVKSILEELVIDSSKYQIGNTKVFFKAGVLAALEDMRDAKLDNIATRIQRAIRGRYLRRRYLQALKRIKKIQVIQH 779 (1463)
T ss_pred HHHHHHHHHHHhhcCChhheeccceeEEeeCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence 6799999999998776 69999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccceeccccccchhhhHHHHHHHHHHHHHHHhhcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhh
Q 048174 714 GILARRYCKVKKKEAAAVKIQKNSRTMMTRKAYSNVKAAAIVLQAWLRARAAVRAMAALSELRHRKHAKGALSIQTSWRG 793 (1303)
Q Consensus 714 g~laRk~~~~~r~~~AAi~IQ~~~Rg~~aRr~~~k~r~aai~IQ~~~R~~~~~R~~~arr~~~~~~~~~AA~~IQ~~~Rg 793 (1303)
|++.|+.+..--.-.+++.+|..||....|+.|......++.+|.- ..++...+.........+++..+|++||.
T Consensus 780 ~~~~~~~~~~~~~~~~~~~l~~~~~~~~~r~~~~~~~~~i~~lq~~-----i~~~~~~~~~~e~~~~~~~~~L~~~~~rs 854 (1463)
T COG5022 780 GFRLRRLVDYELKWRLFIKLQPLLSLLGSRKEYRSYLACIIKLQKT-----IKREKKLRETEEVEFSLKAEVLIQKFGRS 854 (1463)
T ss_pred ccchhhhcccchHHHhHHHhhHHhHHHhhHHHHHHHHHHHHHHHHH-----HHHHHHHhHHHHHHHHHHHHHHHHHHHHh
Confidence 9999988777666789999999999999999999999999999941 23333333333445557899999999999
Q ss_pred HHHHHHHHHHhhhhHHhhhhhhhHHHHHHHHHHHHHHHHHH
Q 048174 794 HRDFSYYKRLRKASVFSQSRWRGIAARREFRKLKMTAKKEE 834 (1303)
Q Consensus 794 ~~aRr~~~~~~kaav~IQ~~~R~~~aRkel~~lk~aa~~~~ 834 (1303)
+..+++|..+.+.++.+|..+|...|++++..++.+.++..
T Consensus 855 ~~~~kr~~~L~k~~i~~~~~~r~~~a~r~~~e~k~~~~~~~ 895 (1463)
T COG5022 855 LKAKKRFSLLKKETIYLQSAQRVELAERQLQELKIDVKSIS 895 (1463)
T ss_pred hhhhHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHhHHHHH
Confidence 99999999999999999999999999999999998888655
|
|
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
| >cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
| >cd01380 MYSc_type_V Myosin motor domain, type V myosins | Back alignment and domain information |
|---|
| >cd01381 MYSc_type_VII Myosin motor domain, type VII myosins | Back alignment and domain information |
|---|
| >KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01377 MYSc_type_II Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
| >cd01378 MYSc_type_I Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
| >cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata | Back alignment and domain information |
|---|
| >cd01387 MYSc_type_XV Myosin motor domain, type XV myosins | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01385 MYSc_type_IX Myosin motor domain, type IX myosins | Back alignment and domain information |
|---|
| >cd01382 MYSc_type_VI Myosin motor domain, type VI myosins | Back alignment and domain information |
|---|
| >KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01379 MYSc_type_III Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >smart00242 MYSc Myosin | Back alignment and domain information |
|---|
| >KOG0162 consensus Myosin class I heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00124 MYSc Myosin motor domain | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins | Back alignment and domain information |
|---|
| >PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG4229 consensus Myosin VII, myosin IXB and related myosins [Cell motility] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG4229 consensus Myosin VII, myosin IXB and related myosins [Cell motility] | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG1074 consensus Transcriptional repressor SALM [Transcription] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG1074 consensus Transcriptional repressor SALM [Transcription] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG3576 consensus Ovo and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >KOG2128 consensus Ras GTPase-activating protein family - IQGAP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2128 consensus Ras GTPase-activating protein family - IQGAP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG3576 consensus Ovo and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >KOG2008 consensus BTK-associated SH3-domain binding protein SAB [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >KOG3608 consensus Zn finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >COG1660 Predicted P-loop-containing kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF14992 TMCO5: TMCO5 family | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PRK14732 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PF07475 Hpr_kinase_C: HPr Serine kinase C-terminal domain; InterPro: IPR011104 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF06548 Kinesin-related: Kinesin-related; InterPro: IPR010544 This entry represents a domain within kinesin-related proteins from higher plants | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PF05769 DUF837: Protein of unknown function (DUF837); InterPro: IPR008555 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >PRK13729 conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0802 Predicted ATPase or kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1303 | ||||
| 2dfs_A | 1080 | 3-D Structure Of Myosin-V Inhibited State Length = | 1e-170 | ||
| 1w9j_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 1e-163 | ||
| 1w9i_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 1e-163 | ||
| 1g8x_A | 1010 | Structure Of A Genetically Engineered Molecular Mot | 1e-163 | ||
| 2aka_A | 776 | Structure Of The Nucleotide-Free Myosin Ii Motor Do | 1e-162 | ||
| 1jwy_A | 776 | Crystal Structure Of The Dynamin A Gtpase Domain Co | 1e-162 | ||
| 1d0x_A | 761 | Dictyostelium Myosin S1dc (Motor Domain Fragment) C | 1e-162 | ||
| 2xel_A | 776 | Molecular Mechanism Of Pentachloropseudilin Mediate | 1e-162 | ||
| 1yv3_A | 762 | The Structural Basis Of Blebbistatin Inhibition And | 1e-162 | ||
| 1fmv_A | 761 | Crystal Structure Of The Apo Motor Domain Of Dictyo | 1e-162 | ||
| 1w9l_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 1e-162 | ||
| 2jhr_A | 788 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 1e-162 | ||
| 3mnq_A | 788 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 1e-162 | ||
| 2xo8_A | 776 | Crystal Structure Of Myosin-2 In Complex With Tribr | 1e-162 | ||
| 3myh_X | 762 | Insights Into The Importance Of Hydrogen Bonding In | 1e-162 | ||
| 2y0r_X | 758 | Structural Basis For The Allosteric Interference Of | 1e-162 | ||
| 1mma_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 1e-162 | ||
| 1mmd_A | 762 | Truncated Head Of Myosin From Dictyostelium Discoid | 1e-161 | ||
| 2y9e_X | 758 | Structural Basis For The Allosteric Interference Of | 1e-161 | ||
| 1w9k_A | 770 | Dictyostelium Discoideum Myosin Ii Motor Domain S45 | 1e-161 | ||
| 1mmg_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 1e-161 | ||
| 1lvk_A | 762 | X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N | 1e-160 | ||
| 1mmn_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 1e-160 | ||
| 1oe9_A | 795 | Crystal Structure Of Myosin V Motor With Essential | 1e-156 | ||
| 1w8j_A | 766 | Crystal Structure Of Myosin V Motor Domain - Nucleo | 1e-154 | ||
| 3mkd_A | 692 | Crystal Structure Of Myosin-2 Dictyostelium Discoid | 1e-152 | ||
| 2x9h_A | 695 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 1e-152 | ||
| 2vas_A | 788 | Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigo | 1e-133 | ||
| 2x51_A | 789 | M6 Delta Insert1 Length = 789 | 1e-133 | ||
| 4dbq_A | 788 | Myosin Vi D179y (md-insert2-cam, Delta-insert1) Pos | 1e-133 | ||
| 3l9i_A | 814 | Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant | 1e-131 | ||
| 2bki_A | 858 | Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal St | 1e-130 | ||
| 2bkh_A | 814 | Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc | 1e-130 | ||
| 4e7s_A | 798 | Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke Stat | 1e-130 | ||
| 2v26_A | 784 | Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) L | 1e-130 | ||
| 4e7z_A | 798 | Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal F | 1e-130 | ||
| 1kk7_A | 837 | Scallop Myosin In The Near Rigor Conformation Lengt | 1e-130 | ||
| 1qvi_A | 840 | Crystal Structure Of Scallop Myosin S1 In The Pre-P | 1e-130 | ||
| 1b7t_A | 835 | Myosin Digested By Papain Length = 835 | 1e-130 | ||
| 1dfk_A | 830 | Nucleotide-Free Scallop Myosin S1-Near Rigor State | 1e-130 | ||
| 1dfl_A | 831 | Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra | 1e-130 | ||
| 4dbp_A | 814 | Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal | 1e-130 | ||
| 4anj_A | 1052 | Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke St | 1e-130 | ||
| 4dbr_A | 786 | Myosin Vi D179y (md) Pre-powerstroke State Length = | 1e-130 | ||
| 2os8_A | 840 | Rigor-Like Structures Of Muscle Myosins Reveal Key | 1e-128 | ||
| 3i5g_A | 839 | Crystal Structure Of Rigor-Like Squid Myosin S1 Len | 1e-127 | ||
| 2ec6_A | 838 | Placopecten Striated Muscle Myosin Ii Length = 838 | 1e-127 | ||
| 1i84_S | 1184 | Cryo-Em Structure Of The Heavy Meromyosin Subfragme | 1e-125 | ||
| 3dtp_A | 971 | Tarantula Heavy Meromyosin Obtained By Flexible Doc | 1e-124 | ||
| 3dtp_B | 973 | Tarantula Heavy Meromyosin Obtained By Flexible Doc | 1e-123 | ||
| 3j04_A | 909 | Em Structure Of The Heavy Meromyosin Subfragment Of | 1e-123 | ||
| 4a7f_C | 697 | Structure Of The Actin-Tropomyosin-Myosin Complex ( | 1e-123 | ||
| 1br1_A | 820 | Smooth Muscle Myosin Motor Domain-Essential Light C | 1e-122 | ||
| 1lkx_A | 697 | Motor Domain Of Myoe, A Class-I Myosin Length = 697 | 1e-122 | ||
| 2w4g_M | 840 | Isometrically Contracting Insect Asynchronous Fligh | 1e-121 | ||
| 2ycu_A | 995 | Crystal Structure Of Human Non Muscle Myosin 2c In | 1e-121 | ||
| 1br2_A | 791 | Smooth Muscle Myosin Motor Domain Complexed With Mg | 1e-121 | ||
| 4db1_A | 783 | Cardiac Human Myosin S1dc, Beta Isoform Complexed W | 1e-120 | ||
| 2mys_A | 843 | Myosin Subfragment-1, Alpha Carbon Coordinates Only | 1e-111 | ||
| 1m8q_A | 840 | Molecular Models Of Averaged Rigor Crossbridges Fro | 1e-111 | ||
| 2l1o_A | 39 | Zinc To Cadmium Replacement In The A. Thaliana Supe | 1e-10 |
| >pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 | Back alignment and structure |
|
| >pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 | Back alignment and structure |
| >pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 | Back alignment and structure |
| >pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 | Back alignment and structure |
| >pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 | Back alignment and structure |
| >pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 | Back alignment and structure |
| >pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 | Back alignment and structure |
| >pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 | Back alignment and structure |
| >pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 | Back alignment and structure |
| >pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 | Back alignment and structure |
| >pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 | Back alignment and structure |
| >pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 | Back alignment and structure |
| >pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 | Back alignment and structure |
| >pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 | Back alignment and structure |
| >pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 | Back alignment and structure |
| >pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 | Back alignment and structure |
| >pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 | Back alignment and structure |
| >pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 | Back alignment and structure |
| >pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 | Back alignment and structure |
| >pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|1OE9|A Chain A, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 795 | Back alignment and structure |
| >pdb|1W8J|A Chain A, Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free Length = 766 | Back alignment and structure |
| >pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 | Back alignment and structure |
