Citrus Sinensis ID: 048228

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------63
MPPSYFPLRWESTGDQWWYASPIDFAAANGHYELVKELLHLDTNLLIKLTSLRRIRRLETVWDDEEQFDDVAKCRSSVARKLLHDCETKKGHNSLIRAGYGGWLLYTAASAGDVRFVKELLQRDPLLVFGEGEYGVTDILYAAARSKNSEVFRLLLDNAVAPRCCLSSGGEFEEKLSDSYSVFKWEMMNRAVHAVARGGNLDILRQLLGDCENVLAYRDVQGSTILHSASGRGQVEVLIAKSPSLISVTNSHGDTFLHMVVAGFRSPGFRRVDHQIQLMEQLVSGKIVEVKDIINVTNNNGRTALHLAVSENIQCNLVELLMTVPSINLNIQDGEGMTPLDLLKQHPRSASSEILIKQLISAGGISNCQDNVARNAIACHLKGQGIGVSPGSSFRVPDAEIFLYTGIENASDAICDAASVEYSSCLSEQSDFDSSNTPDDKKSSPIDYAARRLKFLLRWTKRKERKATSSELGDGDTLATSSISTNWGNSPISLRQKYQKSVSLPNNKRILSLRSDFPSPDTKNKFTAGLMHGVIQPLPHLASPTQSLPSPLSGSSISSPTSMEKQNGVDISEPSCINGTPQMNRKQTSFDKKLMNQYLCFGAQGLAGEDSINNLKPGRRFKHVGSLVT
ccccccccccEEcccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHcccccHHHHccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccEEEEEEccccccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHccccHHHHHHHHHHHHccccccccccccccHHHHHHHcccccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccEEccccccHHcHcHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccHcccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccHHHHHHcccccEEEcccccccHHHcccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHccccEEEEEcccccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHcccccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccEccccccccHHHHHHHHHccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHccccccccHHHHccccHHHHHHcccccccHHHHcccccHHHHccccccccccccccccccccccHHHHccccccccccccEEEEEcccccHHHHHHHHHcccccEEEccccccccccccccccccccccccccHccccccccccccccccccccccccccccHHHcccEEEEcccccEEccccccccccccHHEccHccc
mppsyfplrwestgdqwwyaspidfaaANGHYELVKELLHLDTNLLIKLTSLRRIRRLetvwddeeqfdDVAKCRSSVARKLLHDCETKKGHNSLIRAGYGGWLLYTAASAGDVRFVKELLqrdpllvfgegeygvTDILYAAARSKNSEVFRLLLdnavaprcclssggefeeklSDSYSVFKWEMMNRAVHAVARGGNLDILRQLLGDCENVLAyrdvqgstilhsasgrgQVEVLIAkspslisvtnshgdTFLHMVVAgfrspgfrrvDHQIQLMEQLVSGKIVEVKDIINVTNNNGRTALHLAVSENIQCNLVELLMtvpsinlniqdgegmtpldllkqhprsasSEILIKQLISaggisncqdNVARNAIAChlkgqgigvspgssfrvpdaEIFLYTGIENASDAICDAASVEYSsclseqsdfdssntpddkksspiDYAARRLKFLLRWTKRKerkatsselgdgdtlatssistnwgnspisLRQKYQksvslpnnkrilslrsdfpspdtknkftaglmhgviqplphlasptqslpsplsgssissptsmekqngvdisepscingtpqmnrkqtsFDKKLMNQYLCfgaqglagedsinnlkpgrrfkhvgslvt
MPPSYFPLRWESTGDQWWYASPIDFAAANGHYELVKELLHLDTNLLIKLTSLRRIRRLetvwddeeqfddvAKCRSSVARKLlhdcetkkghnslIRAGYGGWLLYTAASAGDVRFVKELLQRDPLLVFGEGEYGVTDILYAAARSKNSEVFRLLLDNAVAPRCClssggefeeKLSDSYSVFKWEMMNRAVHAVARGGNLDILRQLLGDCENVLAYRDVQGSTILHSASGRGQVEVLIAKSPSLISVTNSHGDTFLHMVVAGFRSPGFRRVDHQIQLMEQLVSGKIVEVKDIINVTNNNGRTALHLAVSENIQCNLVELLMTVPSINLNIQDGEGMTPLDLLKQHPRSASSEILIKQLISAGGISNCQDNVARNAIACHLKGQGIGVSPGSSFRVPDAEIFLYTGIENASDAICDAASVEYSSCLSeqsdfdssntpddkksspidyAARRLKFLLrwtkrkerkatsselgdgdtlatssistnwgnspISLRQKYQKSVSLPNNKRILSLRSDFPSPDTKNKFTAGLMHGVIQPLPHLASPTQSLPSPLSGSSISSPTSMEKQNGVDISEPSCINGTPQMNRKQTSFDKKLMNQYLCFGAQGLAGEDSinnlkpgrrfkhvgslvt
MPPSYFPLRWESTGDQWWYASPIDFAAANGHYELVKELLHLDTNLLIKLTSLRRIRRLETVWDDEEQFDDVAKCRSSVARKLLHDCETKKGHNSLIRAGYGGWLLYTAASAGDVRFVKELLQRDPLLVFGEGEYGVTDILYAAARSKNSEVFRLLLDNAVAPRCCLSSGGEFEEKLSDSYSVFKWEMMNRAVHAVARGGNLDILRQLLGDCENVLAYRDVQGSTILHSASGRGQVEVLIAKSPSLISVTNSHGDTFLHMVVAGFRSPGFRRVDHQIQLMEQLVSGKIVEVKDIINVTNNNGRTALHLAVSENIQCNLVELLMTVPSINLNIQDGEGMTPLDLLKQHPRSASSEILIKQLISAGGISNCQDNVARNAIACHLKGQGIGVSPGSSFRVPDAEIFLYTGIENASDAICDAASVEYSSCLSEQSDFDSSNTPDDKKSSPIDYAARRLKFLLRWTKRKERKATSSELGDGDTLATSSISTNWGNSPISLRQKYQKSVSLPNNKRILSLRSDFPSPDTKNKFTAGLMHGVIQPLPHLAsptqslpsplsgssissptsMEKQNGVDISEPSCINGTPQMNRKQTSFDKKLMNQYLCFGAQGLAGEDSINNLKPGRRFKHVGSLVT
****YFPLRWESTGDQWWYASPIDFAAANGHYELVKELLHLDTNLLIKLTSLRRIRRLETVWDDEEQFDDVAKCRSSVARKLLHDCETKKGHNSLIRAGYGGWLLYTAASAGDVRFVKELLQRDPLLVFGEGEYGVTDILYAAARSKNSEVFRLLLDNAVAPRCCLSSGGEFEEKLSDSYSVFKWEMMNRAVHAVARGGNLDILRQLLGDCENVLAYRDVQGSTILHSASGRGQVEVLIAKSPSLISVTNSHGDTFLHMVVAGFRSPGFRRVDHQIQLMEQLVSGKIVEVKDIINVTNNNGRTALHLAVSENIQCNLVELLMTVPSINLNIQDGEGMTPLDL**********EILIKQLISAGGISNCQDNVARNAIACHLKGQGIGVSPGSSFRVPDAEIFLYTGIENASDAICDAASVEYS************************YAARRLKFLLRWT*********************************************************************LMHGVI*********************************************************KLMNQYLCFGAQGLAG*********************
**PSYFPLRWESTGDQWWYASPIDFAAANGHYELVKELLHLDTNLLIKLTSLRRIRRLETVWDDEEQFDDVAKCRSSVARKLLHDCETKKGHNSLIRAGYGGWLLYTAASAGDVRFVKELLQRDPLLVFGEGEYGVTDILYAAARSKNSEVFRLLLDNAVAPRCCLSSGGEFEEKLSDSYSVFKWEMMNRAVHAVARGGNLDILRQLLGDCENVLAYRDVQGSTILHSASGRGQVEVLIAKSPSLISVTNSHGDTFLHMVVAGFRSPGFRRVDHQIQLMEQLVSGKIVEVKDIINVTNNNGRTALHLAVSENIQCNLVELLMTVPSINLNIQDGEGMTPLDLLKQHPRSASSEILIKQLISAGGISNCQDNVARNAIACHLKGQGIGVSPGSSFRVPDAEIFLYTGIENASDAICDAASVEYSSCLSEQSDFDSSNTPDDKKSSPIDYAARRLKFLLR*****************************GNSPISL*******************************************************************************************************YLCFGAQGL****************HVGSLV*
MPPSYFPLRWESTGDQWWYASPIDFAAANGHYELVKELLHLDTNLLIKLTSLRRIRRLETVWDDEEQFDDVAKCRSSVARKLLHDCETKKGHNSLIRAGYGGWLLYTAASAGDVRFVKELLQRDPLLVFGEGEYGVTDILYAAARSKNSEVFRLLLDNAVAPRCCLSSGGEFEEKLSDSYSVFKWEMMNRAVHAVARGGNLDILRQLLGDCENVLAYRDVQGSTILHSASGRGQVEVLIAKSPSLISVTNSHGDTFLHMVVAGFRSPGFRRVDHQIQLMEQLVSGKIVEVKDIINVTNNNGRTALHLAVSENIQCNLVELLMTVPSINLNIQDGEGMTPLDLLKQHPRSASSEILIKQLISAGGISNCQDNVARNAIACHLKGQGIGVSPGSSFRVPDAEIFLYTGIENASDAICDAASVEY*********************SPIDYAARRLKFLLRWTKR*************DTLATSSISTNWGNSPISLRQKYQKSVSLPNNKRILSLRSDFPSPDTKNKFTAGLMHGVIQPLPHLAS************************GVDISEPSCINGTPQMNRKQTSFDKKLMNQYLCFGAQGLAGEDSINNLKPGRRFKHVGSLVT
*PPSYFPLRWESTGDQWWYASPIDFAAANGHYELVKELLHLDTNLLIKLTSLRRIRRLETVWDDEEQFDDVAKCRSSVARKLLHDCETKKGHNSLIRAGYGGWLLYTAASAGDVRFVKELLQRDPLLVFGEGEYGVTDILYAAARSKNSEVFRLLLDNAVAPRCCLSSGGEFEEKLSDSYSVFKWEMMNRAVHAVARGGNLDILRQLLGDCENVLAYRDVQGSTILHSASGRGQVEVLIAKSPSLISVTNSHGDTFLHMVVAGFRSPGFRRVDHQIQLMEQLVSGKIVEVKDIINVTNNNGRTALHLAVSENIQCNLVELLMTVPSINLNIQDGEGMTPLDLLKQHPRSASSEILIKQLISAGGISNCQDNVARNAIACHLKGQGIGVSPGSSFRVPDAEIFLYTGIENASDAICDAASVEYSSCLSEQSDFDSSNTPDDKKSSPIDYAARRLKFLLRWTKRKER*************ATSSI****GNSPISLRQKYQKSVSLPNNKRILSLRSDFPSPDTKNKFTAGLMHGVIQPL**************************************************SFDKKLMNQYLCFGAQGLAGED******************T
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPSYFPLRWESTGDQWWYASPIDFAAANGHYELVKELLHLDTNLLIKLTSLRRIRRLETVWDDEEQFDDVAKCRSSVARKLLHDCETKKGHNSLIRAGYGGWLLYTAASAGDVRFVKELLQRDPLLVFGEGEYGVTDILYAAARSKNSEVFRLLLDNAVAPRCCLSSGGEFEEKLSDSYSVFKWEMMNRAVHAVARGGNLDILRQLLGDCENVLAYRDVQGSTILHSASGRGQVEVLIAKSPSLISVTNSHGDTFLHMVVAGFRSPGFRRVDHQIQLMEQLVSGKIVEVKDIINVTNNNGRTALHLAVSENIQCNLVELLMTVPSINLNIQDGEGMTPLDLLKQHPRSASSEILIKQLISAGGISNCQDNVARNAIACHLKGQGIGVSPGSSFRVPDAEIFLYTGIENASDAICDAASVEYSSCLSEQSDFDSSNTPDDKKSSPIDYAARRLKFLLRWTKRKERKATSSELGDGDTLATSSISTNWGNSPISLRQKYQKSVSLPNNKRILSLRSDFPSPDTKNKFTAGLMHGVIQPLPHLASPTQSLPSPLSGSSISSPTSMEKQNGVDISEPSCINGTPQMNRKQTSFDKKLMNQYLCFGAQGLAGEDSINNLKPGRRFKHVGSLVT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query629 2.2.26 [Sep-21-2011]
Q9C7A2590 Ankyrin repeat-containing no no 0.419 0.447 0.256 3e-09
Q5ZLC8 1073 Serine/threonine-protein yes no 0.251 0.147 0.281 6e-08
Q8N8A2 993 Serine/threonine-protein yes no 0.254 0.161 0.289 9e-08
Q9GKW8471 Ankyrin repeat and death N/A no 0.418 0.558 0.263 4e-07
B2RXR6 993 Serine/threonine-protein yes no 0.254 0.161 0.284 4e-07
Q5F478 990 Serine/threonine-protein no no 0.254 0.161 0.273 6e-07
Q8BTI7 1076 Serine/threonine-protein no no 0.251 0.146 0.276 7e-07
Q8NB46 1076 Serine/threonine-protein no no 0.251 0.146 0.276 7e-07
Q96AX91013 E3 ubiquitin-protein liga no no 0.526 0.326 0.249 9e-07
Q502K3 1071 Serine/threonine-protein yes no 0.251 0.147 0.281 1e-06
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function desciption
 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 81/316 (25%), Positives = 136/316 (43%), Gaps = 52/316 (16%)

