Citrus Sinensis ID: 048211
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 665 | ||||||
| 359486519 | 799 | PREDICTED: uncharacterized protein LOC10 | 0.986 | 0.821 | 0.573 | 0.0 | |
| 255570887 | 781 | heat shock protein 70 (HSP70)-interactin | 0.971 | 0.827 | 0.557 | 0.0 | |
| 357464329 | 785 | SET and MYND domain-containing protein [ | 0.971 | 0.822 | 0.543 | 0.0 | |
| 356518688 | 786 | PREDICTED: uncharacterized protein LOC10 | 0.978 | 0.828 | 0.547 | 0.0 | |
| 449459406 | 775 | PREDICTED: SET and MYND domain-containin | 0.960 | 0.824 | 0.527 | 0.0 | |
| 356507528 | 784 | PREDICTED: uncharacterized protein LOC10 | 0.968 | 0.821 | 0.535 | 0.0 | |
| 297736653 | 716 | unnamed protein product [Vitis vinifera] | 0.852 | 0.791 | 0.578 | 0.0 | |
| 224140669 | 584 | tetratricopeptide repeat-containing prot | 0.816 | 0.929 | 0.572 | 1e-178 | |
| 42562487 | 798 | tetratricopeptide repeat-containing prot | 0.981 | 0.818 | 0.467 | 1e-177 | |
| 12322390 | 781 | unknown protein; 33246-28649 [Arabidopsi | 0.956 | 0.814 | 0.447 | 1e-164 |
| >gi|359486519|ref|XP_002270770.2| PREDICTED: uncharacterized protein LOC100263830 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 762 bits (1967), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 406/708 (57%), Positives = 496/708 (70%), Gaps = 52/708 (7%)
Query: 2 DANDKDRNLVATLYVNRASVLQKRDHLVECLRDCNRAVQICPSYAKAWYRRGKVNVSLEN 61
DA+D D+NLV TL+VNRASVL K LVECLRDCNRA+ I P+YAKAWYRRGK N SL
Sbjct: 96 DADDVDKNLVVTLFVNRASVLHKMGFLVECLRDCNRALLISPNYAKAWYRRGKANASLNG 155
Query: 62 HDDAVHDLTIAKNRESSLAGKKQIESELKIILDQSNRTSNKVVQHTKNNLRVSDES---- 117
++DAVHDL +A + E SLAG+ QIE ELK+ILDQ + +N V QH +N+L +
Sbjct: 156 YEDAVHDLNVAMHLEESLAGRSQIERELKLILDQY-KGNNSVDQHDQNDLGTLGKMYPNI 214
Query: 118 --------VQVQLQCVTTPDKGRGITSQYDIPEGSLVHSEEPYAVTISKHCRETHCHYCL 169
+Q++LQCV+TP KGRG+ S +I + LVH+EEPYA I KHCR+THCH+C
Sbjct: 215 FLICFILHLQIKLQCVSTPTKGRGMASLSEISQSYLVHTEEPYAAIILKHCRDTHCHFCF 274
Query: 170 NELPADAIPCTSCSIPLYCSRRCRGQAGGQVFKNCPMERNINDSVFDNLEEYISQITLDN 229
NELPAD++PCTSCSIPLYCS+ C+ QAGGQ +N I ++ +LE+Y++ ITL
Sbjct: 275 NELPADSVPCTSCSIPLYCSQHCQMQAGGQELRNNSKNHGICKNLSSDLEKYVAGITLPK 334
Query: 230 DFYPEDEHIFEHKHECKGVHWPVILPSDVVLAGRVLVKSVQKNGVSMDVPNLLGKLELSH 289
D E I EHKHECKGV+WP +LP ++VLAGRV+VKSV++ S + NL+ L+LSH
Sbjct: 335 DSDSNIEWIAEHKHECKGVNWPAVLPPEIVLAGRVMVKSVEQKKHSCNASNLMDTLDLSH 394
Query: 290 NYSQVSPESKLESHIYAIVLLYCLQHSYGFELPINGASVSQVVILISQIRVNSLAIVRMN 349
+Y ++PESKL+ HIY++VLLYCLQHSYGFELP+NG S+SQ++ILISQI+VNS+AIVRM
Sbjct: 395 SYKTMAPESKLDLHIYSVVLLYCLQHSYGFELPLNGISISQLIILISQIKVNSIAIVRMK 454
Query: 350 -SNNYGQSDH------VSSGSTCTVEQVRVGLAIYTAGSLFNHSCLPNIHAYFLSRTLMI 402
+ Y D T +EQVRVG AIY+ SLFNHSC PNIHAYFLSRTL +
Sbjct: 455 FMDGYSPLDQSVNFSPAGGAFTSNMEQVRVGQAIYSVASLFNHSCQPNIHAYFLSRTLFL 514
Query: 403 RTTEFVPSGYPLELSYGPQVGQWDCKDRLKFLEDEYSFRCQCSGCSELNTSDLVINAFCC 462
R TE V G PLELSYGPQVGQWDCKDR KFL+DEYSFRC+CSGCSELN SDLV+NAF C
Sbjct: 515 RATEHVAVGCPLELSYGPQVGQWDCKDRQKFLKDEYSFRCECSGCSELNVSDLVLNAFRC 574
Query: 463 VDPNCPGVVLDNSILNCEKQKRKHLPAVPQCSSSAPHLQVGKLSSDYIGLVAYLLLEENN 522
V+P+C G VLD+ ++ E +K + VPQ S PHLQ L +D I VA+ N
Sbjct: 575 VNPDCFGTVLDSCVIKYENKKFERFQGVPQDCISEPHLQ---LKNDGIREVAHQAFA--N 629
Query: 523 RTSRYGPGYCLKCGSDRDLESSYATVDEAWIYIRRLQDAIISKEISRAVLLDASRFLGLL 582
+ R PGYCL CG+ RDLE+S+ATV EA IYI RLQ+AI+SKE+ DA R L LL
Sbjct: 630 SSFRAAPGYCLHCGAYRDLEASHATVGEAGIYISRLQEAIVSKEVPATTFSDALRSLDLL 689
Query: 583 RSILHAYNKSIA---------------------------EILEKLYGHNHIVIGYELVKL 615
+S LHAYNK IA EILEKLYG NHIVIGYEL+KL
Sbjct: 690 KSTLHAYNKGIAEAEDWIAQAFCMIGELQPAMHHCKASIEILEKLYGSNHIVIGYELMKL 749
Query: 616 SSIQLSLDDHNAVDTISRLAAIFLHYFGSHAETMFPHLLFLQREALKL 663
SSIQLSL D A+ +ISRLAAIF Y+G HA+ MFP+L L+RE KL
Sbjct: 750 SSIQLSLGDTAAMKSISRLAAIFSWYYGPHADMMFPYLGSLKREICKL 797
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255570887|ref|XP_002526395.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223534257|gb|EEF35971.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357464329|ref|XP_003602446.1| SET and MYND domain-containing protein [Medicago truncatula] gi|355491494|gb|AES72697.1| SET and MYND domain-containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356518688|ref|XP_003528010.1| PREDICTED: uncharacterized protein LOC100783548 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449459406|ref|XP_004147437.1| PREDICTED: SET and MYND domain-containing protein 4-like [Cucumis sativus] gi|449500639|ref|XP_004161155.1| PREDICTED: SET and MYND domain-containing protein 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356507528|ref|XP_003522516.1| PREDICTED: uncharacterized protein LOC100794609 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297736653|emb|CBI25524.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224140669|ref|XP_002323703.1| tetratricopeptide repeat-containing protein [Populus trichocarpa] gi|222868333|gb|EEF05464.1| tetratricopeptide repeat-containing protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|42562487|ref|NP_174606.2| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332193468|gb|AEE31589.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|12322390|gb|AAG51222.1|AC051630_19 unknown protein; 33246-28649 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 665 | ||||||
| TAIR|locus:2007013 | 798 | TPR9 "tetratricopeptide repeat | 0.899 | 0.749 | 0.484 | 3.8e-170 | |
| UNIPROTKB|E1C7E7 | 797 | SMYD4 "SET and MYND domain-con | 0.209 | 0.174 | 0.289 | 1.4e-18 | |
| FB|FBgn0036282 | 663 | Smyd4 "SET and MYND domain pro | 0.341 | 0.342 | 0.230 | 1.8e-17 | |
| FB|FBgn0033633 | 660 | CG7759 [Drosophila melanogaste | 0.267 | 0.269 | 0.279 | 5.2e-17 | |
| UNIPROTKB|J9NYI0 | 806 | SMYD4 "Uncharacterized protein | 0.336 | 0.277 | 0.255 | 4e-16 | |
| UNIPROTKB|E2R4V0 | 794 | SMYD4 "Uncharacterized protein | 0.332 | 0.278 | 0.259 | 4.7e-16 | |
| RGD|1562635 | 428 | Smyd3 "SET and MYND domain con | 0.129 | 0.200 | 0.329 | 2.9e-15 | |
| MGI|MGI:2442796 | 799 | Smyd4 "SET and MYND domain con | 0.257 | 0.214 | 0.243 | 3.9e-14 | |
| ZFIN|ZDB-GENE-051120-138 | 429 | smyd3 "SET and MYND domain con | 0.112 | 0.174 | 0.363 | 7.6e-14 | |
| UNIPROTKB|I3LVI1 | 803 | SMYD4 "Uncharacterized protein | 0.203 | 0.168 | 0.265 | 8.7e-14 |
| TAIR|locus:2007013 TPR9 "tetratricopeptide repeat 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1513 (537.7 bits), Expect = 3.8e-170, Sum P(2) = 3.8e-170
Identities = 295/609 (48%), Positives = 426/609 (69%)
Query: 1 MDANDKDRNLVATLYVNRASVLQKRDHLVECLRDCNRAVQICPSYAKAWYRRGKVNVSLE 60
+DA D D++L+A+L++NRA+VL L E LRDC+RA++I P YAKAWYRRGK+N L
Sbjct: 95 LDAIDGDKSLLASLFLNRANVLHNLGLLKESLRDCHRALRIDPYYAKAWYRRGKLNTLLG 154
Query: 61 NHDDAVHDLTIAKNRESSLAGKKQIESELKIILD-QSNRTSNKVVQHTKNNLRVSD-ESV 118
N+ DA D+T++ + ESSL GKKQ+++ELK I D Q+N+T N+ V SV
Sbjct: 155 NYKDAFRDITVSMSLESSLVGKKQLQNELKAIPDYQNNQTLEHDEYRPSNDAGVDHLPSV 214
Query: 119 Q--VQLQCVTTPDKGRGITSQYDIPEGSLVHSEEPYAVTISKHCRETHCHYCLNELPADA 176
Q V+L+CV+T +KGRG+ S+ DI E S++H EEP++V ISK CRETHCH+CLNELPAD
Sbjct: 215 QMEVKLRCVSTKEKGRGMVSECDIEEASVIHVEEPFSVVISKSCRETHCHFCLNELPADT 274
Query: 177 IPCTSCSIPLYCSRRCRGQAGGQVFKNCPMERNINDSVFDNLEEYISQITLDNDFYPEDE 236
+PC SCSIP+YCS C+ Q+GG + N + +I + D++ E+I +T + +Y +
Sbjct: 275 VPCPSCSIPVYCSESCQIQSGGMLSTNEMDKHHIFQKLPDDIVEHIKGVTSADIYYFATD 334
Query: 237 HIFEHKHECKGVHWPVILPSDVVLAGRVLVKSVQKNGVSMDVPNLLGKLELSHNYSQVSP 296
I EH+HEC+G +WP +LPSD VLAGR+++K + + + D+ NL LELSH YS+++P
Sbjct: 335 LIQEHQHECRGANWPAVLPSDAVLAGRIIMKLINQGKAATDLSNLQEILELSHTYSKMNP 394
Query: 297 ESKLESHIYAIVLLYCLQHSYGFELPINGASVSQVVILISQIRVNSLAIVRMNSNNYG-- 354
E+KLE H+ +IVL++CL S L + ASV+Q +IL+SQI+VNS+A+ RM S+
Sbjct: 395 ENKLELHLLSIVLIWCLSKSSCPNLSVCEASVTQTIILLSQIKVNSIAVARMKSSGDSFK 454
Query: 355 --QSDHVSSGSTC-TVEQVRVGLAIYTAGSLFNHSCLPNIHAYFLSRTLMIRTTEFVPSG 411
S ++S+ ++EQ+RVG A+Y GSLFNHSC PNIH YFLSR L+++TTEFVP+G
Sbjct: 455 CLPSGNISTKEPIQSLEQIRVGQALYKTGSLFNHSCKPNIHLYFLSRGLIMQTTEFVPTG 514
Query: 412 YPLELSYGPQVGQWDCKDRLKFLEDEYSFRCQCSGCSELNTSDLVINAFCCVDPNCPGVV 471
PLELSYGP+VG+WDCK+R++FLE+EY F C+C GC+++N SDLVIN + CV+ NC GVV
Sbjct: 515 CPLELSYGPEVGKWDCKNRIRFLEEEYFFHCRCRGCAQINISDLVINGYGCVNTNCTGVV 574
Query: 472 LDNSILNCEKQKRKHLPAVPQCSSSAPHLQVGKLSSDYIGLVAYLLLEENNRTSRYGPGY 531
LD+++ CE +K H P+ ++ K+ +D +G VA LL + + + P
Sbjct: 575 LDSNVATCESEKLNHFFTAPRNVDQQVQMRE-KVYAD-VGEVASSLLSKPSGSLHIEPEI 632
Query: 532 CLKCGSDRDLESSYATVDEAWIYIRRLQDAIISKEISRAVLLDASRFLGLLRSILHAYNK 591
CLKCGS D+E+S+A V++AW ++RR+++ + S + +VL D SR + +LR+ LH YNK
Sbjct: 633 CLKCGSRCDIENSHAEVNKAWNHMRRVEELMNSGRANYSVLSDCSRSIAVLRTFLHMYNK 692
Query: 592 SIAEILEKL 600
IA+ +K+
Sbjct: 693 DIADAEDKV 701
|
|
| UNIPROTKB|E1C7E7 SMYD4 "SET and MYND domain-containing protein 4" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0036282 Smyd4 "SET and MYND domain protein 4" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033633 CG7759 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NYI0 SMYD4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R4V0 SMYD4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1562635 Smyd3 "SET and MYND domain containing 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2442796 Smyd4 "SET and MYND domain containing 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-051120-138 smyd3 "SET and MYND domain containing 3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LVI1 SMYD4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 665 | |||