| >pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 | Back alignment and structure |
| >pdb|2VAS|A Chain A, Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigor State Length = 788 | Back alignment and structure |
| >pdb|2X51|A Chain A, M6 Delta Insert1 Length = 789 | Back alignment and structure |
| >pdb|4DBQ|A Chain A, Myosin Vi D179y (md-insert2-cam, Delta-insert1) Post-rigor State Length = 788 | Back alignment and structure |
| >pdb|3L9I|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant Crystal Structure Length = 814 | Back alignment and structure |
| >pdb|2BKI|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal Structure Length = 858 | Back alignment and structure |
| >pdb|2BKH|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 814 | Back alignment and structure |
| >pdb|4E7S|A Chain A, Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke State Length = 798 | Back alignment and structure |
| >pdb|2V26|A Chain A, Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) Length = 784 | Back alignment and structure |
| >pdb|4E7Z|A Chain A, Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal Form Length = 798 | Back alignment and structure |
| >pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 | Back alignment and structure |
| >pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 | Back alignment and structure |
| >pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 | Back alignment and structure |
| >pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 | Back alignment and structure |
| >pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 | Back alignment and structure |
| >pdb|4DBP|A Chain A, Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal Structure Length = 814 | Back alignment and structure |
| >pdb|4ANJ|A Chain A, Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke State (Mg.Adp.Alf4) Length = 1052 | Back alignment and structure |
| >pdb|4DBR|A Chain A, Myosin Vi D179y (md) Pre-powerstroke State Length = 786 | Back alignment and structure |
| >pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 | Back alignment and structure |
| >pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 | Back alignment and structure |
| >pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 | Back alignment and structure |
| >pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 | Back alignment and structure |
| >pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 | Back alignment and structure |
| >pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 | Back alignment and structure |
| >pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 | Back alignment and structure |
| >pdb|4A7F|C Chain C, Structure Of The Actin-Tropomyosin-Myosin Complex (Rigor Atm 3) Length = 697 | Back alignment and structure |
| >pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 | Back alignment and structure |
| >pdb|1LKX|A Chain A, Motor Domain Of Myoe, A Class-I Myosin Length = 697 | Back alignment and structure |
| >pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 | Back alignment and structure |
| >pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791 | Back alignment and structure |
| >pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 | Back alignment and structure |
| >pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 | Back alignment and structure |
| >pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 | Back alignment and structure |
| >pdb|2L1O|A Chain A, Zinc To Cadmium Replacement In The A. Thaliana Superman Cys2his2 Zinc Finger Induces Structural Rearrangements Of Typical Dna Base Determinant Positions Length = 39 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
Score = 1177 bits (3048), Expect = 0.0
Identities = 377/1030 (36%), Positives = 562/1030 (54%), Gaps = 77/1030 (7%)
Query: 7 GADDMTKLSYLHEPGVLHNLATRY-EINEIYTYTGNILIALNPFQPLSHLYDAYMMERYK 65
G +D+T LSYLHEP VLHNL R+ + IYTY G +L+A+NP++ L +Y ++ Y
Sbjct: 70 GENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYEQLP-IYGEDIINAYS 128
Query: 66 GVPFGKLSPHVFAIADAAYREMINEGKSNSILVSGESGAGKTETTKMIMRYLAYLGGHTA 125
G G + PH+FA+A+ AY++M + ++ SI+VSGESGAGKT + K MRY A + G +
Sbjct: 129 GQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSG--S 186
Query: 126 AEGRSVEQQVLESNPVLEAFGNAKTVKNNNSSRFGKFVEIQFDKRGRISGAAIRTYLLER 185
A +VE++VL SNP++E+ GNAKT +N+NSSRFGK++EI FDKR RI GA +RTYLLE+
Sbjct: 187 ASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEK 246
Query: 186 SRVCKISDPERNYHCFYLLCA-APPDEIERYKLGNPTSFHYLNQSNCYELVGVNDANDYL 244
SRV ++ ERNYH FY LCA A E + +LGN FHY Q + G++DA + +
Sbjct: 247 SRVVFQAEEERNYHIFYQLCASAALPEFKTLRLGNANYFHYTKQGGSPVIDGIDDAKEMV 306
Query: 245 ATRRAMDVIGISRKEQDAIFGVVAAILHLGNIEFEKGEEDSSVVKDNESKFHLQMTAKLL 304
TR+A ++GIS Q IF ++A ILHLGN+EF + DS + L + L+
Sbjct: 307 NTRQACTLLGISDSYQMGIFRILAGILHLGNVEFASRDSDSCAIPPKHD--PLTIFCDLM 364
Query: 305 MCDPGELEDALCKRVMITPEEIIKKSLDPVAATVSRDGLAKTIYSRLFDWLVDKINVSIG 364
D E+ LC R + T E K + + A +RD LAK IY+ LF+W+VD +N ++
Sbjct: 365 GVDYEEMAHWLCHRKLATATETYIKPISKLHAINARDALAKHIYANLFNWIVDHVNKALH 424
Query: 365 QDPHSKCLIGVLDIYGFESFESNSFEQFCINFTNEKLQQHFNQNVFKMEQNDYRNEEIDW 424
IGVLDIYGFE+FE NSFEQFCIN+ NEKLQQ FN +VFK+EQ +Y E+I W
Sbjct: 425 STVKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPW 484
Query: 425 SYVHFVDNQDVLDLIEKKPGGIIALLDEACMFPKSTHENFSQKLYQTFKD-HKRFIKPKL 483
+ + F DNQ ++LIE K G++ LLDE C PK + + ++QKLY T + F KP+L
Sbjct: 485 TLIDFYDNQPCINLIEAKM-GVLDLLDEECKMPKGSDDTWAQKLYNTHLNKCALFEKPRL 543
Query: 484 TRSDFTIVHYAGEVHYQSDLFLDKNKDYVVAEHQDLLSAS-ECSFVSGLFPPISEET--- 539
+ F I H+A +V YQ + FL+KNKD V E +L +S + + LF +
Sbjct: 544 SNKAFIIKHFADKVEYQCEGFLEKNKDTVYEEQIKVLKSSKKFKLLPELFQDEEKAISPT 603
Query: 540 ------------------------TKSSKFSSIGSRFKLQLQQLMDTLNSTEPHYIRCVK 575
T ++G +F+ L LM+TLN+T PHY+RC+K
Sbjct: 604 SATPSGRVPLSRTPVKPAKARPGQTSKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIK 663
Query: 576 PNNELKPVILDSNNVMQQLRSGGVLEAIRVKCAGYPTRKTFSEFLDRFGILLPEIRKQNY 635
PN+ P D +QQLR+ GVLE IR+ AG+P+R T+ EF R+ +L+ + +
Sbjct: 664 PNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQ-KDVLS 722
Query: 636 DEKIACKWILEKMDL--KGYQIGKTKVFLKAGQMAELDAKRAKLLGHSAEVIQSQHRRRV 693
D K CK +LEK+ L YQ GKTK+F +AGQ+A L+ RA L + IQ R +
Sbjct: 723 DRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRADKLRAACIRIQKTIRGWL 782
Query: 694 TQKHYITLVQAAVCIQSSCRGILARRYCKVKKKEAAAVKIQKNSRTMMTRKAYSNVKAAA 753
+K Y+ + +AA+ IQ RG AR Y ++ AA+ IQK R + RK Y ++ A
Sbjct: 783 MRKKYMRMRRAAITIQRYVRGHQARCYATFLRRTRAAIIIQKFQRMYVVRKRYQCMRDAT 842
Query: 754 IVLQAWLRARAAVRAMAALSELRHRKHAKGALSIQTSWRGHRDFSYYKRLRKASVFSQSR 813
I LQ A +R ++ + ++ IQ RG +Y R KA V+ Q
Sbjct: 843 IALQ------ALLRGYLVRNKYQMMLREHKSIIIQKHVRGWLARVHYHRTLKAIVYLQCC 896
Query: 814 WRGIAARREFRKLKMTAKKEERGQEITESQESQ--EAVQYIVDETSEVKECDITNKGIEV 871
+R + A+RE +KLK+ A+ ER +++ E++ + + I ++ E K +E
Sbjct: 897 YRRMMAKRELKKLKIEARSVERYKKLHIGLENKIMQLQRKIDEQNKEYKSLLEKMNNLE- 955
Query: 872 HVKECDTTDRAIEVYVKECDTKDRATEVHVEDCDDIDRAIEPHPITGKIPCSNEEEEKIE 931
T TE D + + + E + ++
Sbjct: 956 -------------------ITYSTETEKLRSDVERLRMSEEE---------AKNATNRVL 987
Query: 932 NLSAEVEKLKALLQAEKQRADDSARKCAEARVLSEKRLKKLEETERRVYQLQDSLNRLLY 991
+L E+ KL+ L + + + +E+ + +L+E + ++ LNR ++
Sbjct: 988 SLQEEIAKLRKELHQTQTEKKTIEEWADKYKHETEQLVSELKEQNTLLKTEKEELNRRIH 1047
Query: 992 CMSEQFSQLK 1001
+++ ++
Sbjct: 1048 DQAKEITETM 1057
|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 | Back alignment and structure |
|---|
| >2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 | Back alignment and structure |
|---|
| >1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 | Back alignment and structure |
|---|
| >1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 | Back alignment and structure |
|---|
| >4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Length = 39 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 | Back alignment and structure |
|---|
| >2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 63 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1303 | |||
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 100.0 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 100.0 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 100.0 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 100.0 | |
| 4anj_A | 1052 | Unconventional myosin-VI, green fluorescent prote; | 100.0 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 100.0 | |
| 1lkx_A | 697 | Myosin IE heavy chain; myosin motor domain, lever | 100.0 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 100.0 | |
| 4db1_A | 783 | Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb | 100.0 | |
| 2v26_A | 784 | Myosin VI; calmodulin-binding, nucleotide-binding, | 100.0 | |
| 1w9i_A | 770 | Myosin II heavy chain; molecular motor, ATPase, mo | 100.0 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 99.9 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 99.08 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 98.89 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 98.74 | |
| 1n2d_C | 48 | IQ2 and IQ3 motifs from MYO2P, A class V myosin; p | 98.69 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 98.62 | |
| 1n2d_C | 48 | IQ2 and IQ3 motifs from MYO2P, A class V myosin; p | 98.28 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 98.13 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 98.07 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 97.95 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 97.94 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 97.93 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 97.14 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.91 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.9 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 97.89 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 97.89 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 97.87 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 97.87 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.87 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 97.86 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 97.85 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 97.85 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 97.06 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.84 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.84 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 97.83 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 97.83 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 97.83 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.82 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 97.79 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 97.77 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 97.77 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 97.76 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 97.76 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 97.75 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 97.75 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 97.75 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.75 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 97.74 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 97.73 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 97.71 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 97.71 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.71 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.7 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 97.69 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 97.69 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 97.69 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 97.68 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 97.68 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 97.68 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.68 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 97.67 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 97.67 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.67 