Query: 66  EQFD-DVAKCRSSVARKLLHDCETKKGHNSLIRAGYGGWLLYTAASAGDVRFVKELLQRD 124
           E+FD +VA+ R+S+  ++          N L     G   L+TAA  G +  VKELL+  
Sbjct: 108 EEFDAEVAEIRASIVNEV----------NEL-----GETALFTAADKGHLDVVKELLKYS 152

Query: 125 PLLVFGEGEYGVTDILYAAARSKNSEVFRLLLDNAVAPRCCLSSGGEFEEKLSDSYSVFK 184
                 +      D L+ AA   +  +  +LLD+              +  LS ++    
Sbjct: 153 SRESIAKKNRSGYDPLHIAAIQGHHAIVEVLLDH--------------DATLSQTFGPSN 198

Query: 185 WEMMNRAVHAVARGGNLDILRQLLGDCENVLAYRDVQGSTILHSASGRGQVEV---LIAK 241
              +   V A  RG + +++ QLL    N+L          LH A+ +G VEV   L++K
Sbjct: 199 ATPL---VSAAMRG-HTEVVNQLLSKAGNLLEISRSNNKNALHLAARQGHVEVIKALLSK 254

Query: 242 SPSLISVTNSHGDTFLHMVVAGFRSPGFRRVDHQIQLMEQLVSGKIVEVKDIINVTNNNG 301
            P L    +  G T LHM V G  S          ++++ L+         I+   + + 
Sbjct: 255 DPQLARRIDKKGQTALHMAVKGQSS----------EVVKLLLDAD----PAIVMQPDKSC 300

Query: 302 RTALHLAVSENIQCNLVELLMTVPSINLNIQDGEGMTPLDLLKQHPRSASSEILIKQLIS 361
            TALH+A  +  +  +VELL+++P  N N    +  T LD+ +  P S  S  + + L  
Sbjct: 301 NTALHVATRKK-RAEIVELLLSLPDTNANTLTRDHKTALDIAEGLPLSEESSYIKECLAR 359