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 1e-07 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 5e-07 | |
| PLN03088 | 356 | PLN03088, PLN03088, SGT1, suppressor of G2 allele | 4e-06 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 0.001 |
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
Score = 48.8 bits (117), Expect = 1e-07
Identities = 15/62 (24%), Positives = 30/62 (48%), Gaps = 1/62 (1%)
Query: 12 ATLYVNRASVLQKRDHLVECLRDCNRAVQICPSYAKAWYRRGKVNVSL-ENHDDAVHDLT 70
A N + L K E + +A+++ P A+A+Y + L +++++A+ DL
Sbjct: 3 AEALKNLGNALFKLGDYDEAIEAYEKALELDPDNAEAYYNLALAYLKLGKDYEEALEDLE 62
Query: 71 IA 72
A
Sbjct: 63 KA 64
|
Length = 69 |
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)- [FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)- [FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 665 | |||
| KOG2084 | 482 | consensus Predicted histone tail methylase contain | 99.88 | |
| PF00856 | 162 | SET: SET domain; InterPro: IPR001214 The SET domai | 99.6 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.46 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 99.39 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.23 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.12 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.01 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 98.98 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 98.95 | |
| smart00317 | 116 | SET SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) | 98.92 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 98.83 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 98.83 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 98.76 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 98.74 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.66 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 98.61 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 98.6 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.52 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 98.49 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 98.4 | |
| PF01753 | 37 | zf-MYND: MYND finger; InterPro: IPR002893 Zinc fin | 98.37 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 98.37 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 98.33 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 98.31 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.29 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.26 | |
| KOG2589 | 453 | consensus Histone tail methylase [Chromatin struct | 98.24 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 98.21 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 98.2 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 98.14 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 98.12 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.12 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 98.07 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 98.06 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 97.98 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 97.95 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 97.83 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 97.82 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 97.81 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 97.8 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 97.79 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 97.78 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 97.73 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 97.72 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 97.68 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 97.67 | |
| COG2940 | 480 | Proteins containing SET domain [General function p | 97.65 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 97.64 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 97.64 | |
| KOG4442 | 729 | consensus Clathrin coat binding protein/Huntingtin | 97.64 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 97.64 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 97.61 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 97.61 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 97.59 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 97.56 | |
| KOG1080 | 1005 | consensus Histone H3 (Lys4) methyltransferase comp | 97.54 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 97.51 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 97.48 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 97.47 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 97.44 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 97.42 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 97.41 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 97.4 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.39 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 97.37 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 97.33 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 97.32 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 97.3 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 97.3 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 97.29 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 97.29 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 97.29 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 97.21 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 97.18 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 97.18 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 97.16 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.13 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 97.12 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 97.12 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 97.1 | |
| PLN02789 | 320 | farnesyltranstransferase | 97.07 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 97.07 | |
| PLN02789 | 320 | farnesyltranstransferase | 97.05 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 96.94 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 96.9 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 96.9 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 96.87 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 96.83 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 96.83 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 96.76 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 96.75 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 96.74 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 96.73 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 96.73 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 96.73 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 96.67 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 96.66 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 96.6 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 96.58 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 96.57 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 96.51 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 96.51 | |
| KOG1082 | 364 | consensus Histone H3 (Lys9) methyltransferase SUV3 | 96.48 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 96.46 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 96.44 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 96.37 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 96.35 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 96.33 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 96.3 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 96.28 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 96.26 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 96.24 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 96.23 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 96.21 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 96.21 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 96.16 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 96.16 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 96.15 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 96.14 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 96.13 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 96.1 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 96.08 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 96.07 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 96.06 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 96.05 | |
| KOG1141 | 1262 | consensus Predicted histone methyl transferase [Ch | 96.04 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 95.99 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 95.97 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 95.95 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 95.86 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 95.86 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 95.81 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 95.79 | |