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 97.66 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 96.83 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 97.66 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.66 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 97.65 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.65 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.64 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.64 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.64 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 97.64 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.64 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 97.63 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.62 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 97.62 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.61 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.61 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.61 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.6 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.6 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.6 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.6 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.6 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.59 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 97.59 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.59 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.59 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.59 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 97.58 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.58 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.58 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.58 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.57 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.57 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 97.57 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.57 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.57 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.57 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.57 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.57 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.57 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 97.57 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 97.57 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 97.56 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.56 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.56 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.56 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.56 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 97.55 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.55 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.55 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 97.55 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.55 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.55 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.55 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.55 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.55 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.55 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 97.54 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.54 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.54 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 97.54 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.54 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.54 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.54 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.54 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.54 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 97.54 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.54 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.53 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.53 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.53 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.53 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.53 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 97.52 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 97.52 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.52 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.52 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.52 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 97.52 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.52 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.51 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.51 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.51 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.51 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.5 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 97.5 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.5 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.5 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.5 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.5 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.49 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.49 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.49 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 97.47 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.47 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.47 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 97.47 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 97.46 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.45 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.45 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.44 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.43 | |
| 1wdc_A | 64 | Scallop myosin; calcium binding protein, muscle pr | 97.43 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 97.42 | |
| 2bl0_A | 63 | Major plasmodial myosin heavy chain; muscle protei | 97.42 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 97.4 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 97.38 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.38 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 97.36 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 97.35 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 97.33 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 97.33 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 97.28 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 97.26 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 97.25 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 97.24 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 97.24 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 97.23 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 97.23 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 97.22 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 97.21 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 97.18 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 97.15 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 97.15 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.13 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 97.12 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 97.12 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 97.11 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 97.11 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 97.08 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 97.07 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 97.04 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 97.04 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.02 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 96.99 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 96.98 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 96.96 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 96.95 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 96.91 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 96.9 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 96.89 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 96.84 | |
| 1wdc_A | 64 | Scallop myosin; calcium binding protein, muscle pr | 96.79 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 96.76 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 96.72 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 96.71 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 96.71 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 96.71 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 96.67 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 96.66 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 96.61 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 96.59 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 96.58 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 96.57 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 96.57 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 96.56 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 96.55 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 96.53 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 96.48 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 96.46 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 96.45 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.44 | |
| 2bl0_A | 63 | Major plasmodial myosin heavy chain; muscle protei | 96.43 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 96.42 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.41 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 96.4 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 96.34 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 96.3 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 96.28 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 96.28 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 96.27 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 96.26 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 96.25 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 96.21 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 96.13 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 96.08 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 95.95 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 95.92 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 95.92 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 95.85 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 95.84 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 95.8 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 95.78 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 95.77 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.74 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 95.7 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 95.68 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 95.66 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 95.64 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 95.39 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 95.31 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 95.24 | |
| 3gn4_A | 148 | Myosin-VI; unconventional myosin, motility, lever | 95.23 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 95.03 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 94.99 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 94.97 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 94.94 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 94.87 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 94.74 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 94.53 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 94.53 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 94.52 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 94.29 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 94.07 | |