Query: 362 AGGISNCQDNVARNAI 377
           +G +   + N  R+ +
Sbjct: 360 SGALRANELNQPRDEL 375

Arabidopsis thaliana (taxid: 3702)
>sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 Back     alignment and function description
>sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 Back     alignment and function description
>sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 Back     alignment and function description
>sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=2 SV=1 Back     alignment and function description
>sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 Back     alignment and function description
>sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=2 SV=1 Back     alignment and function description
>sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 Back     alignment and function description
>sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 Back     alignment and function description
>sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query629
255547886663 ankyrin repeat-containing protein, putat 0.995 0.944 0.658 0.0
224102337656 predicted protein [Populus trichocarpa] 0.984 0.943 0.644 0.0
225425880668 PREDICTED: uncharacterized protein LOC10 0.969 0.913 0.65 0.0
147815182 738 hypothetical protein VITISV_024449 [Viti 0.969 0.826 0.648 0.0
224110768641 predicted protein [Populus trichocarpa] 0.958 0.940 0.624 0.0
356512349674 PREDICTED: uncharacterized protein LOC10 0.998 0.931 0.583 0.0
356567316651 PREDICTED: uncharacterized protein LOC10 0.966 0.933 0.589 0.0
356525130676 PREDICTED: uncharacterized protein LOC10 0.998 0.928 0.576 0.0
356538107652 PREDICTED: ankyrin-1-like [Glycine max] 0.968 0.934 0.584 0.0
359488622680 PREDICTED: uncharacterized protein LOC10 0.988 0.914 0.566 0.0
>gi|255547886|ref|XP_002515000.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223546051|gb|EEF47554.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  873 bits (2255), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/664 (65%), Positives = 519/664 (78%), Gaps = 38/664 (5%)

Query: 1   MPPSYFPLRWESTGDQWWYASPIDFAAANGHYELVKELLHLDTNLLIKLTSLRRIRRLET 60
           MPP YFPLRWESTGDQWWYASPIDFAAANGHY+LV+ELLHLDTNLLIKLTSLRRIRRLET
Sbjct: 1   MPPPYFPLRWESTGDQWWYASPIDFAAANGHYDLVRELLHLDTNLLIKLTSLRRIRRLET 60

Query: 61  VWDDEEQFDDVAKCRSSVARKLLHDCETKKGHNSLIRAGYGGWLLYTAASAGDVRFVKEL 120
           VWDDEEQFDDVA CR+ VARKLL +CETKKGHN+LIRAGYGGWLLYTAASAGD  FVKEL
Sbjct: 61  VWDDEEQFDDVASCRAIVARKLLLECETKKGHNTLIRAGYGGWLLYTAASAGDESFVKEL 120

Query: 121 LQRDPLLVFGEGEYGVTDILYAAARSKNSEVFRLLLDNAVAPRCCLSSGGEFEEKLSDSY 180
           L+RDPLLVFGEGEYGVTDILYAAARSKNSEVFR+LL+ +    C LSSG E EE  S+S+
Sbjct: 121 LERDPLLVFGEGEYGVTDILYAAARSKNSEVFRILLNFSSLRPCGLSSGEELEEGQSESH 180

Query: 181 SVFKWEMMNRAVHAVARGGNLDILRQLLGDCENVLAYRDVQGSTILHSASGRGQVEV--- 237
           S F+ +MMNRAVHA ARGGNL IL++LLGDC NVLAYRD QGSTILH+ASGRGQVEV   
Sbjct: 181 SDFRQDMMNRAVHAAARGGNLGILKELLGDCSNVLAYRDAQGSTILHTASGRGQVEVVKD 240

Query: 238 ---------------------------------LIAKSPSLISVTNSHGDTFLHMVVAGF 264
                                            LI  SPS+ ++TN  GDTFLHM V+GF
Sbjct: 241 LIASFHFITCTDYQGNTALHIAAYRGYLAVAEILILASPSITTITNYFGDTFLHMAVSGF 300

Query: 265 RSPGFRRVDHQIQLMEQLVSGKIVEVKDIINVTNNNGRTALHLAVSENIQCNLVELLMTV 324
           R+PGFRRVD QI+L+  LVSGKI+ ++DIINV NN+GRTALH+AV ENIQ NLVELLMTV
Sbjct: 301 RTPGFRRVDRQIELINHLVSGKIMNIQDIINVKNNDGRTALHMAVVENIQSNLVELLMTV 360

Query: 325 PSINLNIQDGEGMTPLDLLKQHPRSASSEILIKQLISAGGISNCQDNVARNAIACHLKGQ 384
           P INLNI+D  GMTPLDLLKQ PR+ASSEILIKQLISAGGIS CQDNVAR+AIA  LKGQ
Sbjct: 361 PLINLNIRDVYGMTPLDLLKQRPRTASSEILIKQLISAGGISKCQDNVARSAIASQLKGQ 420

Query: 385 GIGVSPGSSFRVPDAEIFLYTGIENASDAICDAASVEYSSCLSEQSDFDSSNTPDDKKSS 444
           GIG+SPG+SFR+PDAEIFLYTGI+NASD  C+  SV+YS+CLSE S+ +++N+  DKK +
Sbjct: 421 GIGMSPGTSFRIPDAEIFLYTGIDNASDGSCEVTSVDYSTCLSEVSECETTNSVSDKKLA 480

Query: 445 PIDYAARRLKFLLRWTKRKERKATSSELGDGDTLATSSISTNWGNSPISLRQKYQKSVSL 504
            ++  ARRLK LL+W ++KER++ S+EL D  ++ + ++S +  + PI LRQ++ K  SL
Sbjct: 481 SVNNTARRLKSLLQWRRKKERRSASNELADDKSVDSINLSRSLEDHPIPLRQRFSKMPSL 540

Query: 505 PNNKRILSLRSDFPSPDTKNKFTAGLMHGVIQPLPHLASPTQSLPSPLSGSSISSPTSME 564
            ++  + + RS  PSP T+ KFTAGL HGVIQ  PHLA P +S  SPLS SS++SP S+E
Sbjct: 541 SSDNGLFAFRSGLPSPLTRKKFTAGLTHGVIQATPHLAVPGESPSSPLSISSMASPASVE 600

Query: 565 KQNGVDISEPSCINGTPQMNRKQTSFDKKLMNQYLCFGAQGLAGEDSINNLKPGRRFKHV 624
           K+ G+DI+  S  N +  +  KQTSF+K+LMNQY CFGAQGL  E+SI+     + +KH 
Sbjct: 601 KKRGIDIAGSSSSNQS--LKHKQTSFNKRLMNQYFCFGAQGLVVENSISYRHQDQSYKHA 658

Query: 625 GSLV 628
            S+V
Sbjct: 659 ASMV 662

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224102337|ref|XP_002312643.1| predicted protein [Populus trichocarpa] gi|222852463|gb|EEE90010.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225425880|ref|XP_002270297.1| PREDICTED: uncharacterized protein LOC100242500 [Vitis vinifera] gi|269980442|gb|ACZ56416.1| ankyrin-like protein [Vitis vinifera] Back     alignment and taxonomy information
>gi|147815182|emb|CAN63350.1| hypothetical protein VITISV_024449 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224110768|ref|XP_002315630.1| predicted protein [Populus trichocarpa] gi|222864670|gb|EEF01801.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356512349|ref|XP_003524882.1| PREDICTED: uncharacterized protein LOC100791999 [Glycine max] Back     alignment and taxonomy information
>gi|356567316|ref|XP_003551867.1| PREDICTED: uncharacterized protein LOC100782564 [Glycine max] Back     alignment and taxonomy information
>gi|356525130|ref|XP_003531180.1| PREDICTED: uncharacterized protein LOC100811195 [Glycine max] Back     alignment and taxonomy information
>gi|356538107|ref|XP_003537546.1| PREDICTED: ankyrin-1-like [Glycine max] Back     alignment and taxonomy information
>gi|359488622|ref|XP_003633791.1| PREDICTED: uncharacterized protein LOC100257639 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query629
TAIR|locus:2082344664 AT3G01750 [Arabidopsis thalian 0.465 0.441 0.589 9.3e-91
TAIR|locus:2103060656 AT3G04140 [Arabidopsis thalian 0.825 0.791 0.398 3.9e-83
TAIR|locus:2045233662 AT2G31820 [Arabidopsis thalian 0.217 0.206 0.335 7.7e-10
TAIR|locus:2132711445 AT4G10720 "AT4G10720" [Arabido 0.254 0.359 0.263 5.8e-09
TAIR|locus:2176252442 AT5G51160 "AT5G51160" [Arabido 0.255 0.364 0.276 4.6e-08
TAIR|locus:2026489543 AT1G07710 "AT1G07710" [Arabido 0.357 0.414 0.255 1.4e-07
TAIR|locus:2172089426 ANK "ankyrin" [Arabidopsis tha 0.263 0.389 0.255 1.9e-07
CGD|CAL0003397249 orf19.5961 [Candida albicans ( 0.303 0.767 0.263 2e-07
UNIPROTKB|Q5ANE2249 NAS6 "Potential proteasome-int 0.303 0.767 0.263 2e-07
UNIPROTKB|Q8N8A2 993 ANKRD44 "Serine/threonine-prot 0.254 0.161 0.289 3.3e-07
TAIR|locus:2082344 AT3G01750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 905 (323.6 bits), Expect = 9.3e-91, P = 9.3e-91
 Identities = 188/319 (58%), Positives = 235/319 (73%)