| KOG1083 | 1306 | consensus Putative transcription factor ASH1/LIN-5 | 95.78 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 95.76 | |
| KOG4151 | 748 | consensus Myosin assembly protein/sexual cycle pro | 95.74 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 95.69 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 95.63 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 95.59 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 95.57 | |
| KOG1085 | 392 | consensus Predicted methyltransferase (contains a | 95.56 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 95.55 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 95.54 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 95.52 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 95.5 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 95.46 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 95.42 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 95.4 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 95.37 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 95.33 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 95.32 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 95.32 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 95.1 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 95.04 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 95.0 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 94.99 | |
| KOG1337 | 472 | consensus N-methyltransferase [General function pr | 94.89 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 94.87 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 94.84 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 94.76 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 94.75 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 94.75 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 94.62 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 94.54 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 94.5 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 94.47 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 94.45 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 94.4 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 94.19 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 94.17 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 94.03 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 93.98 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 93.78 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 93.65 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 93.65 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 93.6 | |
| smart00317 | 116 | SET SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) | 93.55 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 93.37 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 93.23 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 93.16 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 93.15 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 92.94 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 92.88 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 92.8 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 92.71 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 92.63 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 92.52 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 92.42 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 92.02 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 92.0 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 91.69 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 91.65 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 91.47 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 91.46 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 91.39 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 91.36 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 91.35 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 91.14 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 91.05 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 91.05 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 90.54 | |
| KOG1079 | 739 | consensus Transcriptional repressor EZH1 [Transcri | 90.36 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 90.28 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 90.16 | |
| PF13824 | 55 | zf-Mss51: Zinc-finger of mitochondrial splicing su | 89.99 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 89.83 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 89.69 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 89.61 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 89.55 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 89.33 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 89.22 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 89.15 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 89.08 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 88.98 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 88.97 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 88.28 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 87.55 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 86.0 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 85.82 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 85.77 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 85.67 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 85.49 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 85.31 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 84.67 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 84.45 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 84.2 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 84.13 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 83.7 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 82.84 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 82.29 | |
| KOG1338 | 466 | consensus Uncharacterized conserved protein [Funct | 82.07 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 81.04 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 80.56 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 80.34 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 80.23 | |
| TIGR03504 | 44 | FimV_Cterm FimV C-terminal domain. This protein is | 80.11 |
| >KOG2084 consensus Predicted histone tail methylase containing SET domain [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
Probab=99.88 E-value=5.3e-21 Score=213.61 Aligned_cols=234 Identities=20% Similarity=0.251 Sum_probs=154.6
Q ss_pred eeEEEeccccccccCCCcCCcEEEEeCCEEEEEEeecCCCCC-ceeeecCCCCCCCCHHHHHHHhhcCCCeeeeccCCCC
Q 048211 371 RVGLAIYTAGSLFNHSCLPNIHAYFLSRTLMIRTTEFVPSGY-PLELSYGPQVGQWDCKDRLKFLEDEYSFRCQCSGCSE 449 (665)
Q Consensus 371 ~~g~glyp~~Sl~NHSC~PN~~~~f~g~~~~vrA~r~I~~Ge-eI~isY~~~~~~~~~~~Rr~~L~~~y~F~C~C~rC~~ 449 (665)
..|.|+||..+++||||.||+...|++....+++...+.+++ +|+++|++. .+++..||..|+..|+|.|.|+||.+
T Consensus 197 ~~~~~l~~~~~~~~hsC~pn~~~~~~~~~~~~~~~~~~~~~~~~l~~~y~~~--~~~~~~r~~~l~~~~~f~c~c~rc~d 274 (482)
T KOG2084|consen 197 FLGRGLFPGSSLFNHSCFPNISVIFDGRGLALLVPAGIDAGEEELTISYTDP--LLSTASRQKQLRQSKLFSCQCPRCLD 274 (482)
T ss_pred cceeeecccchhcccCCCCCeEEEECCceeEEEeecccCCCCCEEEEeeccc--ccCHHHHHHHHhhccceeeecCCCCC
Confidence 589999999999999999999999999999999999998887 999999986 69999999999999999999999999
Q ss_pred CccCCccccceecCCCCCCCcccCCcccchhhhhhccCCCCCCCCCCccccccCCCCchhHHHHHHHHhhhcCCccccCC
Q 048211 450 LNTSDLVINAFCCVDPNCPGVVLDNSILNCEKQKRKHLPAVPQCSSSAPHLQVGKLSSDYIGLVAYLLLEENNRTSRYGP 529 (665)
Q Consensus 450 ~~~~d~~~~~~~C~~~~C~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~ 529 (665)
+++.+++.++++|.+.+|.+.+.+..... ....
T Consensus 275 ~~~~~~~~~~~~c~~~~~~~~~~~~~~~~-----------------------------------------------~~~~ 307 (482)
T KOG2084|consen 275 PTELGTFLSSLRCENCTCGGLLGTSFLDK-----------------------------------------------EDLQ 307 (482)
T ss_pred CCccccchhhhhhcCCCCCCccCCCcccc-----------------------------------------------cCCC
Confidence 99989999999999888876654422100 0123
Q ss_pred ccccccCccccchhhhhhHHHHHH-------------HHHHHHHHH-------------hHHhhHHHHHH---HHHHHHH
Q 048211 530 GYCLKCGSDRDLESSYATVDEAWI-------------YIRRLQDAI-------------ISKEISRAVLL---DASRFLG 580 (665)
Q Consensus 530 ~~C~~C~~~~~~~~~~~~~~~~~~-------------~~~~~~~~~-------------~~~~~~~~~~~---~~~~~l~ 580 (665)
|.|..|........+......... .+..-+..+ ....+...... .......
T Consensus 308 w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~l~~~~~~~~~~~~~~~~~~~~~~~~il~~~~~~~~~~~~~~~ 387 (482)
T KOG2084|consen 308 WPCTECALVRLKAYVVESREELQNELLDAFSDLLIEELLLLRQESLELPNDFEVLLLKLHLLFILGSLLGAFLSCSPNAE 387 (482)
T ss_pred ccccccccchhHHHHHHHHHHHHhhccccCChhhhHHHHHHHHHhhhCcchHHHHHHHHHHHHHHHHHHhhhhccchhhH
Confidence 555555433322111111111000 000000000 00000000000 0000000
Q ss_pred hHHHHHHHhhhHHHHHHHHHhCCCChHHHHHHHHHHHHHhhcCChhhH-hHHHHHHHHHHHhhCCCCcchhhhH
Q 048211 581 LLRSILHAYNKSIAEILEKLYGHNHIVIGYELVKLSSIQLSLDDHNAV-DTISRLAAIFLHYFGSHAETMFPHL 653 (665)
Q Consensus 581 ~~~~~l~~~~~~~~~~~~~~yg~~~~~~g~~l~~l~~~~l~~~~~~~a-~~~~~A~~il~~~~G~~~~~~~~~~ 653 (665)
.....-..+...+..++..+++..++..++..+.++....+++....+ ........++...++.++...-...