| 3gn4_A | 148 | Myosin-VI; unconventional myosin, motility, lever | 94.03 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 93.96 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 93.9 | |
| 2kxw_B | 27 | Sodium channel protein type 2 subunit alpha; actio | 93.67 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 93.61 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 93.43 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 93.33 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 93.32 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 93.32 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 93.28 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 93.2 | |
| 2l53_B | 31 | CAM, voltage-gated sodium channel type V alpha iso | 93.18 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 93.17 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 93.07 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 92.89 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 92.8 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 92.7 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 92.69 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 92.66 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 92.53 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 92.34 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 92.32 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 92.23 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 92.17 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 92.17 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 91.92 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 91.82 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 91.8 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 91.72 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 91.51 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 91.45 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 91.41 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.37 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 91.37 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 91.19 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 91.18 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.16 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 91.14 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 91.11 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 91.09 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.07 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 91.07 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 90.98 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.98 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 90.93 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 90.9 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 90.86 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 90.85 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.78 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 90.77 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 90.73 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 90.73 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 90.72 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.71 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 90.71 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 90.66 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 90.66 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.65 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 90.64 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 90.57 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 90.56 | |
| 2kxw_B | 27 | Sodium channel protein type 2 subunit alpha; actio | 90.54 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 90.52 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 90.48 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 90.47 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.45 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 90.4 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 90.35 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 90.33 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 90.26 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 90.24 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 90.23 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 90.19 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 90.17 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 90.13 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 90.07 | |
| 2l53_B | 31 | CAM, voltage-gated sodium channel type V alpha iso | 90.0 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 89.97 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 89.96 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 89.95 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 89.93 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 89.9 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 89.88 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 89.84 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 89.84 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 89.8 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 89.79 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 89.74 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 89.74 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 89.7 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 89.67 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 89.61 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 89.6 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 89.58 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 89.58 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 89.58 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 89.55 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 89.51 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 89.51 | |
| 1wt6_A | 81 | Myotonin-protein kinase; coiled-coil, kinase activ | 89.47 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 89.47 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 89.37 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 89.34 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 89.34 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 89.27 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 89.15 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 89.12 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 89.03 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 89.0 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 88.99 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 88.99 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 88.98 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 88.97 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.93 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 88.89 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 88.88 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.88 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 88.86 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 88.84 | |
| 2oqq_A | 42 | Transcription factor HY5; homodimer leucine zipper | 88.77 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 88.75 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 88.74 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 88.72 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.68 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 88.65 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 88.64 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 88.63 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 88.58 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 88.57 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 88.55 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 88.48 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 88.46 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 88.46 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 88.45 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 88.4 | |
| 3cve_A | 72 | Homer protein homolog 1; coiled coil, alternative | 88.34 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 88.34 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 88.33 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 88.26 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 88.26 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 88.25 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 88.22 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 88.13 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 88.12 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 87.89 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 87.8 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 87.78 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 87.77 | |
| 2e72_A | 49 | POGO transposable element with ZNF domain; zinc fi | 87.72 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 87.68 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 87.65 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 87.65 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 87.63 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 87.62 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 87.59 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 87.59 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 87.49 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 87.45 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 87.38 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 87.24 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 87.16 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 87.15 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 87.08 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 87.01 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 86.98 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 86.97 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 86.97 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 86.96 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 86.84 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 86.83 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 86.82 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 86.78 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 86.72 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 86.7 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 86.69 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 86.59 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 86.53 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 86.52 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 86.51 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 86.44 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 86.4 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 86.25 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 86.22 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 86.22 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 86.19 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 86.09 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 86.0 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 85.98 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 85.98 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 85.97 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 85.9 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 85.88 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 85.84 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 85.82 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 85.77 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 85.75 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 85.72 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 