Query:     1 MPPSYFPLRWESTGDQWWYASPIDFAAANGHYELVKELLHLDTNLLIKLTSLRRIRRLET 60
             MPP+YFPLRWESTGDQWWYA+PID+AAAN  Y+LV+ELL +D+N LIKLTSLRRIRRLET
Sbjct:     1 MPPTYFPLRWESTGDQWWYATPIDYAAANSQYDLVRELLRIDSNNLIKLTSLRRIRRLET 60

Query:    61 VWDDEEQFDDVAKCRSSVARKLLHDCET--KKG--HNSLIRAGYGGWLLYTAASAGDVRF 116
             VWDD+ QF DVA CRS VARKLL  C+     G   N+LIR+GYGGWL+YTAASAGD+ F
Sbjct:    61 VWDDDSQFHDVAACRSRVARKLLAACDEGGSPGSKRNTLIRSGYGGWLIYTAASAGDLAF 120

Query:   117 VKELLQRDPLLVFGEGEYGVTDILYAAARSKNSEVFRLLLDNAVAPRCCLSSGGEFEEKL 176
             V +LL+R+PLLVFGEGEYGVTDILYAAARSKN +VFRL+ D AV PR    +GG  E++ 
Sbjct:   121 VHDLLERNPLLVFGEGEYGVTDILYAAARSKNDDVFRLIYDFAVTPR--FGTGG-IEQQT 177

Query:   177 SDSYSVFKWEMMNRAVHAVARGGNLDILRQLLGDC--ENVLAYRDVQGSTILHSASGRGQ 234
              +  + +KWEM NRAVH+ +RGGNL +L++LL DC  E+VLA+RD QGSTILHSA+G+G+
Sbjct:   178 GEIPAAYKWEMKNRAVHSASRGGNLILLKELLSDCSVEHVLAFRDKQGSTILHSAAGKGK 237

Query:   235 VEV---LIAKSPSLISVTNSHGDTFLHMVVAGFRSPGFRRVDHQIQLMEQLVSGKIVEVK 291
              +V   L+A S  L+   ++ G+T LH  VA +R        H   L++ L+S       
Sbjct:   238 TQVVKELVASSYHLVDAVDNQGNTALH--VAAYRG-------HA-DLVDVLISAS----P 283

Query:   292 DIINVTNNNGRTALHLAVS 310
              +I+  NN G T LH  +S
Sbjct:   284 SLISARNNAGDTFLHAGIS 302
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2103060 AT3G04140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045233 AT2G31820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132711 AT4G10720 "AT4G10720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176252 AT5G51160 "AT5G51160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026489 AT1G07710 "AT1G07710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172089 ANK "ankyrin" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0003397 orf19.5961 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ANE2 NAS6 "Potential proteasome-interacting protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N8A2 ANKRD44 "Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query629
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-13
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-12
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-10
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-09
PHA02741169 PHA02741, PHA02741, hypothetical protein; Provisio 2e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-07
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 6e-05
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-04
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-04
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.002
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score = 67.4 bits (165), Expect = 1e-13
 Identities = 34/128 (26%), Positives = 63/128 (49%), Gaps = 19/128 (14%)

Query: 217 YRDVQGSTILHSASGRGQVEV--LIAKSPSLISVTNSHGDTFLHMVVAGFRSPGFRRVDH 274
            RD  G T LH A+  G +EV  L+ ++ + ++  ++ G T LH+           +  H
Sbjct: 2   ARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAA---------KNGH 52

Query: 275 QIQLMEQLVSGKIVEVKDIINVTNNNGRTALHLAVSENIQCNLVELLMTVPSINLNIQDG 334
            +++++ L+          +N  + +G T LHLA       ++V+LL+     ++N +D 
Sbjct: 53  -LEIVKLLLEKGA-----DVNARDKDGNTPLHLAARNG-NLDVVKLLLKH-GADVNARDK 104

Query: 335 EGMTPLDL 342
           +G TPL L
Sbjct: 105 DGRTPLHL 112

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|165108 PHA02741, PHA02741, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 629
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.96
PHA02795437 ankyrin-like protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02795437 ankyrin-like protein; Provisional 99.95
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.95
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.92
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.92
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.92
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.92
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.92
PLN03192823 Voltage-dependent potassium channel; Provisional 99.91
PLN03192823 Voltage-dependent potassium channel; Provisional 99.9
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.9
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.89
PHA02743166 Viral ankyrin protein; Provisional 99.88
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.88
KOG0514452 consensus Ankyrin repeat protein [General function 99.86
KOG0514452 consensus Ankyrin repeat protein [General function 99.85
PHA02743166 Viral ankyrin protein; Provisional 99.85
PHA02741169 hypothetical protein; Provisional 99.84
PHA02884300 ankyrin repeat protein; Provisional 99.82
PHA02736154 Viral ankyrin protein; Provisional 99.82
PHA02736154 Viral ankyrin protein; Provisional 99.81
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.81
PHA02741169 hypothetical protein; Provisional 99.81
PHA02884300 ankyrin repeat protein; Provisional 99.8
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.76
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.74
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.7
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.7
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.67
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.67
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.66
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.65
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.57
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.51
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.49
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.48
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.44
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.37
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.34
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.34
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.33
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.29
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.28
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.27
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.24
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.18
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.15
PF1360630 Ank_3: Ankyrin repeat 98.77
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.69
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.6
PF1360630 Ank_3: Ankyrin repeat 98.55
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.51
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.5
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.5
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.49
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.48
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.48
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.46
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.38
KOG0522 560 consensus Ankyrin repeat protein [General function 98.35
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.34
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.27
KOG0522 560 consensus Ankyrin repeat protein [General function 98.23
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.17
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.06
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.04
KOG2384223 consensus Major histocompatibility complex protein 97.93
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.85
KOG2384223 consensus Major histocompatibility complex protein 97.75
KOG0511 516 consensus Ankyrin repeat protein [General function 97.75
KOG0520975 consensus Uncharacterized conserved protein, conta 97.68
KOG0520975 consensus Uncharacterized conserved protein, conta 97.62
KOG0511516 consensus Ankyrin repeat protein [General function 97.61
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.81
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.15
KOG2505591 consensus Ankyrin repeat protein [General function 95.8
KOG2505591 consensus Ankyrin repeat protein [General function 95.65
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.43
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 93.8
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 93.64
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 91.77
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 88.74
PLN032181060 maturation of RBCL 1; Provisional 88.45
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 86.6
PLN032181060 maturation of RBCL 1; Provisional 86.36
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 83.3
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 81.54
PLN03077857 Protein ECB2; Provisional 81.18
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.6e-51  Score=468.77  Aligned_cols=363  Identities=17%  Similarity=0.146  Sum_probs=265.5

Q ss_pred             CCCCcHHHHHHHCCCHHHHHHHHHhCCCchhhhhhhHhhhhccccCCCCcHHH---------------------------
Q 048228           17 WWYASPIDFAAANGHYELVKELLHLDTNLLIKLTSLRRIRRLETVWDDEEQFD---------------------------   69 (629)
Q Consensus        17 ~~g~TpLh~Aa~~G~~~~v~~LL~~gad~~~~~~~~~~~~~~~~~~~~~t~Lh---------------------------   69 (629)
                      .++.||||+||..||.|+|+.||+.+++....           .+..|.||||                           
T Consensus        39 ~~~~t~LH~A~~~g~~e~V~~ll~~~~~~~~~-----------~~~~~~tpLh~a~~~~~~~~~~~~l~~~~~~~~~~~~  107 (682)
T PHA02876         39 SIPFTAIHQALQLRQIDIVEEIIQQNPELIYI-----------TDHKCHSTLHTICIIPNVMDIVISLTLDCDIILDIKY  107 (682)
T ss_pred             cccchHHHHHHHHHhhhHHHHHHHhCcccchh-----------hchhhccccccccCCCCccccccccccchhhcccccH
Confidence            35779999999999999999999998874321           1223444444                           