T Consensus 388 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 461 (482)
T KOG2084|consen 388 LERLLNLFECRELLKALRDVKPGEEPLIAYLDYELGKLARELREKVLAEDALKDCKCIMCLARAEDLDKLSEEE 461 (482)
T ss_pred HHHHHHhhhhhHHHHHHHhhcchhhhhhHHHHHHHHHHHHHHHHHHhhhcCcchhHHHHHHHHHHHhhhhhHHH
Confidence 001111111355677889999999999999999999999887766666 7777777777777777776654433
|
|
| >PF00856 SET: SET domain; InterPro: IPR001214 The SET domain appears generally as one part of a larger multidomain protein, and recently there were described three structures of very different proteins with distinct domain compositions: Neurospora crassa DIM-5, a member of the Su(var) family of HKMTs which methylate histone H3 on lysine 9,human SET7 (also called SET9), which methylates H3 on lysine 4 and garden pea Rubisco LSMT, an enzyme that does not modify histones, but instead methylates lysine 14 in the flexible tail of the large subunit of the enzyme Rubisco | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00317 SET SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PF01753 zf-MYND: MYND finger; InterPro: IPR002893 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG2589 consensus Histone tail methylase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG2940 Proteins containing SET domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4442 consensus Clathrin coat binding protein/Huntingtin interacting protein HIP1, involved in regulation of endocytosis [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1080 consensus Histone H3 (Lys4) methyltransferase complex, subunit SET1 and related methyltransferases [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1082 consensus Histone H3 (Lys9) methyltransferase SUV39H1/Clr4, required for transcriptional silencing [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1141 consensus Predicted histone methyl transferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG1083 consensus Putative transcription factor ASH1/LIN-59 [Transcription] | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >KOG1085 consensus Predicted methyltransferase (contains a SET domain) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1337 consensus N-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >smart00317 SET SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1079 consensus Transcriptional repressor EZH1 [Transcription] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF13824 zf-Mss51: Zinc-finger of mitochondrial splicing suppressor 51 | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1338 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >TIGR03504 FimV_Cterm FimV C-terminal domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 665 | ||||
| 3ru0_A | 438 | Cocrystal Structure Of Human Smyd3 With Inhibitor S | 5e-12 | ||
| 3oxf_A | 436 | Human Lysine Methyltransferase Smyd3 In Complex Wit | 5e-12 | ||
| 3pdn_A | 428 | Crystal Structure Of Smyd3 In Complex With Methyltr | 5e-12 | ||
| 3qwp_A | 429 | Crystal Structure Of Set And Mynd Domain Containing | 6e-12 | ||
| 3oxg_A | 464 | Human Lysine Methyltransferase Smyd3 In Complex Wit | 7e-12 | ||
| 3mek_A | 429 | Crystal Structure Of Human Histone-Lysine N- Methyl | 3e-11 | ||
| 3s7b_A | 433 | Structural Basis Of Substrate Methylation And Inhib | 1e-09 | ||
| 3rib_A | 441 | Human Lysine Methyltransferase Smyd2 In Complex Wit | 8e-09 | ||
| 3tg4_A | 433 | Structure Of Smyd2 In Complex With Sam Length = 433 | 9e-09 | ||
| 3qwv_A | 433 | Crystal Structure Of Histone Lysine Methyltransfera | 1e-05 | ||
| 3upv_A | 126 | Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = | 2e-04 | ||
| 3n71_A | 490 | Crystal Structure Of Cardiac Specific Histone Methy | 5e-04 |
| >pdb|3RU0|A Chain A, Cocrystal Structure Of Human Smyd3 With Inhibitor Sinefungin Bound Length = 438 | Back alignment and structure |
|
| >pdb|3OXF|A Chain A, Human Lysine Methyltransferase Smyd3 In Complex With Adohcy (Form I) Length = 436 | Back alignment and structure |
| >pdb|3PDN|A Chain A, Crystal Structure Of Smyd3 In Complex With Methyltransferase Inhibitor Sinefungin Length = 428 | Back alignment and structure |
| >pdb|3QWP|A Chain A, Crystal Structure Of Set And Mynd Domain Containing 3; Zinc Finger Mynd Domain-Containing Protein 1 Length = 429 | Back alignment and structure |
| >pdb|3OXG|A Chain A, Human Lysine Methyltransferase Smyd3 In Complex With Adohcy (Form Iii) Length = 464 | Back alignment and structure |
| >pdb|3MEK|A Chain A, Crystal Structure Of Human Histone-Lysine N- Methyltransferase Smyd3 In Complex With S-Adenosyl-L- Methionine Length = 429 | Back alignment and structure |
| >pdb|3S7B|A Chain A, Structural Basis Of Substrate Methylation And Inhibition Of Smyd2 Length = 433 | Back alignment and structure |
| >pdb|3RIB|A Chain A, Human Lysine Methyltransferase Smyd2 In Complex With Adohcy Length = 441 | Back alignment and structure |
| >pdb|3TG4|A Chain A, Structure Of Smyd2 In Complex With Sam Length = 433 | Back alignment and structure |
| >pdb|3QWV|A Chain A, Crystal Structure Of Histone Lysine Methyltransferase Smyd2 In Complex With The Cofactor Product Adohcy Length = 433 | Back alignment and structure |
| >pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 | Back alignment and structure |
| >pdb|3N71|A Chain A, Crystal Structure Of Cardiac Specific Histone Methyltransferase Smyd1 Length = 490 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 665 | |||
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 3e-39 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 2e-35 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 5e-32 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 8e-17 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 6e-16 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 7e-16 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 2e-15 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 3e-15 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 3e-15 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 6e-15 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 7e-15 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 1e-14 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 2e-14 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 3e-14 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 4e-14 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 1e-13 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-13 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 7e-13 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-12 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 3e-10 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-07 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-07 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 4e-07 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-04 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 3e-12 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 4e-12 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-09 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 2e-07 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 5e-07 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-06 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 4e-04 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 5e-04 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 5e-04 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 6e-12 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 4e-11 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 3e-10 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 2e-07 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 2e-07 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 3e-06 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 2e-05 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 1e-04 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 8e-11 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 5e-10 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 7e-06 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 9e-05 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 2e-04 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 4e-04 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 5e-10 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 7e-10 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 9e-10 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 6e-08 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-06 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-06 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 5e-05 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 3e-04 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 1e-09 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 3e-09 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 5e-09 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 2e-07 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 8e-04 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 3e-07 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 3e-04 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 5e-07 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 9e-05 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 5e-04 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-06 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-04 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 2e-04 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 3e-04 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 6e-04 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 1e-06 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 2e-06 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 5e-04 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-06 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-06 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 3e-06 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-06 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-06 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-06 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 5e-06 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 5e-06 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-05 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 5e-05 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-06 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-06 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-06 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-06 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 6e-06 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 7e-06 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 8e-06 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-05 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-05 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-05 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-04 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 3e-06 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 5e-06 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 3e-06 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 9e-06 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 2e-05 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 2e-05 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 4e-04 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 4e-06 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 3e-05 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 1e-04 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 1e-04 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 8e-06 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 1e-05 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 1e-04 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 3e-04 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 9e-06 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 1e-05 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 8e-05 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 1e-05 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 1e-05 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 8e-05 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 2e-04 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 2e-04 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 1e-05 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 2e-05 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 3e-04 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 4e-04 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 2e-05 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 4e-05 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 2e-04 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 2e-05 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 5e-05 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 5e-05 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 6e-05 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 6e-05 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 6e-05 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 1e-04 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 4e-04 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 1e-04 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-04 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-04 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-04 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 4e-04 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 8e-04 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 3e-04 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 6e-04 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 3e-04 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 6e-04 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 4e-04 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 5e-04 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 6e-04 |
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 | Back alignment and structure |
|---|
Score = 149 bits (376), Expect = 3e-39
Identities = 80/527 (15%), Positives = 147/527 (27%), Gaps = 119/527 (22%)
Query: 122 LQCVTTPDKGRGITSQYDIPEGSLVHSEEPYAVTISKHCRETHCHYCLNELPADAIPCTS 181
L+ + KGRG+ + G L+ S YA ++ R HC C C
Sbjct: 9 LERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEG-LSKCGR 67
Query: 182 CSIPLYCSRRCRGQAGGQVFKNCPMERNINDSVFDNLEEYISQITLDNDFYPEDEHIFEH 241
C YC C+ + H
Sbjct: 68 CKQAFYCDVECQKEDWPL-----------------------------------------H 86
Query: 242 KHECKGVH--WPVILPSDVVLAGRVLVKSVQKNGVSMDVPNLLGKLELSHNYSQVSPESK 299
K EC + PS+ V ++ + + LL E + ++ E K
Sbjct: 87 KLECSSMVVLGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVREFESHLDKLDNEKK 146
Query: 300 LESHIYAIVLLYCLQHSYGFELPINGASVSQVVILISQIRVNSLAIVRMNSNNYGQSDHV 359
L F S +V+L +Q+ N I
Sbjct: 147 DLIQSDIAALHQFYSKYLEFP------DHSSLVVLFAQVNCNGFTI-------------- 186
Query: 360 SSGSTCTVEQVRVGLAIYTAGSLFNHSCLPNIHAYFLSRTLMIRTTEFVPSGYPLELSYG 419
E +G AI+ +L NHSC PN+ + +R + + G + SY
Sbjct: 187 -----EDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYI 241
Query: 420 PQVGQWDCKDRLKFLEDEYSFRCQCSGCSELNTSDLVINAFCCVDPNCPGVVLDNSILNC 479
+ + +DR L D Y F C+C C+ + + P + D
Sbjct: 242 DLL--YPTEDRNDRLRDSYFFTCECRECTTKDKDKAKVEVRKLSSPPQAEAIRD-----M 294
Query: 480 EKQKRKHLPAVPQCSSSAPHLQVGKLSSDYIGLVAYLLLEENNRTSRYGPGYCLKCGSDR 539
+ R + + ++ ++ C
Sbjct: 295 VRYARNVIEEFRRAKHYKSPSELLEI--------------------------CELS---- 324
Query: 540 DLESSYATVDEAWIYIRRLQDAIISKEISRAVLLDASRFLGLLRSILHAYNKSIAEILEK 599
E + +++ +Y+ + + ++ L Y + I + K
Sbjct: 325 -QEKMSSVFEDSNVYMLHMMYQ----------AMGVCLYMQDWEGAL-KYGQKIIKPYSK 372
Query: 600 LYGHNHIVIGYELVKLSSIQLSLDDH-NAVDTISRLAAIFLHYFGSH 645
Y + + +KL + + L++ + + AI G
Sbjct: 373 HYPVYSLNVASMWLKLGRLYMGLENKAAGEKALKKAIAIMEVAHGKD 419
|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 665 | |||
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 100.0 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 100.0 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 100.0 | |
| 3rq4_A | 247 | Histone-lysine N-methyltransferase SUV420H2; suppr | 99.44 | |
| 3s8p_A | 273 | Histone-lysine N-methyltransferase SUV420H1; SET d | 99.29 | |
| 1n3j_A | 119 | A612L, histone H3 lysine methyltransferase; beta b | 99.23 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.2 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.16 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.11 | |
| 2w5y_A | 192 | Histone-lysine N-methyltransferase HRX; transcript | 99.03 | |