85.68 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 85.64 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 85.6 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 85.55 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 85.47 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 85.47 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 85.45 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 85.42 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 85.41 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 85.3 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 85.29 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 85.25 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 85.23 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 85.18 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 85.14 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 85.06 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 85.05 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 85.01 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 84.98 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 84.97 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 84.9 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 84.9 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 84.89 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 84.87 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 84.76 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 84.72 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 84.65 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 84.59 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 84.54 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 84.33 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 84.22 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 84.18 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 84.08 |
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-222 Score=2145.02 Aligned_cols=940 Identities=39% Similarity=0.640 Sum_probs=812.9
Q ss_pred CCCCCccCCCCCChHHHHHHHHHHh-hcCceeeeccCeeEeeCCCCCCCCCCcHHHHHHhcCCCCCCCCchHHHHHHHHH
Q 048174 6 GGADDMTKLSYLHEPGVLHNLATRY-EINEIYTYTGNILIALNPFQPLSHLYDAYMMERYKGVPFGKLSPHVFAIADAAY 84 (1303)
Q Consensus 6 ~~~~Dl~~L~~l~E~~vL~~L~~Ry-~~~~iYT~~G~iLiavNP~~~l~~ly~~~~~~~y~~~~~~~~~PHifavA~~Ay 84 (1303)
.++|||+.|++|||++||+||+.|| ..+.||||+|+||||||||+.+| +|+++++..|+|+..+++||||||||+.||
T Consensus 69 ~~~~Dl~~L~~l~e~~vl~nL~~Ry~~~~~iYTy~G~iLiavNPyk~l~-iy~~~~~~~Y~~~~~~~~pPHifaiA~~Ay 147 (1080)
T 2dfs_A 69 VGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYEQLP-IYGEDIINAYSGQNMGDMDPHIFAVAEEAY 147 (1080)
T ss_dssp SSCSBSTTCSSCSHHHHHHHHHHHHHTTCCCEEEETTEEEEECCSSCCS-CSSHHHHHHHTTCCGGGSCCCHHHHHHHHH
T ss_pred cchhhhhhhhhcchHHHHHHHHHHHHhcCCchhccCceeEEecCCcccc-cCCHHHHHHhcCCCCCCCCCcHHHHHHHHH
Confidence 6899999999999999999999999 99999999999999999999998 999999999999999999999999999999
Q ss_pred HHHHHcCCCeEEEEeCCcCCCchhhHHHHHHHHHHHhCCCCcCCCcHHHHHHhhchHHHhhcccccccCCCCCcccceEE
Q 048174 85 REMINEGKSNSILVSGESGAGKTETTKMIMRYLAYLGGHTAAEGRSVEQQVLESNPVLEAFGNAKTVKNNNSSRFGKFVE 164 (1303)
Q Consensus 85 ~~m~~~~~~QsIiisGESGaGKTe~~k~i~~yLa~~~~~~~~~~~~ie~~il~snpiLEAFGNAkT~rN~NSSRfGK~i~ 164 (1303)
++|+.+++||||||||||||||||++|+||+|||++++... ..+|+++|+++||||||||||||+||||||||||||+
T Consensus 148 ~~m~~~~~~QsIiisGESGAGKTe~~K~i~~yla~~~~~~~--~~~ie~~il~snpiLEAFGNAkT~rN~NSSRFGK~i~ 225 (1080)
T 2dfs_A 148 KQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSAS--EANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIE 225 (1080)
T ss_dssp HHHHHHTCCEEEEEECSTTSSHHHHHHHHHHHHHHTTTCCT--TTCTHHHHHHHHHHHHHHHEEEETTEEEEECSEEEEE
T ss_pred HHHHhcCCCcEEEEcCCCCCCccchHHHHHHHHHhhccCCC--ccchHHHHHHHHHHHHHhcCCcCCCCCCccccceeEE
Confidence 99999999999999999999999999999999999986532 3589999999999999999999999999999999999
Q ss_pred EEEcCCCCeeeeEEeeeeecccceeecCCCCCceeeeeeccc-CChhhHhhcCCCCCCCCccccCCCcccccCCCCHHHH
Q 048174 165 IQFDKRGRISGAAIRTYLLERSRVCKISDPERNYHCFYLLCA-APPDEIERYKLGNPTSFHYLNQSNCYELVGVNDANDY 243 (1303)
Q Consensus 165 l~f~~~g~i~Ga~i~~yLLEksRvv~q~~~ERNfHIFYqll~-~~~~~~~~l~L~~~~~~~yl~~~~~~~~~~~dd~~~f 243 (1303)
|+||.+|.|+||+|.+|||||||||+|++||||||||||||+ +++++++.|+|.+|.+|+||++|+|..++|+||+++|
T Consensus 226 i~F~~~g~i~Ga~i~~yLLEKsRVv~q~~~ERnfHIFYqllag~~~~~~~~l~L~~~~~y~yl~~~~~~~~~~~dD~~~f 305 (1080)
T 2dfs_A 226 IGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAALPEFKTLRLGNANYFHYTKQGGSPVIDGIDDAKEM 305 (1080)
T ss_dssp EEECTTCCEEEEEEEEECCCCGGGTCCCTTCCSBHHHHHHHHTTTSSGGGGTCCCCTTTCTTTSTTSCCSCTTCCHHHHH
T ss_pred EEECCCCCEeeecceeEeecCceeeccCCCCCcchhHHHHHcCCChHHHHHccCCCHHhcCcccCCCCCCCCCccHHHHH
Confidence 999999999999999999999999999999999999999999 6788999999999999999999999999999999999
Q ss_pred HHHHhhhhhccCCHHHHHHHHHHHHHHHHhcCeeeeecCCccceecCcccHHHHHHHHHhcCCCHHHHHHHHhhceeeeC
Q 048174 244 LATRRAMDVIGISRKEQDAIFGVVAAILHLGNIEFEKGEEDSSVVKDNESKFHLQMTAKLLMCDPGELEDALCKRVMITP 323 (1303)
Q Consensus 244 ~~~~~Al~~lG~~~~~~~~I~~ilaaILhLGni~F~~~~~d~~~~~~~~~~~~l~~~a~LLgv~~~~L~~~L~~~~~~~~ 323 (1303)
..|+.||++|||+++++.+||+|||||||||||+|...+++.+.+.+ +...++.||.||||++++|.++||++++.++
T Consensus 306 ~~~~~A~~~lg~~~~e~~~i~~ilaaILhLGni~F~~~~~~~~~~~~--~~~~l~~~a~LLgv~~~~L~~~l~~~~~~~~ 383 (1080)
T 2dfs_A 306 VNTRQACTLLGISDSYQMGIFRILAGILHLGNVEFASRDSDSCAIPP--KHDPLTIFCDLMGVDYEEMAHWLCHRKLATA 383 (1080)
T ss_dssp HHHHHHHHHTTCCHHHHHHHHHHHHHHHHHTTCCCEEETTTEEECCS--SCHHHHHHHHHHTCCHHHHHHHHHEEEECC-
T ss_pred HHHHHHHHHcCCCHHHHHHHHHHHHHHHhccCceEEecCCcceeecC--ChHHHHHHHHHhCCCHHHHHHHhcccEEEeC
Confidence 99999999999999999999999999999999999887666555532 2357999999999999999999999999999
Q ss_pred CceeeccCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcCcCCCCceEEEeeeccccccCCCCCHHHHHHHhhhHHHHh
Q 048174 324 EEIIKKSLDPVAATVSRDGLAKTIYSRLFDWLVDKINVSIGQDPHSKCLIGVLDIYGFESFESNSFEQFCINFTNEKLQQ 403 (1303)
Q Consensus 324 ~e~i~~~l~~~~A~~~Rdalak~LY~~LF~wiV~~iN~~l~~~~~~~~~IgiLDI~GFE~f~~NsfEQlcINyaNEkLq~ 403 (1303)
+|.|+++++++||.++||||||+||++||+|||.+||.+|..+.....+||||||||||+|+.|||||||||||||+|||
T Consensus 384 ~e~i~~~~~~~qa~~~rdalak~lY~~LF~wlV~~iN~~l~~~~~~~~~IgvLDI~GFE~f~~NsFEQlcINy~NEkLQq 463 (1080)
T 2dfs_A 384 TETYIKPISKLHAINARDALAKHIYANLFNWIVDHVNKALHSTVKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQ 463 (1080)
T ss_dssp ---EEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCSSCCCEEEEEEEECCCCCCSSBCHHHHHHHHHHHHHHH
T ss_pred CceEEeCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccCceEEeeccCCccccCcCCHHHHHHHhhhHHHHH
Confidence 99999999999999999999999999999999999999999877678999999999999999999999999999999999
Q ss_pred HHhHhhHHhhHhhhhccCCCcccccccChHHHHHhhhcCCCcccccchhhhcCCCCchHHHHHHHHHHh-cCCCCcccCC
Q 048174 404 HFNQNVFKMEQNDYRNEEIDWSYVHFVDNQDVLDLIEKKPGGIIALLDEACMFPKSTHENFSQKLYQTF-KDHKRFIKPK 482 (1303)
Q Consensus 404 ~f~~~vf~~eq~ey~~EgI~w~~i~~~dn~~~ldlie~~p~Gil~lLdee~~~p~~td~~f~~kl~~~~-~~~~~f~~p~ 482 (1303)
+||+|||+.||+||.+|||+|.+|+|.||++|||||+++ .|||+||||||++|++||++|++||+..| ++|++|.+|+
T Consensus 464 ~F~~~~f~~EqeeY~~EgI~w~~i~f~dn~~~idlie~~-~Gil~lLdee~~~p~~tD~~f~~kl~~~~~~~~~~f~~p~ 542 (1080)
T 2dfs_A 464 QFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIEAK-MGVLDLLDEECKMPKGSDDTWAQKLYNTHLNKCALFEKPR 542 (1080)
T ss_dssp HHHHHHHHHHHHHHHHHTCCTTCCCCCCCHHHHHHHHST-TSHHHHHHHHTTSTTCCHHHHHHHHHHHHBTTBSSEECCT
T ss_pred HHHHHhhHHHHHHHhhcCCccccccccccHHHHHHHhcC-CceeeeccccccCCCCChHHHHHHHHHHhhcCCCCccCCC
Confidence 999999999999999999999999999999999999987 79999999999999999999999999998 9999999999
Q ss_pred CCCCCcEEEccCCCcchhhhhhhhhccchhHHHHHHHHhhc-hhhhhhccCCCCccc-----------------------
Q 048174 483 LTRSDFTIVHYAGEVHYQSDLFLDKNKDYVVAEHQDLLSAS-ECSFVSGLFPPISEE----------------------- 538 (1303)
Q Consensus 483 ~~~~~F~I~HyaG~V~Y~~~gflekN~D~l~~~~~~ll~~S-~~~~i~~lf~~~~~~----------------------- 538 (1303)
.+...|+|+||||+|+|+++|||+||+|.|+++++.||++| +++||+.||+.....
T Consensus 543 ~~~~~F~I~HyAG~V~Y~~~gfleKN~D~l~~~~~~ll~~S~~~~~v~~lf~~~~~~~~~~~~~~s~~~~~~~~~~~~~~ 622 (1080)
T 2dfs_A 543 LSNKAFIIKHFADKVEYQCEGFLEKNKDTVYEEQIKVLKSSKKFKLLPELFQDEEKAISPTSATPSGRVPLSRTPVKPAK 622 (1080)
T ss_dssp TCSSEEEEECSSCEEEEECTTHHHHHBCCCCHHHHHHHHTCSSCSHHHHSCC----------------------------
T ss_pred CCCCceEEEecceEEEEehhhHHHhccccccHHHHHHHHcccccHHHHHHhccccccccccccccccccccccccccccc
Confidence 88899999999999999999999999999999999999999 999999999853210
Q ss_pred ----ccCCCCccchhHhhHhhHHHHHHHHccCCCeeEEecCCCCCCCCCcCCccccccceecccHHHHHHHHhhCCCccc
Q 048174 539 ----TTKSSKFSSIGSRFKLQLQQLMDTLNSTEPHYIRCVKPNNELKPVILDSNNVMQQLRSGGVLEAIRVKCAGYPTRK 614 (1303)
Q Consensus 539 ----~~~~~~~~tv~~~fk~sL~~Lm~~L~~t~~hfIrCIkPN~~~~p~~fd~~~V~~QLr~~gvle~iri~~~Gyp~r~ 614 (1303)
..+..+++||+++|+.||+.||++|++|+||||||||||+.+.|+.||..+|++||||+||||+|||+++|||+|+
T Consensus 623 ~~~~~~~~~~~~tv~~~fk~sL~~Lm~~L~~t~phfVRCIkPN~~k~p~~fd~~~V~~QLr~~GvlE~iri~r~Gyp~R~ 702 (1080)
T 2dfs_A 623 ARPGQTSKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRW 702 (1080)
T ss_dssp ---------CCCBHHHHHHHHHHHHHHHHHSSEEEEEEEECCCSSCCTTCCCHHHHHHHHHTTTHHHHHHHHTTSCCEEE
T ss_pred ccccccccCCCCcHHHHHHHHHHHHHHHHHhcCCeeEEEecCCCCCCchhcCHHhhHHHHhhcccHHHHhHHhcCCCchh
Confidence 0122367899999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CHHHHHHhhcccccchhccccchHHHHHHHHHhcCC--CCcccccccceeccchhhHHHHHHHhhhchhHHHHhhhhhhh
Q 048174 615 TFSEFLDRFGILLPEIRKQNYDEKIACKWILEKMDL--KGYQIGKTKVFLKAGQMAELDAKRAKLLGHSAEVIQSQHRRR 692 (1303)
Q Consensus 615 ~~~eF~~Ry~~L~~~~~~~~~~~~~~~~~il~~~~~--~~~~iGkTkVFlr~~~~~~LE~~R~~~l~~aA~~IQ~~~R~~ 692 (1303)
+|.+|+.||++|+|...... |++++|+.||..+++ +.|+||+||||||++++..||.+|...+..+|+.||++||+|
T Consensus 703 ~~~eF~~RY~~L~~~~~~~~-d~k~~~~~il~~~~~~~~~~~~G~TKVF~r~g~l~~LE~~R~~~l~~aa~~IQa~~Rg~ 781 (1080)
T 2dfs_A 703 TYQEFFSRYRVLMKQKDVLS-DRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRADKLRAACIRIQKTIRGW 781 (1080)
T ss_dssp EHHHHHHHHTTTSCGGGCCS-SHHHHHHHHHTTTSCCGGGEEECSSEEEECTTHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred hHHHHHHHHHHHCCccCCCC-ChHHHHHHHHHHhcCChhhheeccccchhccchhhHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999765544 889999999998865 489999999999999999999999999999999999999999
Q ss_pred hhhhhhhhhhhHHHHHHhhccccceeccccccchhhhHHHHHHHHHHHHHHHhhcchhHHHHHHHHHHHHHHHHHHHHHH
Q 048174 693 VTQKHYITLVQAAVCIQSSCRGILARRYCKVKKKEAAAVKIQKNSRTMMTRKAYSNVKAAAIVLQAWLRARAAVRAMAAL 772 (1303)
Q Consensus 693 ~~Rk~y~~~r~aai~IQa~~Rg~laRk~~~~~r~~~AAi~IQ~~~Rg~~aRr~~~k~r~aai~IQ~~~R~~~~~R~~~ar 772 (1303)
++|++|.+++.|++.||++|||+++|+.++.+|+..||++||++||||++|+.|.+++.+++.||++||++ .+|
T Consensus 782 l~Rk~~~~~r~aai~IQ~~~Rg~~aR~~~~~lr~~~AAi~IQs~~Rg~~~Rk~y~~lr~aai~IQs~~Rg~------laR 855 (1080)
T 2dfs_A 782 LMRKKYMRMRRAAITIQRYVRGHQARCYATFLRRTRAAIIIQKFQRMYVVRKRYQCMRDATIALQALLRGY------LVR 855 (1080)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHH
T ss_pred HHHHHhhhhHHHHHHHHHHHHHHHHhhcccccccchhHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHH------HHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999955555 555
Q ss_pred HHHHHHHhHHHHHHHHHHHhhHHHHHHHHHHhhhhHHhhhhhhhHHHHHHHHHHHHHHHHHH--------HHHHHHHH-H
Q 048174 773 SELRHRKHAKGALSIQTSWRGHRDFSYYKRLRKASVFSQSRWRGIAARREFRKLKMTAKKEE--------RGQEITES-Q 843 (1303)
Q Consensus 773 r~~~~~~~~~AA~~IQ~~~Rg~~aRr~~~~~~kaav~IQ~~~R~~~aRkel~~lk~aa~~~~--------LE~kl~eL-~ 843 (1303)
+.+..++++.||+.||++||||++|+.|.+.+++++.||++||++++|+++++++.+++..+ ||+++.+| +
T Consensus 856 r~~~~lr~~~aav~IQ~~~Rg~l~R~~y~~~~~aai~iQs~~R~~laRr~~~~Lk~ear~~~~l~~~~~~LE~kl~eLq~ 935 (1080)
T 2dfs_A 856 NKYQMMLREHKSIIIQKHVRGWLARVHYHRTLKAIVYLQCCYRRMMAKRELKKLKIEARSVERYKKLHIGLENKIMQLQR 935 (1080)
T ss_dssp HHHHHHHHHHHHHHHHHHHTTTHHHHHTTTTHHHHHHHHHHHHHHHHHHHTTTC--------------------------
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHH
Confidence 55566666789999999999999999999999999999999999999999999998887533 89999999 9
Q ss_pred hhHHHHHhhhh-hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcchhhhhhhhhhcchhhhhhccCCCccCcccC
Q 048174 844 ESQEAVQYIVD-ETSEVKECDITNKGIEVHVKECDTTDRAIEVYVKECDTKDRATEVHVEDCDDIDRAIEPHPITGKIPC 922 (1303)
Q Consensus 844 rLe~ee~~r~e-ee~~~~E~~kL~~~ve~Le~qlee~e~~~~~le~e~~~~~~~~~~~~ee~~~~k~~l~e~~~~~e~~~ 922 (1303)
+++++++.+.+ .+.+.....+++.++..|++++++++.. ++|+.