Q ss_pred             -------------------------------------------HHHhcCcHHHHHHHhhcccccCCCcccccCCCChHHH
Q 048228           70 -------------------------------------------DVAKCRSSVARKLLHDCETKKGHNSLIRAGYGGWLLY  106 (629)
Q Consensus        70 -------------------------------------------~A~~~~~~~i~~lL~~~~~~~g~~~~~~d~~g~tpLh  106 (629)
                                                                 .|+..++.+++++|++    .|++++.+|.+|.||||
T Consensus       108 ~~~~~~~~~~~~~~~~il~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~~i~k~Ll~----~Gadvn~~d~~G~TpLh  183 (682)
T PHA02876        108 ASIILNKHKLDEACIHILKEAISGNDIHYDKINESIEYMKLIKERIQQDELLIAEMLLE----GGADVNAKDIYCITPIH  183 (682)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcCCcccHHhhccchhhhHHHHHHHHCCcHHHHHHHHh----CCCCCCCCCCCCCCHHH
Confidence                                                       4456677888999998    99999999999999999


Q ss_pred             HHHHcCCHHHHHHHHhcCCCccccCCCCCCCHHHHHHHHcCCHHHHHHHHHcCCCCccccCCCCchhhhhccchhHHhhh
Q 048228          107 TAASAGDVRFVKELLQRDPLLVFGEGEYGVTDILYAAARSKNSEVFRLLLDNAVAPRCCLSSGGEFEEKLSDSYSVFKWE  186 (629)
Q Consensus       107 ~A~~~g~~~~v~~LL~~g~~~~~~~d~~g~tpL~~AA~~~g~~~iv~~Ll~~Ga~~~~~~~~~~~~~~~~~~~~~~~~d~  186 (629)
                      +||..|+.++|++|+++|++ ++..+..|.||||+| +..++.+++++|++++.+++..                     
T Consensus       184 ~Aa~~G~~~iv~~LL~~Gad-~n~~~~~g~t~L~~A-~~~~~~~ivk~Ll~~~~~~~~~---------------------  240 (682)
T PHA02876        184 YAAERGNAKMVNLLLSYGAD-VNIIALDDLSVLECA-VDSKNIDTIKAIIDNRSNINKN---------------------  240 (682)
T ss_pred             HHHHCCCHHHHHHHHHCCCC-cCccCCCCCCHHHHH-HHcCCHHHHHHHHhcCCCCCCC---------------------
Confidence            99999999999999999998 577889999999998 7889999999999988766532                     


Q ss_pred             ccchHHHHHHhcCCHHHHHHHHhCCCCcccccCCCCCcHHHHHHhcCCcc-e--ecccCCCCccccCCCCCchHHHHHhc
Q 048228          187 MMNRAVHAVARGGNLDILRQLLGDCENVLAYRDVQGSTILHSASGRGQVE-V--LIAKSPSLISVTNSHGDTFLHMVVAG  263 (629)
Q Consensus       187 ~g~t~Lh~A~~~g~~~iv~~Ll~~gad~~~~~d~~g~TpLh~A~~~g~~~-i--lL~~~gadin~~d~~g~TpLh~A~~~  263 (629)
                        .++|+.|+..++.+++++|++.|++++. .+..|.||||+|+..++.. +  +|.+.|++++..|..|.||||+|+..
T Consensus       241 --~~~L~~ai~~~~~~~~~~Ll~~g~~vn~-~d~~g~TpLh~Aa~~~~~~~iv~lLl~~gadin~~d~~g~TpLh~Aa~~  317 (682)
T PHA02876        241 --DLSLLKAIRNEDLETSLLLYDAGFSVNS-IDDCKNTPLHHASQAPSLSRLVPKLLERGADVNAKNIKGETPLYLMAKN  317 (682)
T ss_pred             --cHHHHHHHHcCCHHHHHHHHHCCCCCCC-CCCCCCCHHHHHHhCCCHHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHh
Confidence              2566777777777777777777777664 6666777777777766643 2  55666677777777777777777763


Q ss_pred             CCCCCcccccc-HHHHHHHHHcCCCCcchhhhccCCcCCchHHHHHHHcCCcHHHHHHHhcCCCCCcccCCCCCCcHHHH
Q 048228          264 FRSPGFRRVDH-QIQLMEQLVSGKIVEVKDIINVTNNNGRTALHLAVSENIQCNLVELLMTVPSINLNIQDGEGMTPLDL  342 (629)
Q Consensus       264 ~~~~~~~~~~~-~~eivk~Ll~~g~~d~~a~in~~d~~g~TpLh~A~~~~~~~~iv~~Ll~~~gadvn~~d~~G~TpLh~  342 (629)
                                + ..+++++|+..|     ++++..|..|.||||+|+..+.+.+++++|++ .|+++|.+|..|+||||+
T Consensus       318 ----------g~~~~~v~~Ll~~g-----adin~~d~~g~TpLh~A~~~~~~~~iv~lLl~-~gadin~~d~~G~TpLh~  381 (682)
T PHA02876        318 ----------GYDTENIRTLIMLG-----ADVNAADRLYITPLHQASTLDRNKDIVITLLE-LGANVNARDYCDKTPIHY  381 (682)
T ss_pred             ----------CCCHHHHHHHHHcC-----CCCCCcccCCCcHHHHHHHhCCcHHHHHHHHH-cCCCCccCCCCCCCHHHH
Confidence                      4 466777777766     55677777777777777665436667777776 677777777777777777


Q ss_pred             HHhCCCCchHHHHHHHHHHcCCCCCCCCCCCccHHHHHHHhCCCCCCCCCCCChhhHHHHHHcCCCCccccccCCChhhh
Q 048228          343 LKQHPRSASSEILIKQLISAGGISNCQDNVARNAIACHLKGQGIGVSPGSSFRVPDAEIFLYTGIENASDAICDAASVEY  422 (629)
Q Consensus       343 A~~~~~~~~~~~lv~~Ll~~Gadvn~~d~~G~TpL~~A~~~~~~~~~~~~~~~~~~v~~LL~~Gad~~~~d~~g~t~~~~  422 (629)
                      |+..++.+    ++++|+++|++++..+..|.||||+|+....         ...++++|+++|++++..|..|+||+++
T Consensus       382 Aa~~~~~~----iv~~Ll~~gad~~~~~~~g~T~Lh~A~~~~~---------~~~~vk~Ll~~gadin~~d~~G~TpLh~  448 (682)
T PHA02876        382 AAVRNNVV----IINTLLDYGADIEALSQKIGTALHFALCGTN---------PYMSVKTLIDRGANVNSKNKDLSTPLHY  448 (682)
T ss_pred             HHHcCCHH----HHHHHHHCCCCccccCCCCCchHHHHHHcCC---------HHHHHHHHHhCCCCCCcCCCCCChHHHH
Confidence            77777665    6777777777777777777777777765432         2456677777777777777777777766


Q ss_pred             hh----------hhccCCCCCCCCCCCCCCCCcHHHHHH
Q 048228          423 SS----------CLSEQSDFDSSNTPDDKKSSPIDYAAR  451 (629)
Q Consensus       423 a~----------~~~e~g~~~d~n~~~~~~~~~~~~aa~  451 (629)
                      |.          .|++.|+  ++|..|..|.+|++.|+.
T Consensus       449 Aa~~~~~~~iv~lLl~~Ga--d~n~~d~~g~tpl~~a~~  485 (682)
T PHA02876        449 ACKKNCKLDVIEMLLDNGA--DVNAINIQNQYPLLIALE  485 (682)
T ss_pred             HHHhCCcHHHHHHHHHCCC--CCCCCCCCCCCHHHHHHH
Confidence            62          2455666  677777777777776664

>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query629
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 6e-08
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 3e-07
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-06
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-06
2xeh_A157 Structural Determinants For Improved Thermal Stabil 6e-06
2xee_A157 Structural Determinants For Improved Thermal Stabil 7e-06
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-05
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-05
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-04
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 3e-04
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-04
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 5e-04
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 6e-04
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure 
Iteration: 1