| 2odd_A | 64 | Protein CBFA2T1; MYND zinc finger, cross-braced to | 98.98 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 98.9 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 98.89 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 98.88 | |
| 3f9x_A | 166 | Histone-lysine N-methyltransferase SETD8; methyltr | 98.83 | |
| 3ope_A | 222 | Probable histone-lysine N-methyltransferase ASH1L; | 98.8 | |
| 3ooi_A | 232 | Histone-lysine N-methyltransferase, H3 lysine-36 l | 98.77 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 98.76 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 98.76 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 98.74 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 98.73 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 98.71 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 98.71 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 98.71 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 98.7 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 98.67 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 98.67 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 98.66 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 98.65 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 98.65 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 98.65 | |
| 3h6l_A | 278 | Histone-lysine N-methyltransferase SETD2; SET doma | 98.63 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 98.63 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 98.62 | |
| 1ml9_A | 302 | Histone H3 methyltransferase DIM-5; adoMet-depende | 98.62 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 98.61 | |
| 3hna_A | 287 | Histone-lysine N-methyltransferase, H3 lysine-9 sp | 98.61 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 98.57 | |
| 3bo5_A | 290 | Histone-lysine N-methyltransferase setmar; SET dom | 98.56 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 98.55 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 98.52 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 98.52 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 98.52 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 98.52 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 98.52 | |
| 1mvh_A | 299 | Cryptic LOCI regulator 4; lysine methyltransferase | 98.5 | |
| 2f69_A | 261 | Histone-lysine N-methyltransferase, H3 lysine-4 sp | 98.5 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 98.49 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.48 | |
| 2r3a_A | 300 | Histone-lysine N-methyltransferase SUV39H2; histon | 98.48 | |
| 3qxy_A | 449 | N-lysine methyltransferase SETD6; epigenetics, pro | 98.48 | |
| 3smt_A | 497 | Histone-lysine N-methyltransferase SETD3; histone | 98.47 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 98.46 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.45 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 98.45 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 98.43 | |
| 1h3i_A | 293 | Histone H3 lysine 4 specific methyltransferase; 2. | 98.43 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 98.43 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 98.43 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 98.41 | |
| 2qpw_A | 149 | PR domain zinc finger protein 2; methyltransferase | 98.4 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 98.4 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 98.36 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 98.34 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 98.31 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 98.29 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 98.29 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 98.29 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 98.27 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 98.25 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.25 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 98.24 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 98.21 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 98.21 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 98.21 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 98.18 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 98.18 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 98.18 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 98.18 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 98.17 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 98.15 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 98.15 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 98.14 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 98.12 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 98.12 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 98.11 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 98.1 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 98.06 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.05 | |
| 2jw6_A | 52 | Deformed epidermal autoregulatory factor 1 homolo; | 98.05 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 98.05 | |
| 2dj8_A | 60 | Protein CBFA2T1; zinc finger MYND domain, protein | 98.03 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 98.03 | |
| 2h21_A | 440 | Ribulose-1,5 bisphosphate carboxylase/oxygenase; S | 98.02 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 98.01 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 98.0 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.0 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 97.98 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 97.96 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 97.94 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.94 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 97.94 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 97.93 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 97.92 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 97.89 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 97.89 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 97.87 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 97.86 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 97.85 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 97.83 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 97.83 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 97.81 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 97.81 | |
| 2od1_A | 60 | Protein CBFA2T1; zinc finger, cross-braced topolog | 97.8 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 97.8 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 97.8 | |
| 2d8q_A | 70 | BLU protein, zinc finger MYND domain containing pr | 97.76 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.76 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 97.76 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 97.75 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.73 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 97.73 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.67 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 97.66 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.66 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 97.66 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.65 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 97.64 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 97.64 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 97.64 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 97.64 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.64 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 97.63 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 97.62 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 97.62 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.62 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 97.61 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 97.6 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.58 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.57 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 97.57 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.56 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 97.56 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 97.56 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 97.56 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.55 | |
| 3db5_A | 151 | PR domain zinc finger protein 4; methyltransferase | 97.55 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 97.54 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 97.53 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 97.52 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 97.5 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 97.49 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 97.48 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 97.47 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 97.42 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.42 | |
| 3ep0_A | 170 | PR domain zinc finger protein 12; PR domain-contai | 97.41 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 97.38 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 97.37 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 97.37 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 97.37 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.36 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 97.36 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 97.34 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.34 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 97.3 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 97.27 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 97.26 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 97.24 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.21 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.18 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 97.15 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 97.09 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.08 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 97.08 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 97.06 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 97.06 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 97.05 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.04 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.01 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 97.01 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 97.0 | |
| 3dal_A | 196 | PR domain zinc finger protein 1; methyltransferase | 96.98 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 96.97 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 96.96 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 96.92 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 96.92 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.91 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 96.89 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 96.88 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.84 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 96.82 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 96.78 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.75 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 96.74 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 96.73 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 96.71 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 96.7 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 96.68 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 96.67 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 96.67 | |
| 3ihx_A | 152 | PR domain zinc finger protein 10; PRDM10, methyltr | 96.65 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 96.58 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 96.57 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 96.56 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 96.55 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 96.5 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 96.45 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 96.45 | |
| 3ray_A | 237 | PR domain-containing protein 11; structural genomi | 96.42 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 96.41 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 96.39 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 96.36 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 96.26 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 96.19 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 96.18 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 96.17 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 96.13 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 95.9 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 95.89 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 95.89 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 95.84 | |
| 1n3j_A | 119 | A612L, histone H3 lysine methyltransferase; beta b | 95.44 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 95.23 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 95.23 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 95.14 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 95.07 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 94.88 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 94.82 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 94.6 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 94.54 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 94.45 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 94.18 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 94.0 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 93.83 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 93.76 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 93.62 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 93.53 | |
| 3f9x_A | 166 | Histone-lysine N-methyltransferase SETD8; methyltr | 93.06 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 92.74 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 92.07 | |
| 3ooi_A | 232 | Histone-lysine N-methyltransferase, H3 lysine-36 l | 91.61 | |
| 2w5y_A | 192 | Histone-lysine N-methyltransferase HRX; transcript | 91.24 | |
| 3ope_A | 222 | Probable histone-lysine N-methyltransferase ASH1L; | 91.18 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 91.13 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 89.96 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 89.95 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 89.34 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 89.07 | |
| 3h6l_A | 278 | Histone-lysine N-methyltransferase SETD2; SET doma | 89.07 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 89.01 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 88.37 | |
| 3hna_A | 287 | Histone-lysine N-methyltransferase, H3 lysine-9 sp | 88.12 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 87.97 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 87.8 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 87.72 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 87.3 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 86.88 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 86.86 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 86.55 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 86.07 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 85.0 | |
| 3bo5_A | 290 | Histone-lysine N-methyltransferase setmar; SET dom | 84.7 | |
| 3smt_A | 497 | Histone-lysine N-methyltransferase SETD3; histone | 83.67 | |
| 1ml9_A | 302 | Histone H3 methyltransferase DIM-5; adoMet-depende | 83.2 | |
| 1mvh_A | 299 | Cryptic LOCI regulator 4; lysine methyltransferase | 82.74 | |
| 3qxy_A | 449 | N-lysine methyltransferase SETD6; epigenetics, pro | 81.6 |
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-60 Score=519.51 Aligned_cols=416 Identities=20% Similarity=0.262 Sum_probs=303.6
Q ss_pred eeeEeeecCCCCcccccccCCCCCCcccccCCceeccccccccccccccccccccCCcCCCCCCCccccchHHHHhhhcc
Q 048211 120 VQLQCVTTPDKGRGITSQYDIPEGSLVHSEEPYAVTISKHCRETHCHYCLNELPADAIPCTSCSIPLYCSRRCRGQAGGQ 199 (665)
Q Consensus 120 ~~~~v~~s~~~GR~lvAtrdi~~GevIl~e~P~~~~~~~~~~~~~C~~C~~~~~~~~~~C~~C~~~~YCS~~C~~~a~~~ 199 (665)
..|++..++.+||||||+++|++||+|+.|+|+++++.......+|.+|+++.. .+.+|++|++++|||++||+.+|.