T Consensus 936 rL~~~e~~n~~L~~~~~~~~~~~~~e~~~L~~~l~~le~~----~~e~~------------------------------- 980 (1080)
T 2dfs_A 936 KIDEQNKEYKSLLEKMNNLEITYSTETEKLRSDVERLRMS----EEEAK------------------------------- 980 (1080)
T ss_dssp ---------------CHHHHHHHHHHHHHHHHTHHHHHHH----HHHHH-------------------------------
T ss_pred HHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHH----HHHHH-------------------------------
Confidence 99876666655 2222333456666666666666666532 22211
Q ss_pred chhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 048174 923 SNEEEEKIENLSAEVEKLKALLQAEKQRADDSARKCAEARVLSEKRLKKLEETERRVYQLQDSLNRLLYCMSEQFS 998 (1303)
Q Consensus 923 ~~~~~~ki~~L~~E~~kLe~~leel~~~~~ele~~~~e~~~~~~~l~~kl~e~E~~~~~Lq~el~~Le~kl~~le~ 998 (1303)
..+.++..|++|+++|+.+++++.+..+++++++.++++ ++.+++.+++.++..|++++.+|+..+...++
T Consensus 981 --~~~~~v~~L~~e~~~l~~~~~~~~ke~~~lee~~~~~~~---~L~~kv~~L~~e~~~L~qq~~~l~~~~~~~~~ 1051 (1080)
T 2dfs_A 981 --NATNRVLSLQEEIAKLRKELHQTQTEKKTIEEWADKYKH---ETEQLVSELKEQNTLLKTEKEELNRRIHDQAK 1051 (1080)
T ss_dssp --HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred --HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 123445555555555555555555555555555544442 33355555555555555555555544444433
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A | Back alignment and structure |
|---|
| >4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 | Back alignment and structure |
|---|
| >1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* | Back alignment and structure |
|---|
| >4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* | Back alignment and structure |
|---|
| >2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* | Back alignment and structure |
|---|
| >1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} | Back alignment and structure |
|---|
| >1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3gn4_A Myosin-VI; unconventional myosin, motility, lever ARM, 3-helix bundle, actin-binding, ATP-binding, calmodulin-binding, coiled coil; 2.70A {Sus scrofa} | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3gn4_A Myosin-VI; unconventional myosin, motility, lever ARM, 3-helix bundle, actin-binding, ATP-binding, calmodulin-binding, coiled coil; 2.70A {Sus scrofa} | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >2kxw_B Sodium channel protein type 2 subunit alpha; action potential, amino acid motifs, animals, autism, biomol brain chemistry; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2l53_B CAM, voltage-gated sodium channel type V alpha isoform variant; calmodulin, IQ motif, complex, Ca-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kxw_B Sodium channel protein type 2 subunit alpha; action potential, amino acid motifs, animals, autism, biomol brain chemistry; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2l53_B CAM, voltage-gated sodium channel type V alpha isoform variant; calmodulin, IQ motif, complex, Ca-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1303 | ||||
| d1d0xa2 | 712 | c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain | 0.0 | |
| d1kk8a2 | 789 | c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain | 0.0 | |
| d1kk8a2 | 789 | c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain | 5e-06 | |
| d1lkxa_ | 684 | c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli | 0.0 | |
| d2mysa2 | 794 | c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain | 0.0 | |
| d2mysa2 | 794 | c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain | 2e-06 | |
| d1w7ja2 | 730 | c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick | 0.0 | |
| d1br2a2 | 710 | c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick | 0.0 | |
| d1njqa_ | 37 | g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c | 5e-17 |
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Myosin S1, motor domain species: Dictyostelium discoideum [TaxId: 44689]
Score = 751 bits (1941), Expect = 0.0
Identities = 298/677 (44%), Positives = 456/677 (67%), Gaps = 14/677 (2%)
Query: 7 GADDMTKLSYLHEPGVLHNLATRYEINEIYTYTGNILIALNPFQPLSHLYDAYMMERYKG 66
G +DM++LSYL+EP V HNL RY + IYTY+G L+A+NPF+ + +Y M++ +KG
Sbjct: 40 GVEDMSELSYLNEPAVFHNLRVRYNQDLIYTYSGLFLVAVNPFKRIP-IYTQEMVDIFKG 98
Query: 67 VPFGKLSPHVFAIADAAYREMINEGKSNSILVSGESGAGKTETTKMIMRYLAYLGGHTAA 126
+++PH+FAI+D AYR M+++ ++ S+L++GESGAGKTE TK +++YLA + G A
Sbjct: 99 RRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQA 158
Query: 127 EG-RSVEQQVLESNPVLEAFGNAKTVKNNNSSRFGKFVEIQFDKRGRISGAAIRTYLLER 185
G +EQQ+L++NP+LEAFGNAKT +NNNSSRFGKF+EIQF+ G ISGA+I++YLLE+
Sbjct: 159 NGSGVLEQQILQANPILEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISGASIQSYLLEK 218
Query: 186 SRVCKISDPERNYHCFY-LLCAAPPDEIERYKLGNPTSFHYLNQSNCYELVGVNDANDYL 244
SRV S+ ERNYH FY LL A +E + L P SF+YLNQS C ++ GV+D+ ++
Sbjct: 219 SRVVFQSETERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFK 278
Query: 245 ATRRAMDVIGISRKEQDAIFGVVAAILHLGNIEFEKGEEDSSVVKDNESKFHLQMTAKLL 304
TR+AMD++G S++EQ +IF ++A ILHLGNI+FEKG + +V+KD L + +
Sbjct: 279 ITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGAVLKDKT---ALNAASTVF 335
Query: 305 MCDPGELEDALCKRVMITPEEIIKKSLDPVAATVSRDGLAKTIYSRLFDWLVDKINVSIG 364
+P LE AL + ++ +++ + L+ ++ SRD L K +Y RLF WLV KIN +
Sbjct: 336 GVNPSVLEKALMEPRILAGRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLC 395
Query: 365 QDPHSKCLIGVLDIYGFESFESNSFEQFCINFTNEKLQQHFNQNVFKMEQNDYRNEEIDW 424
Q+ + IGVLDI GFE F+ NSFEQ CIN+TNEKLQQ FN ++FK+EQ +Y E+I+W
Sbjct: 396 QERKAYF-IGVLDISGFEIFKVNSFEQLCINYTNEKLQQFFNHHMFKLEQEEYLKEKINW 454
Query: 425 SYVHF-VDNQDVLDLIEK-KPGGIIALLDEACMFPKSTHENFSQKLYQTF-KDHKRFIKP 481
+++ F +D+Q +DLI+ +P GI+ALLDE +FP +T KL+ F K + ++ +P
Sbjct: 455 TFIDFGLDSQATIDLIDGRQPPGILALLDEQSVFPNATDNTLITKLHSHFSKKNAKYEEP 514
Query: 482 KLTRSDFTIVHYAGEVHYQSDLFLDKNKDYVVAEHQDLLSASECSFVSGLF--PPISEET 539
+ ++++F + HYAG+V Y+ +L+KNKD + + + S + V+ LF P I+
Sbjct: 515 RFSKTEFGVTHYAGQVMYEIQDWLEKNKDPLQQDLELCFKDSSDNVVTKLFNDPNIASRA 574
Query: 540 TKSSKFSSIGSRFKLQLQQLMDTLNSTEPHYIRCVKPNNELKPVILDSNNVMQQLRSGGV 599
K + F ++ +++K QL LM TL +T PH++RC+ PNN+ P L+ V+ QLR GV
Sbjct: 575 KKGANFITVAAQYKEQLASLMATLETTNPHFVRCIIPNNKQLPAKLEDKVVLDQLRCNGV 634
Query: 600 LEAIRVKCAGYPTRKTFSEFLDRFGILLPEIRKQNYDEKIACKWILEKMDL--KGYQIGK 657
LE IR+ G+P R +++F+ R+ +L P + + D + A +L+ +++ + Y+ G
Sbjct: 635 LEGIRITRKGFPNRIIYADFVKRYYLLAPNVPRDAEDSQKATDAVLKHLNIDPEQYRFGI 694
Query: 658 TKVFLKAGQMAELDAKR 674
TK+F +AGQ+A ++ R
Sbjct: 695 TKIFFRAGQLARIEEAR 711
|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1303 | |||
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 100.0 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 100.0 | |
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 100.0 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 100.0 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 100.0 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 100.0 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 99.44 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 98.65 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 98.62 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 98.56 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.52 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.49 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.49 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 98.35 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 98.35 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 98.33 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 98.32 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 98.31 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.25 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 98.23 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 98.14 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 98.08 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.98 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 97.96 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 97.86 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.84 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 97.83 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 97.5 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 97.46 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 97.33 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 97.32 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.26 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 97.09 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 96.7 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 96.69 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 96.5 | |
| d2dmda1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 96.42 | |
| d2glia4 | 31 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 96.41 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 96.41 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 96.18 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 95.33 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 94.99 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 94.77 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 94.43 | |
| d2j7ja2 | 29 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 94.29 | |
| d1tf3a2 | 30 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 94.22 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 94.21 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.11 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 93.73 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 93.71 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 93.48 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 93.39 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 93.38 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 93.33 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 93.31 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 93.18 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 93.07 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 92.91 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 92.84 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 92.61 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 92.53 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 92.38 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 92.15 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 92.14 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 92.04 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 92.02 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 91.95 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 91.77 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 91.55 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 91.54 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 91.53 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 91.38 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 91.28 | |