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 88/176 (50%), Gaps = 23/176 (13%)
Query: 186 EMMNRAVHAVARGGNLDILRQLLGDCENVLAYRDVQGSTILHSASGRGQVEV---LIAKS 242
           E+  R + A A  GN D ++ L+ +  +V A  D  G T LH A+  G  EV   LI+K 
Sbjct: 3   ELGKRLIEA-AENGNKDRVKDLIENGADVNAS-DSDGRTPLHHAAENGHKEVVKLLISKG 60
Query: 243 PSLISVTNSHGDTFLHMVVAGFRSPGFRRVDHQIQLMEQLVSGKIVEVKDIINVTNNNGR 302
              ++  +S G T LH         G + V   ++L+  +  G  V  KD      ++GR
Sbjct: 61  AD-VNAKDSDGRTPLHHAA----ENGHKEV---VKLL--ISKGADVNAKD------SDGR 104
Query: 303 TALHLAVSENIQCNLVELLMTVPSINLNIQDGEGMTPLDLLKQHPRSASSEILIKQ 358
           T LH A +EN    +V+LL++    ++N  D +G TPLDL ++H      ++L KQ
Sbjct: 105 TPLHHA-AENGHKEVVKLLIS-KGADVNTSDSDGRTPLDLAREHGNEEVVKLLEKQ 158
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query629
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-19
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-10
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-19
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-10
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-10
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-19
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-18
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-15
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-15
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-17
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-17
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-13
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-09
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-17
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-15
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-16
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-07
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-06
2etb_A256 Transient receptor potential cation channel subfam 2e-15
2etb_A256 Transient receptor potential cation channel subfam 2e-08
2pnn_A273 Transient receptor potential cation channel subfa 5e-15
2pnn_A273 Transient receptor potential cation channel subfa 1e-09
2pnn_A273 Transient receptor potential cation channel subfa 1e-09
2pnn_A273 Transient receptor potential cation channel subfa 2e-04
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-15
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-09
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-08
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-14
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-07
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-13
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-05
2rfa_A232 Transient receptor potential cation channel subfa 3e-13
2rfa_A232 Transient receptor potential cation channel subfa 2e-11
2rfa_A232 Transient receptor potential cation channel subfa 4e-07
2rfa_A232 Transient receptor potential cation channel subfa 7e-04
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-07
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-05
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-13
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-13
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-05
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-12
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-06
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-10
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-12
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-10
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-11
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-11
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-07
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-11
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-08
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-09
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-07
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-04
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-10
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-09
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-08
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-09
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-07
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-09
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-06
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 8e-05
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-05
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-08
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-05
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-07
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-05
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-08
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-04
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-07
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-07
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 8e-05
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-04
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
 Score = 87.9 bits (219), Expect = 2e-19
 Identities = 57/295 (19%), Positives = 99/295 (33%), Gaps = 68/295 (23%)

Query: 100 YGGW-LLYTAASAGDVRFVKELLQRDPLLVFG-----EGEYGVTDILYAAARSKNSEVFR 153
            GGW  L+ A        V+ LL+       G       + G T     AA + + ++ +
Sbjct: 37  EGGWTPLHNAVQMSREDIVELLLRH------GADPVLRKKNGAT-PFLLAAIAGSVKLLK 89

Query: 154 LLLDNAVAPRCCLSSGGEFEEKLSDSYSVFKWEMMNRAVHAVARGGNLDILRQLL----- 208
           L L            G +  E     ++         A    A  G +  L+ L      
Sbjct: 90  LFLSK----------GADVNECDFYGFT---------AFMEAAVYGKVKALKFLYKRGAN 130

Query: 209 ----GDCENVLAYRDVQGSTILHSASGRGQ---VEVLIAKSPSLISVTNSHGDTFLHMVV 261
                  +         G+T L  A+ +G    +++L+ +  + ++  ++ G   L   +
Sbjct: 131 VNLRRKTKEDQERLRKGGATALMDAAEKGHVEVLKILLDEMGADVNACDNMGRNALIHAL 190

Query: 262 AGFRSPGFRRVDHQIQLMEQLVSGKIVEVKDIINVTNNNGRTALHLAVSENIQCNLVELL 321
                           +   L+        D+ NV    G+T L LAV +     LV+ L
Sbjct: 191 L------SSDDSDVEAITHLLLDHGA----DV-NVRGERGKTPLILAVEKK-HLGLVQRL 238

Query: 322 MTVPSINLNIQDGEGMTPLDLLKQHPRSASS----EILIKQLISAGGISNCQDNV 372
           +    I +N  D +G T L L       A      +I  + L   G  ++C D V
Sbjct: 239 LEQEHIEINDTDSDGKTALLL-------AVELKLKKI-AELLCKRGASTDCGDLV 285
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query629
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2etb_A256 Transient receptor potential cation channel subfam 99.98
3hra_A201 Ankyrin repeat family protein; structural protein; 99.98
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.9
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.9
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.89
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.87
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.86
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.86
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.86
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.86
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.85
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.85
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.85
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.84
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.84
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.83
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.83
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.82
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.81
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.81
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.81
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.81
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.8
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.69
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.66
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=8.4e-60  Score=510.77  Aligned_cols=366  Identities=21%  Similarity=0.234  Sum_probs=342.4

Q ss_pred             CCCCCcHHHHHHHCCCHHHHHHHHHhCCCchhhhhhhHhhhhccccCCCCcHHHHHHhcCcHHHHHHHhhcccccCCCcc
Q 048228           16 QWWYASPIDFAAANGHYELVKELLHLDTNLLIKLTSLRRIRRLETVWDDEEQFDDVAKCRSSVARKLLHDCETKKGHNSL   95 (629)
Q Consensus        16 ~~~g~TpLh~Aa~~G~~~~v~~LL~~gad~~~~~~~~~~~~~~~~~~~~~t~Lh~A~~~~~~~i~~lL~~~~~~~g~~~~   95 (629)
                      +..|.||||+||..|+.++|++|+++|++++..+            ..+.||||+|+..|+.+++++|++    +|++++
T Consensus        11 ~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~~~~~~------------~~~~t~L~~A~~~g~~~~v~~Ll~----~g~~~~   74 (437)
T 1n11_A           11 GESGLTPLHVASFMGHLPIVKNLLQRGASPNVSN------------VKVETPLHMAARAGHTEVAKYLLQ----NKAKVN   74 (437)
T ss_dssp             ----CCHHHHHHHHTCHHHHHHHHHTTCCSCCSS------------SCCCCHHHHHHHHTCHHHHHHHHH----HTCCSS
T ss_pred             CCCCCCHHHHHHHCCCHHHHHHHHHcCCCCCCCC------------CCCCCHHHHHHHcCCHHHHHHHHh----CCCCCC
Confidence            4467899999999999999999999999998643            679999999999999999999999    899999


Q ss_pred             cccCCCChHHHHHHHcCCHHHHHHHHhcCCCccccCCCCCCCHHHHHHHHcCCHHHHHHHHHcCCCCccccCCCCchhhh
Q 048228           96 IRAGYGGWLLYTAASAGDVRFVKELLQRDPLLVFGEGEYGVTDILYAAARSKNSEVFRLLLDNAVAPRCCLSSGGEFEEK  175 (629)
Q Consensus        96 ~~d~~g~tpLh~A~~~g~~~~v~~LL~~g~~~~~~~d~~g~tpL~~AA~~~g~~~iv~~Ll~~Ga~~~~~~~~~~~~~~~  175 (629)
                      .++..|.||||+|+..|+.++|++|+++|++ ++..+..|.||||+| +..|+.+++++|+++|++++...         
T Consensus        75 ~~~~~g~t~L~~A~~~g~~~~v~~Ll~~ga~-~~~~~~~g~t~L~~A-~~~g~~~~v~~Ll~~~~~~~~~~---------  143 (437)
T 1n11_A           75 AKAKDDQTPLHCAARIGHTNMVKLLLENNAN-PNLATTAGHTPLHIA-AREGHVETVLALLEKEASQACMT---------  143 (437)
T ss_dssp             CCCTTSCCHHHHHHHHTCHHHHHHHHHHTCC-TTCCCTTCCCHHHHH-HHHTCHHHHHHHHHTTCCSCCCC---------
T ss_pred             CCCCCCCCHHHHHHHCCCHHHHHHHHhCCCC-CCCCCCCCCcHHHHH-HHcCCHHHHHHHHhCCCCCcCCC---------
Confidence            9999999999999999999999999999988 578899999999998 77799999999999999877553         