T Consensus 7 ~~ve~~~~~~~GRgl~A~r~i~~Ge~Il~e~P~a~~~~~~~~~~~C~~C~~~~~-~~~~C~~C~~~~yCs~~Cq~~~w~- 84 (433)
T 3qww_A 7 GGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKE-GLSKCGRCKQAFYCDVECQKEDWP- 84 (433)
T ss_dssp TTEEEEECTTSCEEEEESSCBCTTCEEEEEECSEEEECGGGTTTBCTTTCCBCS-SCEECTTTSCCEESSHHHHHHHHH-
T ss_pred CcEEEeecCCCcCeEEECCCCCCCCEEEecCCceEEecccccCCcCCcccccCC-CCCCCCCCcceeecChhhhhhhhh-
Confidence 368899999999999999999999999999999999888888999999999754 589999999999999999999995
Q ss_pred ccccCCcccccccccchhhHHHHHHhhcCCCCCCCcccccccccccccCCCCCCCchHHHHHHHHHHHhHhhcCCCCCch
Q 048211 200 VFKNCPMERNINDSVFDNLEEYISQITLDNDFYPEDEHIFEHKHECKGVHWPVILPSDVVLAGRVLVKSVQKNGVSMDVP 279 (665)
Q Consensus 200 ~H~~eC~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~H~~eC~~~~~~~~~p~~~~l~~R~l~~~~~~~~~~~~~~ 279 (665)
+|+.||.....+ ...| .++..+++++|++++... .+......
T Consensus 85 ~Hk~eC~~l~~~-----------------------------------~~~~--~p~~~~rl~~Ril~~~~~-~~~~~~~~ 126 (433)
T 3qww_A 85 LHKLECSSMVVL-----------------------------------GENW--NPSETVRLTARILAKQKI-HPERTPSE 126 (433)
T ss_dssp HHTTTHHHHHHS-----------------------------------STTC--CCCHHHHHHHHHHHHHHH-CCSCCGGG
T ss_pred HHHHHHHHHHHh-----------------------------------CccC--CCcHHHHHHHHHHHHhhh-ccccCchh
Confidence 889998664311 0001 234567899999887532 11111233
Q ss_pred hhhhhhhcccCCCCCCchhhHHHHHHHHHHHHHHhhhcCCCCCCCCccHHHHHHHHhhhhcceeeccccccCCCCCCCCC
Q 048211 280 NLLGKLELSHNYSQVSPESKLESHIYAIVLLYCLQHSYGFELPINGASVSQVVILISQIRVNSLAIVRMNSNNYGQSDHV 359 (665)
Q Consensus 280 ~~~~~~~L~~h~~~~~~~~~~~~~~~a~~l~~~L~~~~~~~~~~~~~~~~~l~~~~~~l~~Na~~i~~~~~~~~~~~~~~ 359 (665)
.+..+.+|++|.+.+.++.+..+......+..++.... . ..+...++.+++++.+|+|+|.+.
T Consensus 127 ~~~~~~~L~sh~~~~~~~~~~~~~~~~~~l~~~~~~~~--~----~~~~~~i~~~~~~~~~N~f~i~~~----------- 189 (433)
T 3qww_A 127 KLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKYL--E----FPDHSSLVVLFAQVNCNGFTIEDE----------- 189 (433)
T ss_dssp SSCCGGGCCCCGGGCCHHHHHHHHHHHHHHHHHHTTTC--C----CCCHHHHHHHHHHHHHHCEEEECT-----------
T ss_pred hhhhHHHHHhhhhccChHHHHHHHHHHHHHHHHHhccc--C----CCCHHHHHHHHHHHcCCceecccC-----------
Confidence 55567889999988876543222211112222332211 1 123566788999999999999641
Q ss_pred CCCCccccccceeEEEeccccccccCCCcCCcEEEEeCCEEEEEEeecCCCCCceeeecCCCCCCCCHHHHHHHhhcCCC
Q 048211 360 SSGSTCTVEQVRVGLAIYTAGSLFNHSCLPNIHAYFLSRTLMIRTTEFVPSGYPLELSYGPQVGQWDCKDRLKFLEDEYS 439 (665)
Q Consensus 360 ~~g~~~~~~~~~~g~glyp~~Sl~NHSC~PN~~~~f~g~~~~vrA~r~I~~GeeI~isY~~~~~~~~~~~Rr~~L~~~y~ 439 (665)
+...+|.||||.+|+|||||+||+.+.|+|++++|||++||++||||||||++. .+++.+||+.|+++|+
T Consensus 190 --------~~~~~g~gl~p~~s~~NHsC~PN~~~~~~~~~~~~~a~r~I~~Geel~i~Y~~~--~~~~~~R~~~L~~~~~ 259 (433)
T 3qww_A 190 --------ELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDL--LYPTEDRNDRLRDSYF 259 (433)
T ss_dssp --------TCCEEEEEECTTGGGSEECSSCSEEEEEETTEEEEEESSCBCTTCEEEECCSCT--TSCHHHHHHHHHHHHS
T ss_pred --------CccceeEEecccccccCCCCCCCceEEEcCCEEEEEeccCcCCCCEEEEeecCC--cCCHHHHHHHHhCcCC
Confidence 125689999999999999999999999999999999999999999999999997 5899999999999999
Q ss_pred eeeeccCCCCCccCCccccceecCCCCCCCcccCCcccchhhhhhccCCCCCCCCCCccccccCCCCchhHHHHHHHHhh
Q 048211 440 FRCQCSGCSELNTSDLVINAFCCVDPNCPGVVLDNSILNCEKQKRKHLPAVPQCSSSAPHLQVGKLSSDYIGLVAYLLLE 519 (665)
Q Consensus 440 F~C~C~rC~~~~~~d~~~~~~~C~~~~C~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~ 519 (665)
|+|.|+||.++++++.+. ++++ |+.. +.. .+ -++++..++..++
T Consensus 260 F~C~C~~C~~~~~d~~~~-~~~~----~~~~--~~~------------------------e~-----v~~~~~~~~~~le 303 (433)
T 3qww_A 260 FTCECRECTTKDKDKAKV-EVRK----LSSP--PQA------------------------EA-----IRDMVRYARNVIE 303 (433)
T ss_dssp CCCCSHHHHHCTTHHHHT-CBCC----CSSC--CCH------------------------HH-----HHHHHHHHHHHHH
T ss_pred EEeECCCCCCCCcchhhh-hhhh----cCCC--ccH------------------------HH-----HHHHHHHHHHHHH
Confidence 999999999988754333 3321 2211 000 00 0223333444442
Q ss_pred hcCCccccCCccccccCccccchhhhhhHHHHHHHHHHHH----HHHhHHhh----HHHHHHHHHHHHHhHHHHHHHhhh
Q 048211 520 ENNRTSRYGPGYCLKCGSDRDLESSYATVDEAWIYIRRLQ----DAIISKEI----SRAVLLDASRFLGLLRSILHAYNK 591 (665)
Q Consensus 520 ~~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~----~~~~~~~~~~~l~~~~~~l~~~~~ 591 (665)
..... .++ | +. ++|...+++.. ..+...++ +...+..+...+++|.+++. +..