| d2drpa2 | 26 | Tramtrack protein (two zinc-finger peptide) {Droso | 91.24 | |
| d2adra2 | 31 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 91.24 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 91.22 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 91.04 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 91.02 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 90.98 | |
| d1x5wa1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 90.72 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 90.7 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 90.64 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 90.51 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 90.12 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 89.99 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 89.94 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 89.47 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 89.34 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 89.15 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 89.15 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 89.14 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 89.11 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 88.9 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 88.77 | |
| d2glia2 | 33 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 88.75 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 88.72 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 88.68 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 88.35 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 88.3 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 88.25 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 88.22 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 88.19 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 88.04 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 87.93 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 87.84 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 87.83 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 87.67 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 86.98 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 86.98 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 86.96 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 86.79 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 86.57 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 86.38 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 86.35 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 86.28 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 86.14 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 86.02 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 85.75 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 85.16 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 85.13 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 84.87 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 84.84 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 84.61 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 84.49 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 84.49 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 84.23 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 83.99 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 83.95 | |
| d1x5wa2 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 83.66 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 83.61 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 83.56 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 83.54 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 83.53 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 83.33 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 83.29 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 83.21 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 83.09 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 83.05 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 83.04 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 82.99 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 82.96 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 82.9 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 82.86 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 82.81 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 82.34 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 81.64 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 81.23 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 80.99 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 80.96 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 80.89 | |
| d1y0jb1 | 36 | U-shaped transcription factor, different fingers { | 80.49 |
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Myosin S1, motor domain species: Bay scallop (Aequipecten irradians) [TaxId: 31199]
Probab=100.00 E-value=1.7e-183 Score=1734.71 Aligned_cols=716 Identities=38% Similarity=0.667 Sum_probs=648.2
Q ss_pred CCCCCccCCCCCChHHHHHHHHHHhhcCceeeeccCeeEeeCCCCCCCCCCcHHHHHHhcCCCCCCCCchHHHHHHHHHH
Q 048174 6 GGADDMTKLSYLHEPGVLHNLATRYEINEIYTYTGNILIALNPFQPLSHLYDAYMMERYKGVPFGKLSPHVFAIADAAYR 85 (1303)
Q Consensus 6 ~~~~Dl~~L~~l~E~~vL~~L~~Ry~~~~iYT~~G~iLiavNP~~~l~~ly~~~~~~~y~~~~~~~~~PHifavA~~Ay~ 85 (1303)
++||||+.|++|||++||++|+.||.++.||||+|+||||||||+.+| +|++++++.|+++..+++|||||+||++||+
T Consensus 35 ~~v~Dl~~L~~l~E~~vl~~L~~Ry~~~~iYT~~G~iLiavNP~k~l~-iy~~~~~~~y~~~~~~~~~PHiyavA~~Ay~ 113 (789)
T d1kk8a2 35 EKLEDMANMTYLNEASVLYNLRSRYTSGLIYTYSGLFCIAVNPYRRLP-IYTDSVIAKYRGKRKTEIPPHLFSVADNAYQ 113 (789)
T ss_dssp TTCSBGGGSSCCSHHHHHHHHHHHHHTTCCEEEETTEEEEECCSSCCS-TTSHHHHHHHTTCCGGGSCCCHHHHHHHHHH
T ss_pred cCcchhccCCCCCHHHHHHHHHHHHcCCCceEeECCEEEEECCCCCCC-CCCHHHHHHHcCCCCCCCCCcHHHHHHHHHH
Confidence 479999999999999999999999999999999999999999999997 9999999999999999999999999999999
Q ss_pred HHHHcCCCeEEEEeCCcCCCchhhHHHHHHHHHHHhCCCC--------cCCCcHHHHHHhhchHHHhhcccccccCCCCC
Q 048174 86 EMINEGKSNSILVSGESGAGKTETTKMIMRYLAYLGGHTA--------AEGRSVEQQVLESNPVLEAFGNAKTVKNNNSS 157 (1303)
Q Consensus 86 ~m~~~~~~QsIiisGESGaGKTe~~k~i~~yLa~~~~~~~--------~~~~~ie~~il~snpiLEAFGNAkT~rN~NSS 157 (1303)
.|..+++||||||||||||||||++|+||+||+.+++... .....|+++|+++||||||||||||++|+|||
T Consensus 114 ~m~~~~~nQ~IiisGESGaGKTe~~K~il~yL~~~~~~~~~~~~~~~~~~~~~i~~~il~~npiLEAFGNAkT~~N~NSS 193 (789)
T d1kk8a2 114 NMVTDRENQSCLITGESGAGKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNSS 193 (789)
T ss_dssp HHHHHTSEEEEEEECSTTSSHHHHHHHHHHHHHHHSCCCCCC--------CCCHHHHHHHHHHHHHHHHEECCSSCTTEE
T ss_pred HHHHhCCCcEEEEEeCCCCCHHHHHHHHHHHHHHHhcccccccccccccccccHHHHHHHHhHHHHhccccCCCCCCccC
Confidence 9999999999999999999999999999999999985432 12357999999999999999999999999999
Q ss_pred cccceEEEEEcCCCCeeeeEEeeeeecccceeecCCCCCceeeeeeccc-CChhhHhhcCCC-CCCCCccccCCCccccc
Q 048174 158 RFGKFVEIQFDKRGRISGAAIRTYLLERSRVCKISDPERNYHCFYLLCA-APPDEIERYKLG-NPTSFHYLNQSNCYELV 235 (1303)
Q Consensus 158 RfGK~i~l~f~~~g~i~Ga~i~~yLLEksRvv~q~~~ERNfHIFYqll~-~~~~~~~~l~L~-~~~~~~yl~~~~~~~~~ 235 (1303)
|||||++|+||.+|.|+||+|.+|||||||||.|++||||||||||||+ +++++++.++|. ++..|.|++++ |..++
T Consensus 194 RFGk~~~l~f~~~g~i~ga~i~~yLLEksRvv~~~~gErnfHIFY~ll~G~~~~~~~~~~l~~~~~~~~~l~~~-~~~~~ 272 (789)
T d1kk8a2 194 RFGKFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNAIPELNDVMLVTPDSGLYSFINQG-CLTVD 272 (789)
T ss_dssp SSEEEEEEEECTTSSEEEEEEEEECCCGGGGTCCCTTCCSBHHHHHHTSCSSGGGHHHHTCCSCGGGCTTTCSS-CSCBT
T ss_pred CcceeEEEEECCCCCCccceeEEecCCCceeeecccccchhHHHHHHHcCCCHHHHHHhCCCCchhhhHhhcCC-CcccC
Confidence 9999999999999999999999999999999999999999999999999 788889999986 46789999885 78899
Q ss_pred CCCCHHHHHHHHhhhhhccCCHHHHHHHHHHHHHHHHhcCeeeeecCC-ccceecCcccHHHHHHHHHhcCCCHHHHHHH
Q 048174 236 GVNDANDYLATRRAMDVIGISRKEQDAIFGVVAAILHLGNIEFEKGEE-DSSVVKDNESKFHLQMTAKLLMCDPGELEDA 314 (1303)
Q Consensus 236 ~~dd~~~f~~~~~Al~~lG~~~~~~~~I~~ilaaILhLGni~F~~~~~-d~~~~~~~~~~~~l~~~a~LLgv~~~~L~~~ 314 (1303)
++||+++|..++.||+.|||+++++..||+|||||||||||+|...++ +.+.+.+. ..++.||.||||++++|.++
T Consensus 273 ~~~d~~~f~~~~~al~~lg~~~~e~~~i~~ilaaILhLGni~F~~~~~~~~~~~~~~---~~~~~~a~LLgi~~~~L~~~ 349 (789)
T d1kk8a2 273 NIDDVEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGEMKFKQRPREEQAESDGT---AEAEKVAFLCGINAGDLLKA 349 (789)
T ss_dssp TBCHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHTTCCEEC----CCCEESCS---HHHHHHHHHHTSCHHHHHHH
T ss_pred CcchHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHhccccceeeccCCccccccCCh---HHHHHHHHHhCCCHHHhhcc
Confidence 999999999999999999999999999999999999999999987665 44444443 46999999999999999999
Q ss_pred HhhceeeeCCceeeccCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcCcCCCCceEEEeeeccccccCCCCCHHHHHH
Q 048174 315 LCKRVMITPEEIIKKSLDPVAATVSRDGLAKTIYSRLFDWLVDKINVSIGQDPHSKCLIGVLDIYGFESFESNSFEQFCI 394 (1303)
Q Consensus 315 L~~~~~~~~~e~i~~~l~~~~A~~~Rdalak~LY~~LF~wiV~~iN~~l~~~~~~~~~IgiLDI~GFE~f~~NsfEQlcI 394 (1303)
|+++++.+++|.+++++++++|.++||+|||+||++||+|||++||.+|.+......+||||||||||+|+.||||||||
T Consensus 350 l~~~~~~~~~e~i~~~l~~~~a~~~rdalaK~lY~~LF~wIV~~IN~~L~~~~~~~~~IgILDIfGFE~f~~NsfEQLcI 429 (789)
T d1kk8a2 350 LLKPKVKVGTEMVTKGQNMNQVVNSVGALAKSLYDRMFNWLVRRVNKTLDTKAKRNYYIGVLDIAGFEIFDFNSFEQLCI 429 (789)
T ss_dssp HHSCEEC----CEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCSSBCHHHHHH
T ss_pred eeEEEEecccCceecCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcCCCCCcceEEEEeecccceecCcCcHHHHHH
Confidence 99999999999999999999999999999999999999999999999998877778899999999999999999999999
Q ss_pred HhhhHHHHhHHhHhhHHhhHhhhhccCCCcccccccChHHHHHhhhcCCCcccccchhhhcCCCCchHHHHHHHHHHhc-
Q 048174 395 NFTNEKLQQHFNQNVFKMEQNDYRNEEIDWSYVHFVDNQDVLDLIEKKPGGIIALLDEACMFPKSTHENFSQKLYQTFK- 473 (1303)
Q Consensus 395 NyaNEkLq~~f~~~vf~~eq~ey~~EgI~w~~i~~~dn~~~ldlie~~p~Gil~lLdee~~~p~~td~~f~~kl~~~~~- 473 (1303)
|||||+||++|++++|+.||++|.+|||+|..|+|.||.+++++|.++|.|||++|||||.+|++||++|++||+..+.
T Consensus 430 NyaNEkLq~~f~~~~f~~eq~~Y~~EgI~~~~i~~~~n~~~~~~l~~~~~Gll~lLdee~~~~~~td~~~l~kl~~~~~~ 509 (789)
T d1kk8a2 430 NYTNERLQQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILSILEEECMFPKADDKSFQDKLYQNHMG 509 (789)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHTTCCCCSCCCCHHHHHHHHHHHSTTSHHHHHHHHTTCTTCCHHHHHHHHHHHHTT
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHhcCCCccCCCcCCCHHHHHHHHcCCccHHHHHHhhhcCCCCCHHHHHHHHHHHhcC
Confidence 9999999999999999999999999999999999999888888888889999999999999999999999999998875
Q ss_pred CCCCcccCCC------CCCCcEEEccCCCcchhhhhhhhhccchhHHHHHHHHhhchhhhhhccCCCCccccc-------
Q 048174 474 DHKRFIKPKL------TRSDFTIVHYAGEVHYQSDLFLDKNKDYVVAEHQDLLSASECSFVSGLFPPISEETT------- 540 (1303)
Q Consensus 474 ~~~~f~~p~~------~~~~F~I~HyaG~V~Y~~~gflekN~D~l~~~~~~ll~~S~~~~i~~lf~~~~~~~~------- 540 (1303)
+++.|.+|.. ....|+|+||||+|+|+++||++||+|.++++++++|+.|+|+||+.||......+.
T Consensus 510 ~~~~~~~~~~~~~~~~~~~~F~I~HyaG~V~Y~v~gfleKN~D~l~~~l~~ll~~S~n~~i~~lf~~~~~~~~~~~~~~~ 589 (789)
T d1kk8a2 510 KNRMFTKPGKPTRPNQGPAHFELHHYAGNVPYSITGWLEKNKDPINENVVALLGASKEPLVAELFKAPEEPAGGGKKKKG 589 (789)
T ss_dssp TCSSEECCCSCSSTTCCCCSEEEEETTEEEEECCSSHHHHHSCCCCHHHHHHHHTCSSHHHHHHTCC-------------
T ss_pred CCccccCCCcccccccCCCceeEeccCCccceeccChHHhhhhhhhHHHHHHHHhCccHHHHHHhcCccccccccCCCCC
Confidence 4566666532 346799999999999999999999999999999999999999999999986432211
Q ss_pred CCCCccchhHhhHhhHHHHHHHHccCCCeeEEecCCCCCCCCCcCCccccccceecccHHHHHHHHhhCCCcccCHHHHH
Q 048174 541 KSSKFSSIGSRFKLQLQQLMDTLNSTEPHYIRCVKPNNELKPVILDSNNVMQQLRSGGVLEAIRVKCAGYPTRKTFSEFL 620 (1303)
Q Consensus 541 ~~~~~~tv~~~fk~sL~~Lm~~L~~t~~hfIrCIkPN~~~~p~~fd~~~V~~QLr~~gvle~iri~~~Gyp~r~~~~eF~ 620 (1303)
++.+.+||+++|+.||++||++|++|+||||||||||+.+.|+.||...|++||||+||||+|||+++|||+|++|++|+
T Consensus 590 ~~~~~~Tv~~~Fr~sL~~L~~~L~~t~~hFIRCIKPN~~k~p~~Fd~~~V~~QLr~~Gvle~vrirr~Gyp~R~~f~eF~ 669 (789)
T d1kk8a2 590 KSSAFQTISAVHRESLNKLMKNLYSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGIRICRKGFPSRLIYSEFK 669 (789)
T ss_dssp -----CCHHHHHHHHHHHHHHHHTTEEEEEEEEECCCSSCCTTCCCHHHHHHHHTTSSSCC-----CCCSCEEEEHHHHH
T ss_pred CCCCcccHHHHHHHHHHHHHHHHhcCCCeEEEecCCccccCCcccCHHHHHHHHHhhchHHHHHHHHcCCCccccHHHHH
Confidence 22345799999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred Hhhcccccchhcc-ccchHHHHHHHHHhcCCC--CcccccccceeccchhhHHHHHHHhhhchhHHHHhhhhhhhhhhhh
Q 048174 621 DRFGILLPEIRKQ-NYDEKIACKWILEKMDLK--GYQIGKTKVFLKAGQMAELDAKRAKLLGHSAEVIQSQHRRRVTQKH 697 (1303)
Q Consensus 621 ~Ry~~L~~~~~~~-~~~~~~~~~~il~~~~~~--~~~iGkTkVFlr~~~~~~LE~~R~~~l~~aA~~IQ~~~R~~~~Rk~ 697 (1303)
+||++|+|..+.. ..+.+++|+.||..++++ +|+||+||||||++++..||.+|.+.+.++|+.||++||+|++||+
T Consensus 670 ~ry~~L~~~~~~~~~~~~k~~~~~il~~~~~~~~~~qiGkTkVFlr~~~~~~LE~~r~~~l~~~~~~IQ~~~R~~~~Rk~ 749 (789)
T d1kk8a2 670 QRYSILAPNAIPQGFVDGKTVSEKILAGLQMDPAEYRLGTTKVFFKAGVLGNLEEMRDERLSKIISMFQAHIRGYLIRKA 749 (789)
T ss_dssp HHHGGGSGGGCCC---CHHHHHHHHHHHHTCCGGGEEECSSEEEECTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHhCcccccccCCCHHHHHHHHHHhcCCChhhEEecCCEEEEChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 9999999886533 467899999999998876 6999999999999999999999999999999999999999999999
Q ss_pred hhhhhhHHHHHHhhccccceeccccccchhhhHHHHHHHHHHHHHHHhhcc
Q 048174 698 YITLVQAAVCIQSSCRGILARRYCKVKKKEAAAVKIQKNSRTMMTRKAYSN 748 (1303)
Q Consensus 698 y~~~r~aai~IQa~~Rg~laRk~~~~~r~~~AAi~IQ~~~Rg~~aRr~~~k 748 (1303)
|+++|.+. .|+++||++||+|++||+|++
T Consensus 750 y~k~r~~~----------------------~ai~~iQ~~~R~~~~rr~~~~ 778 (789)
T d1kk8a2 750 YKKLQDQR----------------------IGLSVIQRNIRKWLVLRNWQW 778 (789)
T ss_dssp HHHHHHHH----------------------HHHHHHHHHHHHHHHHHTCHH
T ss_pred HHHHHHHH----------------------HHHHHHHHHHHHHHHHcccHH
Confidence 98776432 267789999999999999863
|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|