Q ss_pred             hccchhHHhhhccchHHHHHHhcCCHHHHHHHHhCCCCcccccCCCCCcHHHHHHhcCCcce--ecccCCCCccccCCCC
Q 048228          176 LSDSYSVFKWEMMNRAVHAVARGGNLDILRQLLGDCENVLAYRDVQGSTILHSASGRGQVEV--LIAKSPSLISVTNSHG  253 (629)
Q Consensus       176 ~~~~~~~~~d~~g~t~Lh~A~~~g~~~iv~~Ll~~gad~~~~~d~~g~TpLh~A~~~g~~~i--lL~~~gadin~~d~~g  253 (629)
                                ..|.||||+|+..|+.+++++|+++|++++. .+..|.||||+|+..++.++  +|+..|++++..+..|
T Consensus       144 ----------~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~-~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g  212 (437)
T 1n11_A          144 ----------KKGFTPLHVAAKYGKVRVAELLLERDAHPNA-AGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNG  212 (437)
T ss_dssp             ----------TTSCCHHHHHHHTTCHHHHHHHHHTTCCTTC-CCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTC
T ss_pred             ----------CCCCCHHHHHHHcCCHHHHHHHHhCCCCCCC-CCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCcCCCC
Confidence                      3478999999999999999999999999995 99999999999999999999  8888999999999999


Q ss_pred             CchHHHHHhcCCCCCccccccHHHHHHHHHcCCCCcchhhhccCCcCCchHHHHHHHcCCcHHHHHHHhcCCCCCcccCC
Q 048228          254 DTFLHMVVAGFRSPGFRRVDHQIQLMEQLVSGKIVEVKDIINVTNNNGRTALHLAVSENIQCNLVELLMTVPSINLNIQD  333 (629)
Q Consensus       254 ~TpLh~A~~~~~~~~~~~~~~~~eivk~Ll~~g~~d~~a~in~~d~~g~TpLh~A~~~~~~~~iv~~Ll~~~gadvn~~d  333 (629)
                      .||||+|+.          .++.+++++|++.|     ++++..+..|.||||+|+..+ +.+++++|++ .|++++..|
T Consensus       213 ~t~L~~A~~----------~~~~~~~~~Ll~~g-----~~~~~~~~~g~t~L~~A~~~g-~~~~v~~Ll~-~~~~~~~~~  275 (437)
T 1n11_A          213 YTPLHIAAK----------QNQVEVARSLLQYG-----GSANAESVQGVTPLHLAAQEG-HAEMVALLLS-KQANGNLGN  275 (437)
T ss_dssp             CCHHHHHHH----------TTCHHHHHHHHHTT-----CCTTCCCTTCCCHHHHHHHTT-CHHHHHHHHT-TTCCTTCCC
T ss_pred             CCHHHHHHH----------cCCHHHHHHHHHcC-----CCCCCCCCCCCCHHHHHHHCC-CHHHHHHHHh-cCCCCCCCC
Confidence            999999999          59999999999999     669999999999999999999 9999999999 999999999


Q ss_pred             CCCCcHHHHHHhCCCCchHHHHHHHHHHcCCCCCCCCCCCccHHHHHHHhCCCCCCCCCCCChhhHHHHHHcCCCCcccc
Q 048228          334 GEGMTPLDLLKQHPRSASSEILIKQLISAGGISNCQDNVARNAIACHLKGQGIGVSPGSSFRVPDAEIFLYTGIENASDA  413 (629)
Q Consensus       334 ~~G~TpLh~A~~~~~~~~~~~lv~~Ll~~Gadvn~~d~~G~TpL~~A~~~~~~~~~~~~~~~~~~v~~LL~~Gad~~~~d  413 (629)
                      ..|.||||+|+..++.+    ++++|+++|+++|.+|..|+||||+|+..+          +.++|++|+++|+|++..|
T Consensus       276 ~~g~t~L~~A~~~~~~~----~~~~Ll~~g~~~~~~~~~g~t~L~~A~~~g----------~~~~v~~Ll~~gad~n~~~  341 (437)
T 1n11_A          276 KSGLTPLHLVAQEGHVP----VADVLIKHGVMVDATTRMGYTPLHVASHYG----------NIKLVKFLLQHQADVNAKT  341 (437)
T ss_dssp             TTCCCHHHHHHHHTCHH----HHHHHHHHTCCTTCCCSSCCCHHHHHHHSS----------CSHHHHHHHHTTCCTTCCC
T ss_pred             CCCCCHHHHHHHcCCHH----HHHHHHhCCccCCCCCCCCCCHHHHHHHcC----------cHHHHHHHHhcCCCCCCCC
Confidence            99999999999999988    999999999999999999999999999987          6899999999999999999


Q ss_pred             ccCCChhhhh---------hhhccCCCCCCCCCCCCCCCCcHHHHHHH
Q 048228          414 ICDAASVEYS---------SCLSEQSDFDSSNTPDDKKSSPIDYAARR  452 (629)
Q Consensus       414 ~~g~t~~~~a---------~~~~e~g~~~d~n~~~~~~~~~~~~aa~~  452 (629)
                      ..|+||+++|         .+|++.|+  +++..|..|.+|+++|++.
T Consensus       342 ~~g~t~L~~A~~~g~~~iv~~Ll~~ga--~~~~~~~~g~t~l~~A~~~  387 (437)
T 1n11_A          342 KLGYSPLHQAAQQGHTDIVTLLLKNGA--SPNEVSSDGTTPLAIAKRL  387 (437)
T ss_dssp             TTSCCHHHHHHHTTCHHHHHHHHHTTC--CSCCCCSSSCCHHHHHHHT
T ss_pred             CCCCCHHHHHHHCChHHHHHHHHHCcC--CCCCCCCCCCCHHHHHHHc
Confidence            9999999988         56889999  9999999999999999865
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 629
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-20
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-15
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-19
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-11
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-10
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.003
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-10
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-10
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-09
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 9e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.001
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.003
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.004
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.001
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.001
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.002
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.003
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 91.2 bits (225), Expect = 3e-20
 Identities = 78/388 (20%), Positives = 126/388 (32%), Gaps = 62/388 (15%)

Query: 21  SPIDFAAANGHYELVKELLHLDTNLLIK----LTSLRR-------------IRRLETVWD 63
           +P+  AA  GH E+ K LL     +  K     T L               +        
Sbjct: 35  TPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNL 94

Query: 64  DEEQFDDVAKCRSSVARKLLHDCETKKGHNSLIRAGYGGWLLYTAASAGDVRFVKELLQR 123
                       +            +K  +       G   L+ AA  G VR  + LL+R
Sbjct: 95  ATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLER 154

Query: 124 DPLLVFGEGEYGVTDILYAAARSKNSEVFRLLLDNAVAPRCCLSSGGEFEEKLSDSYSVF 183
           D       G+ G+   L+ A    N ++ +LLL    +P     +G              
Sbjct: 155 DA-HPNAAGKNGL-TPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNG-------------- 198

Query: 184 KWEMMNRAVHAVARGGNLDILRQLLGDCENVLAYRDVQGSTILHSASGRGQVEVL--IAK 241
                   +H  A+   +++ R LL    +  A   VQG T LH A+  G  E++  +  
Sbjct: 199 -----YTPLHIAAKQNQVEVARSLLQYGGSANAE-SVQGVTPLHLAAQEGHAEMVALLLS 252

Query: 242 SPSLISVTNSHGDTFLHMVVAGFRSPGFR------------RVDHQIQLMEQLVSGKIVE 289
             +  ++ N  G T LH+V      P                      L      G I  
Sbjct: 253 KQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKL 312

Query: 290 VKD------IINVTNNNGRTALHLAVSENIQCNLVELLMTVPSINLNIQDGEGMTPLDLL 343
           VK        +N     G + LH A  +    ++V LL+     + N    +G TPL + 
Sbjct: 313 VKFLLQHQADVNAKTKLGYSPLHQAAQQG-HTDIVTLLLKN-GASPNEVSSDGTTPLAIA 370

Query: 344 KQHPRSASSEILIKQLISAGGISNCQDN 371
           K+    + +++L K +          D 
Sbjct: 371 KRLGYISVTDVL-KVVTDETSFVLVSDK 397
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query629
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.93
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.93
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.92
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.91
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.91
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.87
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.87
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.87
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.82
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.1e-49  Score=423.71  Aligned_cols=337  Identities=21%  Similarity=0.233  Sum_probs=309.0