T Consensus 304 ~~~~~---~~~-----g---~~-------~eA~~~~~~~L~i~~~~lg~~Hp~~a~~~~nLa~~y~~~g~~~eA~~-~~~ 364 (433)
T 3qww_A 304 EFRRA---KHY-----K---SP-------SELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALK-YGQ 364 (433)
T ss_dssp HHHHH---TTT-----S---CH-------HHHHHHHHHHHHHHTTTBCTTSHHHHHHHHHHHHHHHHTTCHHHHHH-HHH
T ss_pred HHHHh---hhc-----c---CH-------HHHHHHHHHHHHHhhCccChhchHHHHHHHHHHHHHHhhcCHHHHHH-HHH
Confidence 21110 000 0 11 22232332211 11111111 12356666777899999995 888
Q ss_pred HHHHHHHHHhCCCChHHHHHHHHHHHHHhhcCChhhH-hHHHHHHHHHHHhhCCCCcchhhhHHHHH
Q 048211 592 SIAEILEKLYGHNHIVIGYELVKLSSIQLSLDDHNAV-DTISRLAAIFLHYFGSHAETMFPHLLFLQ 657 (665)
Q Consensus 592 ~~~~~~~~~yg~~~~~~g~~l~~l~~~~l~~~~~~~a-~~~~~A~~il~~~~G~~~~~~~~~~~~l~ 657 (665)
+.+.++++.||++||.+|..|++||.++++.|+.++| +++.||.+|+..+||++||.|.++..+|+
T Consensus 365 ~aL~i~~~~lG~~Hp~~a~~l~nLa~~~~~qg~~~eA~~~~~~Al~i~~~~lG~~Hp~~~~l~~~l~ 431 (433)
T 3qww_A 365 KIIKPYSKHYPVYSLNVASMWLKLGRLYMGLENKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIE 431 (433)
T ss_dssp HHHHHHHHHSCSSCHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHTCTTCHHHHHHHHHHH
T ss_pred HHHHHHHHHcCCCChHHHHHHHHHHHHHHhccCHHHHHHHHHHHHHHHHHHcCCCChHHHHHHHHHh
Confidence 8899999999999999999999999999999999999 99999999999999999999988777665
|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3rq4_A Histone-lysine N-methyltransferase SUV420H2; suppressor, variegation 4-20 homolog 2, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3s8p_A Histone-lysine N-methyltransferase SUV420H1; SET domain, histone methyltransferase, transcription regulat histone lysine, SAM, methylation, nucleus; HET: MSE SAM; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1n3j_A A612L, histone H3 lysine methyltransferase; beta barrel, homodimer; NMR {Paramecium bursaria chlorella virus 1} SCOP: b.85.7.2 PDB: 2g46_A* 3kma_A 3kmj_A 3kmt_A* | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2w5y_A Histone-lysine N-methyltransferase HRX; transcription regulation, chromosomal rearrangement, protein lysine methyltransferase, proto-oncogene; HET: SAH; 2.00A {Homo sapiens} PDB: 2w5z_A* | Back alignment and structure |
|---|
| >2odd_A Protein CBFA2T1; MYND zinc finger, cross-braced topology, poly-proline, proline-tryptophan interaction, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3f9x_A Histone-lysine N-methyltransferase SETD8; methyltransferase, SET, lysine, alternative splicing, cell cycle, cell division, chromatin regulator, chromosomal protein, coiled coil; HET: MLY SAH; 1.25A {Homo sapiens} PDB: 3f9w_A* 3f9y_A* 3f9z_A* 1zkk_A* 4ij8_A* 2bqz_A* | Back alignment and structure |
|---|
| >3ope_A Probable histone-lysine N-methyltransferase ASH1L; SET, nucleus; HET: SAM; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3ooi_A Histone-lysine N-methyltransferase, H3 lysine-36 lysine-20 specific; SET domain, S-adenosyl-L methionine; HET: SAM; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >1ml9_A Histone H3 methyltransferase DIM-5; adoMet-dependent methyltransferase histone H3 lysine- 9 methylation; 1.98A {Neurospora crassa} SCOP: b.85.7.1 PDB: 1peg_A* | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hna_A Histone-lysine N-methyltransferase, H3 lysine-9 specific 5; EHMT1, structural genomics, SGC, structural genomics consortium, alternative splicing, ANK repeat; HET: MLZ SAH; 1.50A {Homo sapiens} PDB: 2rfi_A* 2igq_A* 3mo0_A* 3mo2_A* 3mo5_A* 3sw9_A* 3swc_A* 4h4h_A* 4i51_A* 3fpd_A* 3k5k_A* 3nni_A* 3rjw_A* 2o8j_A* | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3bo5_A Histone-lysine N-methyltransferase setmar; SET domain, chromati regulator, DNA damage, DNA repair, DNA-binding, nucleus, ST genomics; HET: SAH; 1.59A {Homo sapiens} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1mvh_A Cryptic LOCI regulator 4; lysine methyltransferase, CLR4, SET-domain; 2.30A {Schizosaccharomyces pombe} SCOP: b.85.7.1 PDB: 1mvx_A | Back alignment and structure |
|---|
| >2f69_A Histone-lysine N-methyltransferase, H3 lysine-4 specific SET7; SET domain, protein lysine methyltransferase, enzyme- peptide-adohcy complex; HET: MLZ SAH; 1.30A {Homo sapiens} SCOP: b.76.2.1 b.85.7.1 PDB: 3m53_A* 3m55_A* 3m54_A* 3m56_A* 3m58_A* 3m57_A* 3m59_A* 3m5a_A* 1xqh_A* 4e47_A* 1n6a_A* 1o9s_A* 3cbp_A* 3cbm_A* 3cbo_A* 3os5_A* | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2r3a_A Histone-lysine N-methyltransferase SUV39H2; histone H3-K9 methyltransferase 2, H3 lysine-9 specific 2, alternative splicing, cell cycle; HET: SAM; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3qxy_A N-lysine methyltransferase SETD6; epigenetics, protein lysine methyltransferase, transferase, network VIA methyllysine signaling; HET: SAM; 2.09A {Homo sapiens} PDB: 3rc0_A* | Back alignment and structure |
|---|
| >3smt_A Histone-lysine N-methyltransferase SETD3; histone methyltransferase, histone modification, LYSI translational modification, structural genomics; HET: SAM; 2.04A {Homo sapiens} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1h3i_A Histone H3 lysine 4 specific methyltransferase; 2.1A {Homo sapiens} SCOP: b.76.2.1 b.85.7.1 PDB: 1mt6_A* 1n6c_A* 1muf_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2qpw_A PR domain zinc finger protein 2; methyltransferase, activator, alternative initiation, alternative splicing, DNA-binding, metal-binding, nucleus; 1.79A {Homo sapiens} PDB: 2jv0_A* | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2jw6_A Deformed epidermal autoregulatory factor 1 homolo; zinc binding domain, transcription, alternative splicing, DI mutation, DNA-binding; NMR {Homo sapiens} SCOP: g.85.1.1 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2dj8_A Protein CBFA2T1; zinc finger MYND domain, protein MTG8, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.85.1.1 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2h21_A Ribulose-1,5 bisphosphate carboxylase/oxygenase; SET domain, protein lysine methyltransferase, transferase; HET: SAM; 2.45A {Pisum sativum} SCOP: a.166.1.1 b.85.7.3 PDB: 2h23_A* 2h2e_A* 2h2j_A* 1p0y_A* 1ozv_A* 1mlv_A* | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2od1_A Protein CBFA2T1; zinc finger, cross-braced topology, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2d8q_A BLU protein, zinc finger MYND domain containing protein 10; zmynd10, ZF-MYND, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.85.1.1 PDB: 2dan_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3db5_A PR domain zinc finger protein 4; methyltransferase, PRDM4, structural genomics, structural GE consortium, SGC, DNA-binding, metal-binding, nucleus; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3ep0_A PR domain zinc finger protein 12; PR domain-containing protein 12, structural genomics, structural genomics consortium, SGC, DNA-binding; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3dal_A PR domain zinc finger protein 1; methyltransferase, PRDM1, structural genomics, structural genomics consortium, SGC, DNA-binding, metal-binding; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ihx_A PR domain zinc finger protein 10; PRDM10, methyltransferase, structural genomics, structural G consortium, SGC, DNA-binding, metal-binding, nucleus; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3ray_A PR domain-containing protein 11; structural genomics consortium, SGC, histone methylation, Zn transcriptional regulation, chromatin, transcription; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1n3j_A A612L, histone H3 lysine methyltransferase; beta barrel, homodimer; NMR {Paramecium bursaria chlorella virus 1} SCOP: b.85.7.2 PDB: 2g46_A* 3kma_A 3kmj_A 3kmt_A* | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3f9x_A Histone-lysine N-methyltransferase SETD8; methyltransferase, SET, lysine, alternative splicing, cell cycle, cell division, chromatin regulator, chromosomal protein, coiled coil; HET: MLY SAH; 1.25A {Homo sapiens} PDB: 3f9w_A* 3f9y_A* 3f9z_A* 1zkk_A* 4ij8_A* 2bqz_A* | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >3ooi_A Histone-lysine N-methyltransferase, H3 lysine-36 lysine-20 specific; SET domain, S-adenosyl-L methionine; HET: SAM; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2w5y_A Histone-lysine N-methyltransferase HRX; transcription regulation, chromosomal rearrangement, protein lysine methyltransferase, proto-oncogene; HET: SAH; 2.00A {Homo sapiens} PDB: 2w5z_A* | Back alignment and structure |
|---|
| >3ope_A Probable histone-lysine N-methyltransferase ASH1L; SET, nucleus; HET: SAM; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3hna_A Histone-lysine N-methyltransferase, H3 lysine-9 specific 5; EHMT1, structural genomics, SGC, structural genomics consortium, alternative splicing, ANK repeat; HET: MLZ SAH; 1.50A {Homo sapiens} PDB: 2rfi_A* 2igq_A* 3mo0_A* 3mo2_A* 3mo5_A* 3sw9_A* 3swc_A* 4h4h_A* 4i51_A* 3fpd_A* 3k5k_A* 3nni_A* 3rjw_A* 2o8j_A* | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3bo5_A Histone-lysine N-methyltransferase setmar; SET domain, chromati regulator, DNA damage, DNA repair, DNA-binding, nucleus, ST genomics; HET: SAH; 1.59A {Homo sapiens} | Back alignment and structure |
|---|
| >3smt_A Histone-lysine N-methyltransferase SETD3; histone methyltransferase, histone modification, LYSI translational modification, structural genomics; HET: SAM; 2.04A {Homo sapiens} | Back alignment and structure |
|---|
| >1ml9_A Histone H3 methyltransferase DIM-5; adoMet-dependent methyltransferase histone H3 lysine- 9 methylation; 1.98A {Neurospora crassa} SCOP: b.85.7.1 PDB: 1peg_A* | Back alignment and structure |
|---|
| >1mvh_A Cryptic LOCI regulator 4; lysine methyltransferase, CLR4, SET-domain; 2.30A {Schizosaccharomyces pombe} SCOP: b.85.7.1 PDB: 1mvx_A | Back alignment and structure |
|---|
| >3qxy_A N-lysine methyltransferase SETD6; epigenetics, protein lysine methyltransferase, transferase, network VIA methyllysine signaling; HET: SAM; 2.09A {Homo sapiens} PDB: 3rc0_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 665 | ||||
| d2c2la1 | 201 | a.118.8.1 (A:24-224) STIP1 homology and U box-cont | 6e-04 | |
| d1dcea1 | 334 | a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr | 9e-04 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 0.001 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 0.002 |
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: STIP1 homology and U box-containing protein 1, STUB1 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 39.2 bits (90), Expect = 6e-04
Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 2/82 (2%)
Query: 12 ATLYVNRASVLQKRDHLVECLRDCNRAVQICPSYAKAWYRRGKVNVSLENHDDAVHDLT- 70
A Y NRA K + L DC RA+++ KA + G+ + +E++D+A+ +L
Sbjct: 38 AVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQR 97
Query: 71 -IAKNRESSLAGKKQIESELKI 91
+ +E L I S L+I
Sbjct: 98 AYSLAKEQRLNFGDDIPSALRI 119
|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 665 | |||
| d2h2ja2 | 261 | RuBisCo LSMT catalytic domain {Garden pea (Pisum s | 99.71 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.33 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.23 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.22 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.17 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.1 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 98.93 | |
| d2g46a1 | 119 | Viral histone H3 Lysine 27 Methyltransferase {Para | 98.92 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 98.82 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 98.78 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 98.73 | |
| d1ml9a_ | 284 | Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]} | 98.67 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 98.66 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.64 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 98.63 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.59 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.58 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 98.57 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.53 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 98.49 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.48 | |
| d2f69a2 | 171 | Histone H3 K4-specific methyltransferase SET7/9 ca | 98.47 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 98.36 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.34 | |
| d1mvha_ | 269 | SET domain of Clr4 {Fission yeast (Schizosaccharom | 98.33 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 98.32 | |
| d2jw6a1 | 38 | Zinc finger MYND domain-containing protein 2, MTG8 | 98.27 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.2 | |
| d2dj8a1 | 47 | Zinc finger MYND domain-containing protein 2, MTG8 | 98.19 | |
| d2dana1 | 47 | Zinc finger MYND domain-containing protein 10, ZMY | 98.17 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 98.17 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 98.04 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.97 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 97.96 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 97.96 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.94 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 97.9 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 97.81 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.74 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 97.67 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 97.64 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 97.63 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 97.6 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 97.56 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 97.53 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 97.33 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 97.26 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 97.25 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 96.94 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 96.73 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 96.61 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 96.08 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 96.08 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 96.02 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 95.8 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 95.41 | |
| d2g46a1 | 119 | Viral histone H3 Lysine 27 Methyltransferase {Para | 95.13 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 94.34 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 94.29 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 92.24 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 90.63 | |
| d1ml9a_ | 284 | Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]} | 90.29 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 89.32 | |
| d1mvha_ | 269 | SET domain of Clr4 {Fission yeast (Schizosaccharom | 88.06 | |
| d2f69a2 | 171 | Histone H3 K4-specific methyltransferase SET7/9 ca | 87.67 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 86.37 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 86.35 |
| >d2h2ja2 b.85.7.3 (A:50-310) RuBisCo LSMT catalytic domain {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: beta-clip superfamily: SET domain family: RuBisCo LSMT catalytic domain domain: RuBisCo LSMT catalytic domain species: Garden pea (Pisum sativum) [TaxId: 3888]
Probab=99.71 E-value=6e-19 Score=176.83 Aligned_cols=87 Identities=14% Similarity=0.159 Sum_probs=65.4
Q ss_pred ccHHHHHHHHhhhhcceeeccccccCCCCCCCCCCCCCccccccceeEEEeccccccccCCCcCCcEEEEe---------
Q 048211 326 ASVSQVVILISQIRVNSLAIVRMNSNNYGQSDHVSSGSTCTVEQVRVGLAIYTAGSLFNHSCLPNIHAYFL--------- 396 (665)
Q Consensus 326 ~~~~~l~~~~~~l~~Na~~i~~~~~~~~~~~~~~~~g~~~~~~~~~~g~glyp~~Sl~NHSC~PN~~~~f~--------- 396 (665)
.+.......++.+..++|.+. ...|.+|||.++|+||||.||+.+.+.
T Consensus 158 ~~~~~~~~a~~~v~sr~~~~~-----------------------~~~~~~l~P~~d~~NHsc~pn~~~~~~~~~~~~~~~ 214 (261)
T d2h2ja2 158 VTLDDFFWAFGILRSRAFSRL-----------------------RNENLVVVPMADLINHSAGVTTEDHAYEVKGAAGLF 214 (261)
T ss_dssp CCHHHHHHHHHHHHHHSBCCC--------------------------CCBCCTTGGGCEECSSCCSCCCCCC--------
T ss_pred cCHHHHHHHHHHhhccccccc-----------------------ccccccchhhhHHhhcCCCCCcccccccccCccccc
Confidence 344555566667777777653 235678999999999999999988764
Q ss_pred --CCEEEEEEeecCCCCCceeeecCCCCCCCCHHHHHHHhhcCCCeee
Q 048211 397 --SRTLMIRTTEFVPSGYPLELSYGPQVGQWDCKDRLKFLEDEYSFRC 442 (665)
Q Consensus 397 --g~~~~vrA~r~I~~GeeI~isY~~~~~~~~~~~Rr~~L~~~y~F~C 442 (665)
++.++|||.|||++|||||||||+. .+.. .|...|+|.+
T Consensus 215 ~~~~~~~l~A~r~I~~GEEI~isYG~~---~~n~----~ll~~yGFv~ 255 (261)
T d2h2ja2 215 SWDYLFSLKSPLSVKAGEQVYIQYDLN---KSNA----ELALDYGFIE 255 (261)
T ss_dssp ---CEEEEECSSCCCTTSBCEECSCSS---CCHH----HHHHHSSCCC
T ss_pred CCCcEEEEEECCCCCCCCEEEEecCCC---CCHH----HHHHhCCCCC
Confidence 2579999999999999999999964 3432 3666899985
|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g46a1 b.85.7.2 (A:1-119) Viral histone H3 Lysine 27 Methyltransferase {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ml9a_ b.85.7.1 (A:) Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2f69a2 b.85.7.1 (A:194-364) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1mvha_ b.85.7.1 (A:) SET domain of Clr4 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jw6a1 g.85.1.1 (A:503-540) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj8a1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dana1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 10, ZMYND10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g46a1 b.85.7.2 (A:1-119) Viral histone H3 Lysine 27 Methyltransferase {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ml9a_ b.85.7.1 (A:) Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1mvha_ b.85.7.1 (A:) SET domain of Clr4 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2f69a2 b.85.7.1 (A:194-364) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|