Q ss_pred             cHHHHHHHCCCHHHHHHHHHhCCCchhhhhhhHhhhhccccCCCCcHHHHHHhcCcHHHHHHHhhcccccCCCcccccCC
Q 048228           21 SPIDFAAANGHYELVKELLHLDTNLLIKLTSLRRIRRLETVWDDEEQFDDVAKCRSSVARKLLHDCETKKGHNSLIRAGY  100 (629)
Q Consensus        21 TpLh~Aa~~G~~~~v~~LL~~gad~~~~~~~~~~~~~~~~~~~~~t~Lh~A~~~~~~~i~~lL~~~~~~~g~~~~~~d~~  100 (629)
                      ||||+||..|+.++|++||++|++++..+            ..|.||||+|+..|+.+++++|++    +|++++.++..
T Consensus         2 TpL~~Aa~~g~~~~v~~Ll~~g~~in~~d------------~~g~TpL~~A~~~g~~~iv~~Ll~----~gadi~~~~~~   65 (408)
T d1n11a_           2 TPLHVASFMGHLPIVKNLLQRGASPNVSN------------VKVETPLHMAARAGHTEVAKYLLQ----NKAKVNAKAKD   65 (408)
T ss_dssp             CHHHHHHHHTCHHHHHHHHHTTCCSCCSS------------SCCCCHHHHHHHHTCHHHHHHHHH----HTCCSSCCCTT
T ss_pred             ChHHHHHHCcCHHHHHHHHHCCCCCCCCC------------CCCCCHHHHHHHcCCHHHHHHHHH----CcCCCCCCCCC
Confidence            99999999999999999999999998754            779999999999999999999999    99999999999


Q ss_pred             CChHHHHHHHcCCHHHHHHHHhcCCC--------------------------------ccccCCCCCCCHHHHHHHHcCC
Q 048228          101 GGWLLYTAASAGDVRFVKELLQRDPL--------------------------------LVFGEGEYGVTDILYAAARSKN  148 (629)
Q Consensus       101 g~tpLh~A~~~g~~~~v~~LL~~g~~--------------------------------~~~~~d~~g~tpL~~AA~~~g~  148 (629)
                      |.||||+|+..|+.+++++|+...+.                                .....+..+.+++++| +..++
T Consensus        66 g~t~L~~A~~~g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a-~~~~~  144 (408)
T d1n11a_          66 DQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVA-AKYGK  144 (408)
T ss_dssp             SCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHH-HHTTC
T ss_pred             CCCHHHHHHHcCCHHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHH-HHcCC
Confidence            99999999999999999999976542                                1234467888999997 78899


Q ss_pred             HHHHHHHHHcCCCCccccCCCCchhhhhccchhHHhhhccchHHHHHHhcCCHHHHHHHHhCCCCcccccCCCCCcHHHH
Q 048228          149 SEVFRLLLDNAVAPRCCLSSGGEFEEKLSDSYSVFKWEMMNRAVHAVARGGNLDILRQLLGDCENVLAYRDVQGSTILHS  228 (629)
Q Consensus       149 ~~iv~~Ll~~Ga~~~~~~~~~~~~~~~~~~~~~~~~d~~g~t~Lh~A~~~g~~~iv~~Ll~~gad~~~~~d~~g~TpLh~  228 (629)
                      .+++++|+++|++++...                   ..|.+|||+|+..|+.+++++|+++|++++. .+..|.||||+
T Consensus       145 ~~~v~~ll~~~~~~~~~~-------------------~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~-~~~~~~t~l~~  204 (408)
T d1n11a_         145 VRVAELLLERDAHPNAAG-------------------KNGLTPLHVAVHHNNLDIVKLLLPRGGSPHS-PAWNGYTPLHI  204 (408)
T ss_dssp             HHHHHHHHHTTCCTTCCC-------------------SSCCCHHHHHHHTTCHHHHHHHGGGTCCSCC-CCTTCCCHHHH
T ss_pred             HHHHHHHHHcCCCCCcCC-------------------CcCchHHHHHHHcCCHHHHHHHHhcCCcccc-cCCCCCCcchh
Confidence            999999999999887553                   3467999999999999999999999999985 89999999999


Q ss_pred             HHhcCCcce--ecccCCCCccccCCCCCchHHHHHhcCCCCCccccccHHHHHHHHHcCCCCcchhhhccCCcCCchHHH
Q 048228          229 ASGRGQVEV--LIAKSPSLISVTNSHGDTFLHMVVAGFRSPGFRRVDHQIQLMEQLVSGKIVEVKDIINVTNNNGRTALH  306 (629)
Q Consensus       229 A~~~g~~~i--lL~~~gadin~~d~~g~TpLh~A~~~~~~~~~~~~~~~~eivk~Ll~~g~~d~~a~in~~d~~g~TpLh  306 (629)
                      ++.....++  .+...+......+..|.||||+|+.          .+..+++++++..+     ..++..+..|.||||
T Consensus       205 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~~a~~----------~~~~~~~~~~~~~~-----~~~~~~~~~g~~~l~  269 (408)
T d1n11a_         205 AAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQ----------EGHAEMVALLLSKQ-----ANGNLGNKSGLTPLH  269 (408)
T ss_dssp             HHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHHH----------TTCHHHHHHHHTTT-----CCTTCCCTTCCCHHH
T ss_pred             hhccchhhhhhhhhhccccccccCCCCCCHHHHHHH----------hCcHhHhhhhhccc-----cccccccCCCCChhh
Confidence            999998888  5666677777888999999999999          58999999999988     558899999999999


Q ss_pred             HHHHcCCcHHHHHHHhcCCCCCcccCCCCCCcHHHHHHhCCCCchHHHHHHHHHHcCCCCCCCCCCCccHHHHHHHhCCC
Q 048228          307 LAVSENIQCNLVELLMTVPSINLNIQDGEGMTPLDLLKQHPRSASSEILIKQLISAGGISNCQDNVARNAIACHLKGQGI  386 (629)
Q Consensus       307 ~A~~~~~~~~iv~~Ll~~~gadvn~~d~~G~TpLh~A~~~~~~~~~~~lv~~Ll~~Gadvn~~d~~G~TpL~~A~~~~~~  386 (629)
                      .|+..+ +.+++++|++ +|++++..+..+.||||.|+..++.+    ++++|++.|+++|.+|.+|+||||+|++.+  
T Consensus       270 ~a~~~~-~~~i~~~Ll~-~g~~~~~~~~~~~t~L~~~~~~~~~~----~~~~ll~~g~~in~~d~~G~T~Lh~A~~~g--  341 (408)
T d1n11a_         270 LVAQEG-HVPVADVLIK-HGVMVDATTRMGYTPLHVASHYGNIK----LVKFLLQHQADVNAKTKLGYSPLHQAAQQG--  341 (408)
T ss_dssp             HHHHHT-CHHHHHHHHH-HTCCTTCCCSSCCCHHHHHHHSSCSH----HHHHHHHTTCCTTCCCTTSCCHHHHHHHTT--
T ss_pred             hhhhcC-cHHHHHHHHH-CCCccccccccccccchhhcccCcce----eeeeeccccccccccCCCCCCHHHHHHHcC--
Confidence            999999 9999999999 99999999999999999999999988    899999999999999999999999999987  


Q ss_pred             CCCCCCCCChhhHHHHHHcCCCCccccccCCChhhhhhh
Q 048228          387 GVSPGSSFRVPDAEIFLYTGIENASDAICDAASVEYSSC  425 (629)
Q Consensus       387 ~~~~~~~~~~~~v~~LL~~Gad~~~~d~~g~t~~~~a~~  425 (629)
                              +.++|++||++|||++.+|..|+||+++|..
T Consensus       342 --------~~~iv~~Ll~~GAd~n~~d~~G~t~L~~A~~  372 (408)
T d1n11a_         342 --------HTDIVTLLLKNGASPNEVSSDGTTPLAIAKR  372 (408)
T ss_dssp             --------CHHHHHHHHHTTCCSCCCCSSSCCHHHHHHH
T ss_pred             --------CHHHHHHHHHCCCCCCCCCCCCCCHHHHHHH
Confidence                    6999999999999999999999999997744
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure