Citrus Sinensis ID: 048248


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
ESTVDHKLFRALRHGYTDKVREFARLNGNRILGTSQNGDTALHIAARFGHEILVMEILKHQSDLVSVPNHKSETPMHVAARAGNFGAAQIFMRPHGNGNNTGTFDDILRKRDEEGNTPLHNAVRKCDGKMAFTMIKKDPEPIRYNNKAKQGPNNLTLLHSAIIKSQFVVMAKILEAKRDLINVRDERNRNPLRYAAALGHFKIACRLSDEDDSLVYQHDCNGQSPLHLASQNGQLSILENLLHSYPDSIEFIDNKNRNILHLAAQNGHADVVVFILKQPEVEDLINSSDVDGNTPLHLAAINNHFNIILVLARNMS
cccccHHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHccc
ccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHccc
ESTVDHKLFRALRHGYTDKVREFARLNgnrilgtsqngdTALHIAARFGHEILVMEILKHQsdlvsvpnhksetpmHVAARagnfgaaqifmrphgngnntgtfDDILRKrdeegntplhnavrkcDGKMAFTMikkdpepirynnkakqgpnnltLLHSAIIKSQFVVMAKILEAKRDLINvrdernrnPLRYAAALGHFKIAcrlsdeddslvyqhdcngqsplhlasqnGQLSILENLlhsypdsiefidnknRNILHLAAQNGHADVVVFILKqpevedlinssdvdgntplHLAAINNHFNIILVLARNMS
estvdhklfralrhgytdKVREFARLNGNRILGTSQNGDTALHIAARFGHEILVMEILKHQSDLVSVPNHKSETPMHVAARAGNFGAAQIFMRPHGNGNNTGTFDDILRKRdeegntplhnavrkcdgkMAFTMIKKDPEPIRYNNKAKQGPNNLTLLHSAIIKSQFVVMAKILEAKRdlinvrdernrNPLRYAAALGHFKIACRLSDEDDSLVYQHDCNGQSPLHLASQNGQLSILENLLHSYPDSIEFIDNKNRNILHLAAQNGHADVVVFILKQPEVEDLINSSDVDGNTPLHLAAINNHFNIILVLARNMS
ESTVDHKLFRALRHGYTDKVREFARLNGNRILGTSQNGDTALHIAARFGHEILVMEILKHQSDLVSVPNHKSETPMHVAARAGNFGAAQIFMRPHGNGNNTGTFDDILRKRDEEGNTPLHNAVRKCDGKMAFTMIKKDPEPIRYNNKAKQGPNNLTLLHSAIIKSQFVVMAKILEAKRDLINVRDERNRNPLRYAAALGHFKIACRLSDEDDSLVYQHDCNGQSPLHLASQNGQLSILENLLHSYPDSIEFIDNKNRNILHLAAQNGHADVVVFILKQPEVEDLINSSDVDGNTPLHLAAINNHFNIILVLARNMS
******KLFRALRHGYTDKVREFARLNGNRILGTSQNGDTALHIAARFGHEILVMEILKHQSDLVS***********VAARAGNFGAAQIFMR*****************************VRKCDGKMAFTMI*****************NNLTLLHSAIIKSQFVVMAKILEAKRDLINVRDERNRNPLRYAAALGHFKIACRLSDEDDSLVYQHDCNGQSPLHLASQNGQLSILENLLHSYPDSIEFIDNKNRNILHLAAQNGHADVVVFILKQPEVEDLINSSDVDGNTPLHLAAINNHFNIILVLA****
ESTVDHKLFRALRHGYTDKVREFARLNGNRILGTSQNGDTALHIAARFGHEILVMEILKHQSDLVSVPNHKSETPMHVAARAGNFGAAQIFMRPHGNGNNTGTFDDILRKRDEEGNTPLHNAVRKCDGKMAFTMIKKDPEPIRYNNKAKQGPNNLTLLHSAIIKSQFVVMAKILEAKRDLINVRDERNRNPLRYAAALGHFKIACRLSDEDDSLVYQHDCNGQSPLHLASQNGQLSILENLLHSYPDSIEFIDNKNRNILHLAAQNGHADVVVFILKQPEVEDLINSSDVDGNTPLHLAAINNHFNIILVLARNM*
ESTVDHKLFRALRHGYTDKVREFARLNGNRILGTSQNGDTALHIAARFGHEILVMEILKHQSDLVSVPNHKSETPMHVAARAGNFGAAQIFMRPHGNGNNTGTFDDILRKRDEEGNTPLHNAVRKCDGKMAFTMIKKDPEPIRYNNKAKQGPNNLTLLHSAIIKSQFVVMAKILEAKRDLINVRDERNRNPLRYAAALGHFKIACRLSDEDDSLVYQHDCNGQSPLHLASQNGQLSILENLLHSYPDSIEFIDNKNRNILHLAAQNGHADVVVFILKQPEVEDLINSSDVDGNTPLHLAAINNHFNIILVLARNMS
****DHKLFRALRHGYTDKVREFARLNGNRILGTSQNGDTALHIAARFGHEILVMEILKHQSDLVSVPNHKSETPMHVAARAGNFGAAQIFMRPHGNGNNTGTFDDILRKRDEEGNTPLHNAVRKCDGKMAFTMIKKDPEPIRYNNKAKQGPNNLTLLHSAIIKSQFVVMAKILEAKRDLINVRDERNRNPLRYAAALGHFKIACRLSDEDDSLVYQHDCNGQSPLHLASQNGQLSILENLLHSYPDSIEFIDNKNRNILHLAAQNGHADVVVFILKQPEVEDLINSSDVDGNTPLHLAAINNHFNIILVLARNM*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ESTVDHKLFRALRHGYTDKVREFARLNGNRILGTSQNGDTALHIAARFGHEILVMEILKHQSDLVSVPNHKSETPMHVAARAGNFGAAQIFMRPHGNGNNTGTFDDILRKRDEEGNTPLHNAVRKCDGKMAFTMIKKDPEPIRYNNKAKQGPNNLTLLHSAIIKSQFVVMAKILEAKRDLINVRDERNRNPLRYAAALGHFKIACRLSDEDDSLVYQHDCNGQSPLHLASQNGQLSILENLLHSYPDSIEFIDNKNRNILHLAAQNGHADVVVFILKQPEVEDLINSSDVDGNTPLHLAAINNHFNIILVLARNMS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query316 2.2.26 [Sep-21-2011]
G0LXV8 1351 Alpha-latrotoxin-Lh1a (Fr N/A no 0.889 0.207 0.280 1e-19
O15084 1053 Serine/threonine-protein no no 0.879 0.264 0.276 3e-19
P23631 1401 Alpha-latrotoxin-Lt1a OS= N/A no 0.892 0.201 0.281 3e-18
Q505D1 1053 Serine/threonine-protein yes no 0.879 0.264 0.269 4e-18
Q8N8A2 993 Serine/threonine-protein no no 0.870 0.276 0.255 2e-17
Q5ZLC81073 Serine/threonine-protein no no 0.911 0.268 0.275 2e-17
Q5F478 990 Serine/threonine-protein no no 0.860 0.274 0.247 3e-17
Q8NB461076 Serine/threonine-protein no no 0.911 0.267 0.265 5e-16
Q01484 3957 Ankyrin-2 OS=Homo sapiens no no 0.816 0.065 0.266 9e-16
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no no 0.816 0.066 0.266 1e-15
>sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 Back     alignment and function desciption
 Score = 97.4 bits (241), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 101/360 (28%), Positives = 160/360 (44%), Gaps = 79/360 (21%)

Query: 21  REFARLN--GNRILGTSQNGDTALHIAARFGHE-ILVMEILKHQSDLVSVPNHKSETPMH 77
           +EF +LN  G  I  T + G T  H AA+ G+  I++      +S+ ++ P+ K  TP+H
Sbjct: 460 KEFTKLNYDGANIRATFEQGRTVFHAAAKSGNSRIMIGLTFLVKSNELNQPDKKGYTPIH 519

Query: 78  VAARAGNFGAAQIFMRPHGNGNNTGTFDDI--------------------------LRKR 111
           VAA +GN G   + ++  G   N+ T++ +                          + +R
Sbjct: 520 VAADSGNAGIVNLLIQ-RGVSINSKTYNFLQTPLHLAAQRGFVTTFQRLMESPEININER 578

Query: 112 DEEGNTPLHNAVRKCDGKM-AFTMIKKDPEPIRYNNKAKQGPNNLTLLHSAIIKSQFVVM 170
           D++G TPLH AVR  +  + AF     +   I  N K+ +G   LT  H AIIK  + V 
Sbjct: 579 DKDGFTPLHYAVRGGERILEAFI----NQIRIDLNAKSNKG---LTPFHLAIIKDDWPVA 631

Query: 171 AKILEAKRDLINVRDERNRNPLRYAAALGHFKIACRLSDEDD-----------------S 213
           + +L +K+  +N  DE N   L YAA LG+ +   +L +  +                 +
Sbjct: 632 STLLGSKKVDVNAVDENNMTALHYAAILGYLETTKQLINLKEINADVVSSPGLLSALHYA 691

Query: 214 LVYQHD------------------CNGQSPLHLASQNGQLSILENLLHSYPDSIEFIDNK 255
           ++Y+HD                    G +PLHLA   G+  IL +L+     +IE   ++
Sbjct: 692 ILYKHDDVASFLLRSSNVNVNLKALGGITPLHLAVIQGRTQIL-SLMFDIGVNIEQQTDE 750

Query: 256 NRNILHLAAQNGHADVVVFILKQ-PEVEDLINSSDVDGNTPLHLAAINNHFNIILVLARN 314
               LHLAA + + +++  +L Q    E   NS    G TPLHLA         L+L  N
Sbjct: 751 KYTPLHLAAMSKYPELIQILLDQGSNFEAKTNS----GATPLHLATFKGKSKAALILLNN 806




Presynaptic neurotoxin that induces exhaustive neurotransmitter release from vertebrate (but not invertebrate) nerve terminals and endocrine cells. Binds to neurexin-1-alpha (NRXN1), latrophilin-1 (LPHN1), and receptor-type tyrosine-protein phosphatase S (PTPRS), and induces neurotransmitter exocytosis through two calcium-dependent mechanisms (membrane pore formation and signaling via latrophilin) and a yet to be defined calcium-independent mechanism (By similarity). Induces rapid muscle contracture and loss of twitch tension when added to the isolated and indirectly stimulated chick biventer cervicis nerve-muscle preparation.
Latrodectus hasseltii (taxid: 256736)
>sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 Back     alignment and function description
>sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 Back     alignment and function description
>sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 Back     alignment and function description
>sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 Back     alignment and function description
>sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 Back     alignment and function description
>sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 Back     alignment and function description
>sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
224117424381 predicted protein [Populus trichocarpa] 0.971 0.805 0.329 1e-41
224109440 577 predicted protein [Populus trichocarpa] 0.971 0.532 0.329 8e-41
224117420 577 predicted protein [Populus trichocarpa] 0.971 0.532 0.326 1e-40
224117416 451 predicted protein [Populus trichocarpa] 0.971 0.680 0.320 4e-40
225446910 777 PREDICTED: ankyrin repeat-containing pro 0.882 0.359 0.333 3e-35
297739103 647 unnamed protein product [Vitis vinifera] 0.863 0.421 0.336 4e-35
296087902 472 unnamed protein product [Vitis vinifera] 0.718 0.480 0.327 6e-35
359485365 781 PREDICTED: ankyrin repeat-containing pro 0.882 0.357 0.331 1e-34
302143222 617 unnamed protein product [Vitis vinifera] 0.927 0.474 0.321 3e-34
147820412 624 hypothetical protein VITISV_004974 [Viti 0.927 0.469 0.321 5e-34
>gi|224117424|ref|XP_002317571.1| predicted protein [Populus trichocarpa] gi|222860636|gb|EEE98183.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  176 bits (447), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 113/343 (32%), Positives = 172/343 (50%), Gaps = 36/343 (10%)

Query: 4   VDHKLFRALRHGYTDKVREFARLNGNRILGTSQNGDTALHIAARFGHEILVMEILKHQSD 63
           +D +L+R  + G    + +    N   +   +  G+T LHIA +FGH+ +V+EI      
Sbjct: 1   MDSRLYRVAKSGNVYILLQLLNENPRLLTKLTPQGNTPLHIAVQFGHKGVVVEIYNRCRS 60

Query: 64  LVSVPNHKSETPMHVAARAGNFGAAQIFM-------RPHGNGNNTGTFDDILRKRDEEGN 116
           L++ PN   ++P+HVAAR G+F      +       R       TG FD ILR+ ++E N
Sbjct: 61  LLTRPNSSGDSPLHVAARCGHFSIVDFLVKEILSAKRISTENGKTGKFD-ILRQGNKENN 119

Query: 117 TPLHNAVRKCDGKMAFTMIKKDPEPIRYNNKAKQGPNNL--------------------- 155
           T LH AVR  +  +   +++ D +   + N A + P  L                     
Sbjct: 120 TVLHEAVRNGNMSVVKLLLRVDTKLACFENYAGESPLFLAAREGKKDVLNQILISNPASA 179

Query: 156 -------TLLHSAIIKSQFVVMAKILEAKRDLINVRDERNRNPLRYAAALGHFKIACRLS 208
                  T LH+A+I+    +M  +L AK  LI   D   R  L YAA+LG  +   RL 
Sbjct: 180 HGGSEGHTALHAAVIERHSDIMEILLRAKPHLITEADHHGRTALYYAASLGDRRAVERLL 239

Query: 209 DEDDSLVYQHDCNGQSPLHLASQNGQLSILENLLHSYPDSIEFIDNKNRNILHLAAQNGH 268
           + D+   Y  D NG SPLH+A++NG   ++E ++H  PDS E +D   R++LH A  +G 
Sbjct: 240 EFDECTAYVLDKNGHSPLHVAARNGHADVIERIIHYCPDSGELLDLNGRSVLHFAVLSGK 299

Query: 269 ADVVVFILKQPEVEDLINSSDVDGNTPLHLAAINNHFNIILVL 311
            +VV  +++  E++ LIN +D  GNTPLHLAAI     I+  L
Sbjct: 300 VNVVRCVVEIAELQWLINQADNGGNTPLHLAAIERQTRILRCL 342




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224109440|ref|XP_002333254.1| predicted protein [Populus trichocarpa] gi|222835818|gb|EEE74253.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224117420|ref|XP_002317570.1| predicted protein [Populus trichocarpa] gi|222860635|gb|EEE98182.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224117416|ref|XP_002317569.1| predicted protein [Populus trichocarpa] gi|222860634|gb|EEE98181.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225446910|ref|XP_002266647.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297739103|emb|CBI28754.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087902|emb|CBI35185.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485365|ref|XP_003633264.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143222|emb|CBI20517.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147820412|emb|CAN63354.1| hypothetical protein VITISV_004974 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
TAIR|locus:2128781 677 AT4G03460 "AT4G03460" [Arabido 0.974 0.454 0.294 1.1e-27
TAIR|locus:2020833 616 AT1G03670 "AT1G03670" [Arabido 0.863 0.443 0.283 5.3e-24
TAIR|locus:2138391 572 AT4G05040 "AT4G05040" [Arabido 0.971 0.536 0.278 4.1e-23
TAIR|locus:2129685 694 AT4G14390 "AT4G14390" [Arabido 0.981 0.446 0.273 7.9e-22
TAIR|locus:2128791 683 AT4G03470 [Arabidopsis thalian 0.816 0.377 0.263 5.5e-21
UNIPROTKB|O15084 1053 ANKRD28 "Serine/threonine-prot 0.873 0.262 0.280 1.2e-20
TAIR|locus:2128771 641 AT4G03450 "AT4G03450" [Arabido 0.727 0.358 0.283 5.8e-20
TAIR|locus:2012873 578 AT1G10340 "AT1G10340" [Arabido 0.762 0.416 0.315 5.9e-20
MGI|MGI:2145661 1053 Ankrd28 "ankyrin repeat domain 0.876 0.263 0.268 3.6e-19
TAIR|locus:2129690 670 ACD6 "AT4G14400" [Arabidopsis 0.971 0.458 0.274 4.6e-19
TAIR|locus:2128781 AT4G03460 "AT4G03460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 318 (117.0 bits), Expect = 1.1e-27, P = 1.1e-27
 Identities = 94/319 (29%), Positives = 152/319 (47%)

Query:     2 STVDH---KLFRALRHGYTDKVREFARLNGNRILGTSQNGDTALHIAARFGHEILVMEIL 58
             S  DH    L  A   G+TD V          ++ ++  G+ ALH+AA  GH  +V  ++
Sbjct:   126 SVNDHGNTMLHLAAAAGHTDLVCYILNAYPGLLMKSNSMGEVALHVAAGAGHLAVVEALV 185

Query:    59 KHQSDLVSVPNHKSETPMHVAARAGNFGAAQIFM-RPHGNGNN--TGTFDDILRKRDEEG 115
                 D +S         ++ A       A  + + R H    +        +    + +G
Sbjct:   186 SFIKD-ISCNKPGVAKKIYFAKDRHQDNALHVSLKRKHLKVASCLVCAEQSLSFVANNDG 244

Query:   116 NTPLHNAVRKCDGKMAFTMIKKDPEPIRYNNKAKQGPNNLTLLHSAIIKSQFVVMAKILE 175
              +PL+ AV      +A TM +         +         +++H A+   +  ++  IL 
Sbjct:   245 VSPLYLAVEAGQADLAKTMWQHSNNGSSSTSTLASKIGGRSIVHGAMKARRKDILVAILS 304

Query:   176 AKRDLINVRDERNRNPLRYAAALGHFKIACRLSDEDDSLVYQHDCNGQSPLHLASQNGQL 235
                 LIN RDE  R  L + A+LG+++  C L D+    VY  D +G  P+H+A + G +
Sbjct:   305 EDASLINFRDE-GRTCLSFGASLGYYEGFCYLLDKALDSVYVSDDDGSFPIHMAVKYGYV 363

Query:   236 SILENLLHSYPDSIEFIDNKNRNILHLAAQNGHADVVVFIL---KQPEVEDLINSSDVDG 292
              IL+ +L   PD++E +D +N+N+LH+AA+NG  +V+ FIL   K    E LIN  D +G
Sbjct:   364 KILKAILKRCPDALELLDRENQNVLHVAAKNGKIEVLKFILRCCKDKNKEKLINEEDANG 423

Query:   293 NTPLHLAAINNHFNIILVL 311
             NTPLHLA  N H  ++ +L
Sbjct:   424 NTPLHLATKNWHPKVVSML 442


GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2020833 AT1G03670 "AT1G03670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138391 AT4G05040 "AT4G05040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129685 AT4G14390 "AT4G14390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128791 AT4G03470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O15084 ANKRD28 "Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2128771 AT4G03450 "AT4G03450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012873 AT1G10340 "AT1G10340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:2145661 Ankrd28 "ankyrin repeat domain 28" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2129690 ACD6 "AT4G14400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-24
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-18
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-14
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-14
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-13
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-10
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-06
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-05
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 5e-05
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-04
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-04
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-04
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-04
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 9e-04
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.001
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.001
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.002
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.003
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 94.8 bits (236), Expect = 3e-24
 Identities = 54/130 (41%), Positives = 74/130 (56%), Gaps = 5/130 (3%)

Query: 182 NVRDERNRNPLRYAAALGHFKIACRLSDEDDSLVYQHDCNGQSPLHLASQNGQLSILENL 241
           N RDE  R PL  AA+ GH ++   L +     V   D +G++PLHLA++NG L I++ L
Sbjct: 1   NARDEDGRTPLHLAASNGHLEVVKLLLENGAD-VNAKDNDGRTPLHLAAKNGHLEIVKLL 59

Query: 242 LHSYPDSIEFIDNKNRNILHLAAQNGHADVVVFILKQPEVEDLINSSDVDGNTPLHLAAI 301
           L    D +   D      LHLAA+NG+ DVV  +LK       +N+ D DG TPLHLAA 
Sbjct: 60  LEKGAD-VNARDKDGNTPLHLAARNGNLDVVKLLLKHG---ADVNARDKDGRTPLHLAAK 115

Query: 302 NNHFNIILVL 311
           N H  ++ +L
Sbjct: 116 NGHLEVVKLL 125


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 316
PHA02874 434 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02946 446 ankyin-like protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
KOG0508 615 consensus Ankyrin repeat protein [General function 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.98
PHA02792 631 ankyrin-like protein; Provisional 99.97
KOG0508 615 consensus Ankyrin repeat protein [General function 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02792 631 ankyrin-like protein; Provisional 99.95
PHA02795437 ankyrin-like protein; Provisional 99.94
PHA02795 437 ankyrin-like protein; Provisional 99.94
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.94
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.93
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.93
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.93
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.92
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.91
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.91
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.91
KOG0514452 consensus Ankyrin repeat protein [General function 99.91
KOG0514452 consensus Ankyrin repeat protein [General function 99.9
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.9
PHA02741169 hypothetical protein; Provisional 99.9
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.89
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.89
PHA02736154 Viral ankyrin protein; Provisional 99.88
PHA02741169 hypothetical protein; Provisional 99.88
PHA02743166 Viral ankyrin protein; Provisional 99.87
PHA02743166 Viral ankyrin protein; Provisional 99.86
PHA02736154 Viral ankyrin protein; Provisional 99.85
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.85
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.85
PHA02884300 ankyrin repeat protein; Provisional 99.83
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.82
PHA02884 300 ankyrin repeat protein; Provisional 99.8
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.76
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.74
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.72
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.69
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.68
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.67
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.66
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.64
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.62
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.57
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.52
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.51
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.48
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.48
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.48
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.47
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.38
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.37
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.36
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.36
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.34
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.28
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.83
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.74
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.72
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.7
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.7
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.69
PF1360630 Ank_3: Ankyrin repeat 98.64
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.61
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.61
PF1360630 Ank_3: Ankyrin repeat 98.59
KOG0522 560 consensus Ankyrin repeat protein [General function 98.59
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.57
KOG0522 560 consensus Ankyrin repeat protein [General function 98.55
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.53
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.51
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.43
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.32
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.27
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.18
KOG2384223 consensus Major histocompatibility complex protein 98.11
KOG2384223 consensus Major histocompatibility complex protein 98.08
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.03
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.98
KOG0511 516 consensus Ankyrin repeat protein [General function 97.96
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.94
KOG0511 516 consensus Ankyrin repeat protein [General function 97.84
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.7
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.65
KOG2505591 consensus Ankyrin repeat protein [General function 95.53
KOG2505591 consensus Ankyrin repeat protein [General function 94.81
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.36
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 92.14
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 90.93
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 87.34
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 87.19
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 83.43
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.2e-43  Score=317.97  Aligned_cols=296  Identities=23%  Similarity=0.256  Sum_probs=250.5

Q ss_pred             cHHHHHHHhcCChHHHHHHHHhcCCccccccCCCChHHHHHHHhCCHHHHHHHHhcCCCccccCCCCCCcHHHHHHHhCC
Q 048248            5 DHKLFRALRHGYTDKVREFARLNGNRILGTSQNGDTALHIAARFGHEILVMEILKHQSDLVSVPNHKSETPMHVAARAGN   84 (316)
Q Consensus         5 ~~~l~~a~~~g~~~~~~~ll~~~~~~~~~~~~~g~t~Lh~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~tpLh~A~~~g~   84 (316)
                      +..|+.|+..|+.+.++.++...+..++..+..|.||||.|+..|+.++|++|++.|++. +..+..|.||||.|+..|+
T Consensus         2 ~~~l~~ai~~gd~~~v~~ll~~~~~~~n~~~~~~~tpL~~A~~~g~~~iv~~Ll~~Ga~~-n~~~~~~~t~L~~A~~~~~   80 (434)
T PHA02874          2 SQDLRMCIYSGDIEAIEKIIKNKGNCINISVDETTTPLIDAIRSGDAKIVELFIKHGADI-NHINTKIPHPLLTAIKIGA   80 (434)
T ss_pred             cHHHHHHHhcCCHHHHHHHHHcCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHHCCCCC-CCCCCCCCCHHHHHHHcCC
Confidence            457899999999999999998888878888889999999999999999999999999874 4567789999999999999


Q ss_pred             hhHHHHhhccCCCCCCCC------c-------chhhhhccCCCCCcHHHHHHhcCChhHHHHHHhhCCCcccccccccCC
Q 048248           85 FGAAQIFMRPHGNGNNTG------T-------FDDILRKRDEEGNTPLHNAVRKCDGKMAFTMIKKDPEPIRYNNKAKQG  151 (316)
Q Consensus        85 ~~~~~~l~~~~~~~~~~~------~-------~~~~~~~~~~~g~t~L~~a~~~~~~~~~~~ll~~~~~~~~~~~~~~~~  151 (316)
                      .+++++|++.+.......      .       ....+..++..|.||||+|+..++.++++.|+..++++      +..+
T Consensus        81 ~~iv~~Ll~~g~~~~~~~~~~~~~~~i~~ll~~g~d~n~~~~~g~T~Lh~A~~~~~~~~v~~Ll~~gad~------n~~d  154 (434)
T PHA02874         81 HDIIKLLIDNGVDTSILPIPCIEKDMIKTILDCGIDVNIKDAELKTFLHYAIKKGDLESIKMLFEYGADV------NIED  154 (434)
T ss_pred             HHHHHHHHHCCCCCCcchhccCCHHHHHHHHHCcCCCCCCCCCCccHHHHHHHCCCHHHHHHHHhCCCCC------CCcC
Confidence            999999998765432100      0       00023456889999999999999999999999988664      2356


Q ss_pred             CCCchHHHHHHHhCcHHHHHHHHHhccccccccccCCCcHHHHHHHhCcHHHHHHhhcCCCCcccccCCCCCcHHHHHHh
Q 048248          152 PNNLTLLHSAIIKSQFVVMAKILEAKRDLINVRDERNRNPLRYAAALGHFKIACRLSDEDDSLVYQHDCNGQSPLHLASQ  231 (316)
Q Consensus       152 ~~~~t~lh~A~~~~~~~~~~~ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~~~~~ll~~~~~~~~~~d~~g~tpLh~A~~  231 (316)
                      ..|.||||+|+..++.++++.|+..+. .++..|..|.||||+|+..|+.++++.|++.+.. ++.++..|+||||.|+.
T Consensus       155 ~~g~tpLh~A~~~~~~~iv~~Ll~~g~-~~n~~~~~g~tpL~~A~~~g~~~iv~~Ll~~g~~-i~~~~~~g~TpL~~A~~  232 (434)
T PHA02874        155 DNGCYPIHIAIKHNFFDIIKLLLEKGA-YANVKDNNGESPLHNAAEYGDYACIKLLIDHGNH-IMNKCKNGFTPLHNAII  232 (434)
T ss_pred             CCCCCHHHHHHHCCcHHHHHHHHHCCC-CCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCC-CcCCCCCCCCHHHHHHH
Confidence            689999999999999999999997764 5788999999999999999999999999977654 56688899999999999


Q ss_pred             cCCHhHHHHHHhhCCCCccccccCCCcHHHHHHHcC-ChhHHHHHhcCcccccccccCCCCCCcHHHHHHHcC-ChhHHH
Q 048248          232 NGQLSILENLLHSYPDSIEFIDNKNRNILHLAAQNG-HADVVVFILKQPEVEDLINSSDVDGNTPLHLAAINN-HFNIIL  309 (316)
Q Consensus       232 ~g~~~iv~~Ll~~~~~~~~~~d~~g~tpLh~A~~~g-~~~~~~~Ll~~~~~~~~~~~~d~~g~t~L~~A~~~~-~~~~~~  309 (316)
                      .+. ++++.|+.  +..++.+|..|+||||+|+..+ +.+++++|+..+.   .++.+|.+|.||||+|++.+ +..+++
T Consensus       233 ~~~-~~i~~Ll~--~~~in~~d~~G~TpLh~A~~~~~~~~iv~~Ll~~ga---d~n~~d~~g~TpL~~A~~~~~~~~~ik  306 (434)
T PHA02874        233 HNR-SAIELLIN--NASINDQDIDGSTPLHHAINPPCDIDIIDILLYHKA---DISIKDNKGENPIDTAFKYINKDPVIK  306 (434)
T ss_pred             CCh-HHHHHHHc--CCCCCCcCCCCCCHHHHHHhcCCcHHHHHHHHHCcC---CCCCCCCCCCCHHHHHHHhCCccHHHH
Confidence            876 56676763  3457899999999999999876 7899999998864   47888999999999999887 678888


Q ss_pred             HHhhcC
Q 048248          310 VLARNM  315 (316)
Q Consensus       310 ~Ll~~~  315 (316)
                      .|+.++
T Consensus       307 ~ll~~~  312 (434)
T PHA02874        307 DIIANA  312 (434)
T ss_pred             HHHHhc
Confidence            888754



>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 9e-17
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-16
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-13
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 4e-13
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-12
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-12
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-12
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 3e-12
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 4e-12
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 4e-12
2xee_A157 Structural Determinants For Improved Thermal Stabil 4e-12
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 5e-12
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-11
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 3e-11
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-11
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 3e-11
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-11
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 5e-11
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-10
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 3e-10
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-10
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 7e-10
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 7e-10
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-09
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-09
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 6e-09
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-08
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 3e-07
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 3e-07
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-04
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 2e-06
3b7b_A 237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 1e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 2e-06
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 2e-05
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 3e-06
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 3e-06
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 3e-06
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 3e-06
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 4e-06
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 6e-06
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 4e-06
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 4e-05
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 6e-06
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 8e-05
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 6e-06
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-04
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 8e-06
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-05
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 8e-06
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 8e-05
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 1e-05
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-05
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-05
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 1e-04
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-05
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 3e-05
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 3e-05
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 6e-05
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 6e-05
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 7e-05
3so8_A162 Crystal Structure Of Ankra Length = 162 8e-05
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 8e-05
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 9e-05
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 1e-04
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 1e-04
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 1e-04
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 2e-04
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 2e-04
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 2e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-04
1uoh_A226 Human Gankyrin Length = 226 2e-04
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-04
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 3e-04
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 3e-04
3uxg_A172 Crystal Structure Of Rfxank Length = 172 4e-04
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 5e-04
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 6e-04
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 6e-04
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 7e-04
3aji_A 231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 8e-04
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 8e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure

Iteration: 1

Score = 84.3 bits (207), Expect = 9e-17, Method: Compositional matrix adjust. Identities = 94/330 (28%), Positives = 151/330 (45%), Gaps = 43/330 (13%) Query: 8 LFRALRHGYTDKVREFARLNGNRILGTSQNGDTALHIAARFGHEILVMEILKHQSDLVSV 67 L A R G+T+ V+ N N L T+ G T LHIAAR GH V+ +L+ ++ + Sbjct: 84 LHCAARIGHTNMVKLLLENNANPNLATTA-GHTPLHIAAREGHVETVLALLEKEASQACM 142 Query: 68 PNHKSETPMHVAARAGNFGAAQIFMR----PHGNGNNTGT------------FDDILRKR 111 K TP+HVAA+ G A++ + P+ G N T +L R Sbjct: 143 -TKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR 201 Query: 112 DEE-------GNTPLHNAVRKCDGKMAFTMIKKDPEPIRYNNKAKQGPNNLTLLHSAIIK 164 G TPLH A ++ ++A ++++ N ++ QG +T LH A + Sbjct: 202 GGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGS---ANAESVQG---VTPLHLAA-Q 254 Query: 165 SQFVVMAKILEAKRDLINVRDERNRNPLRYAAALGHFKIACRLSDEDDSLVYQHDCNGQS 224 M +L +K+ N+ ++ PL A GH +A L + +V G + Sbjct: 255 EGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLI-KHGVMVDATTRMGYT 313 Query: 225 PLHLASQNGQLSILENLLHSYPDSIEFIDNKNR---NILHLAAQNGHADVVVFILKQPEV 281 PLH+AS G + +++ LL D ++ K + + LH AAQ GH D+V +LK Sbjct: 314 PLHVASHYGNIKLVKFLLQHQAD----VNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGAS 369 Query: 282 EDLINSSDVDGNTPLHLAAINNHFNIILVL 311 + ++S DG TPL +A + ++ VL Sbjct: 370 PNEVSS---DGTTPLAIAKRLGYISVTDVL 396
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-35
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-35
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-35
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-33
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-29
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-27
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-34
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-07
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-32
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-21
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-21
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-31
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-29
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-24
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-15
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-13
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-30
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-30
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-29
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-25
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-16
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-16
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-29
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-26
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-20
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-29
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-20
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-27
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-24
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 3e-19
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-27
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-22
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-17
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-27
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-24
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-21
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-27
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-25
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-25
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-23
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-19
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-12
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-25
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-21
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-25
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 2e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-04
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-24
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-23
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-05
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-24
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-23
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-18
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-16
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 3e-16
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-24
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-17
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-24
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-12
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-04
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-23
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-13
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-12
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-09
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-08
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-04
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-23
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-12
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-05
2rfa_A232 Transient receptor potential cation channel subfa 6e-22
2rfa_A232 Transient receptor potential cation channel subfa 5e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-21
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-18
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-21
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-13
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-21
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-14
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-12
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-04
2pnn_A273 Transient receptor potential cation channel subfa 2e-20
2pnn_A273 Transient receptor potential cation channel subfa 7e-16
2pnn_A 273 Transient receptor potential cation channel subfa 6e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-19
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-09
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-19
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-17
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-19
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-19
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-15
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-18
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-15
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-14
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-14
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-09
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-18
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-17
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-15
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-14
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-18
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-18
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-18
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-14
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-18
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 8e-18
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-13
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 3e-09
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-17
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-16
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-08
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-05
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-17
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-05
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-17
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-14
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-09
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-09
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-07
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-06
2etb_A256 Transient receptor potential cation channel subfam 9e-17
2etb_A256 Transient receptor potential cation channel subfam 1e-15
2etb_A256 Transient receptor potential cation channel subfam 2e-15
2etb_A256 Transient receptor potential cation channel subfam 1e-14
2etb_A256 Transient receptor potential cation channel subfam 3e-13
2etb_A256 Transient receptor potential cation channel subfam 2e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-16
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-11
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-09
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-07
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-05
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-16
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-15
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-06
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-16
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-15
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-13
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-15
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-14
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-14
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-13
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-12
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-14
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-13
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-13
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-10
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-10
3jxi_A 260 Vanilloid receptor-related osmotically activated p 5e-06
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 7e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 9e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 9e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 5e-05
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-04
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  131 bits (331), Expect = 3e-35
 Identities = 76/278 (27%), Positives = 122/278 (43%), Gaps = 23/278 (8%)

Query: 34  TSQNGDTALHIAARFGHEILVMEILKHQSDLVSVPNHKSETPMHVAARAGNFGAAQIFMR 93
             ++G T LH+A+  GH  +V  +L+  +   +V N K ETP+H+AARAG+   A+  ++
Sbjct: 10  GGESGLTPLHVASFMGHLPIVKNLLQRGAS-PNVSNVKVETPLHMAARAGHTEVAKYLLQ 68

Query: 94  PHGNGNNTGTFDDILRKRDEEGNTPLHNAVRKCDGKMAFTMIKKDPEPIRYNNKAKQGPN 153
                N           + ++  TPLH A R     M   +++ +  P   N     G  
Sbjct: 69  NKAKVN----------AKAKDDQTPLHCAARIGHTNMVKLLLENNANP---NLATTAG-- 113

Query: 154 NLTLLHSAIIKSQFVVMAKILEAKRDLINVRDERNRNPLRYAAALGHFKIACRLSDEDDS 213
             T LH A  +     +  +LE +        ++   PL  AA  G  ++A  L +  D+
Sbjct: 114 -HTPLHIAAREGHVETVLALLEKEAS-QACMTKKGFTPLHVAAKYGKVRVAELLLER-DA 170

Query: 214 LVYQHDCNGQSPLHLASQNGQLSILENLLHSYPDSIEFIDNKNRNILHLAAQNGHADVVV 273
                  NG +PLH+A  +  L I++ LL     S           LH+AA+    +V  
Sbjct: 171 HPNAAGKNGLTPLHVAVHHNNLDIVKLLL-PRGGSPHSPAWNGYTPLHIAAKQNQVEVAR 229

Query: 274 FILKQPEVEDLINSSDVDGNTPLHLAAINNHFNIILVL 311
            +L+        N+  V G TPLHLAA   H  ++ +L
Sbjct: 230 SLLQY-GGS--ANAESVQGVTPLHLAAQEGHAEMVALL 264


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.98
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.98
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.98
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.92
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.92
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.92
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.92
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.91
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.91
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.9
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.89
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.89
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.89
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.88
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.88
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.88
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.88
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.87
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.86
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.86
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.84
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.84
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.83
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.83
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.82
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.8
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.77
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.75
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-47  Score=335.11  Aligned_cols=291  Identities=22%  Similarity=0.236  Sum_probs=248.6

Q ss_pred             cHHHHHHHhcCChHHHHHHHHhcCCccccccC-CCChHHHHHHHhCCHHHHHHHHhcCCCccccCCCCCCcHHHHHHHhC
Q 048248            5 DHKLFRALRHGYTDKVREFARLNGNRILGTSQ-NGDTALHIAARFGHEILVMEILKHQSDLVSVPNHKSETPMHVAARAG   83 (316)
Q Consensus         5 ~~~l~~a~~~g~~~~~~~ll~~~~~~~~~~~~-~g~t~Lh~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~tpLh~A~~~g   83 (316)
                      .++|+.|++.|+.+.|+.|+.. |.+++.++. .|+||||+|+..|+.++|++|++.++.. ...+..+.+|++.++..+
T Consensus        26 ~t~L~~Av~~g~~~~V~~LL~~-Gadvn~~~~~~g~TpLh~A~~~g~~~iv~~Ll~~ga~~-~~~~~~~~~~~~~~~~~~  103 (337)
T 4g8k_A           26 NHLLIKAVQNEDVDLVQQLLEG-GANVNFQEEEGGWTPLHNAVQMSREDIVELLLRHGADP-VLRKKNGATPFILAAIAG  103 (337)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHH-TCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHHTTCCT-TCCCTTCCCHHHHHHHHT
T ss_pred             ChHHHHHHHcCCHHHHHHHHHC-CCCCCccCCCCCcCHHHHHHHcCCHHHHHHHHHcCCch-hhhccCCCchhHHHHhcc
Confidence            5689999999999999888876 567887764 5999999999999999999999999874 557889999999999999


Q ss_pred             ChhHHHHhhccCCCCCCCCcchhhhhccCCCCCcHHHHHHhcCChhHHHHHHhhCCCcccc----cccccCCCCCchHHH
Q 048248           84 NFGAAQIFMRPHGNGNNTGTFDDILRKRDEEGNTPLHNAVRKCDGKMAFTMIKKDPEPIRY----NNKAKQGPNNLTLLH  159 (316)
Q Consensus        84 ~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~g~t~L~~a~~~~~~~~~~~ll~~~~~~~~~----~~~~~~~~~~~t~lh  159 (316)
                      ....+..++..+..          ++..|..|+||||+|+..++.++++.++..+..+...    ......+..|.||||
T Consensus       104 ~~~~~~~~~~~~~~----------~~~~d~~g~t~l~~A~~~~~~~~~~~ll~~ga~~~~~~~~~~~~~~~~~~g~T~L~  173 (337)
T 4g8k_A          104 SVKLLKLFLSKGAD----------VNECDFYGFTAFMEAAVYGKVKALKFLYKRGANVNLRRKTKEDQERLRKGGATALM  173 (337)
T ss_dssp             CHHHHHHHHTTTCC----------TTCBCTTCCBHHHHHHHTTCHHHHHHHHHTTCCTTCCCCCC-----CTTCSCCHHH
T ss_pred             cchhhHHhhhccch----------hhhhccCCCCHHHHHHHcCcHHHHHHHHHcCCCcchhhccccccccccCCCCcHHH
Confidence            99999999876543          4457899999999999999999999999998765311    111234567899999


Q ss_pred             HHHHhCcHHHHHHHHHhccccccccccCCCcHHHHHHHhCc---H-HHHHHhhcCCCCcccccCCCCCcHHHHHHhcCCH
Q 048248          160 SAIIKSQFVVMAKILEAKRDLINVRDERNRNPLRYAAALGH---F-KIACRLSDEDDSLVYQHDCNGQSPLHLASQNGQL  235 (316)
Q Consensus       160 ~A~~~~~~~~~~~ll~~~~~~~~~~d~~g~tpLh~A~~~g~---~-~~~~~ll~~~~~~~~~~d~~g~tpLh~A~~~g~~  235 (316)
                      +|+..|+.++++.||...+.+++.+|..|.||+|+++..+.   . .+++.|+ ..+.+++.+|..|+||||+|+..|+.
T Consensus       174 ~A~~~g~~~~v~~LL~~~gad~n~~d~~g~t~l~~~~~~~~~~~~~~i~~lLl-~~gad~n~~d~~g~t~L~~a~~~~~~  252 (337)
T 4g8k_A          174 DAAEKGHVEVLKILLDEMGADVNACDNMGRNALIHALLSSDDSDVEAITHLLL-DHGADVNVRGERGKTPLILAVEKKHL  252 (337)
T ss_dssp             HHHHHTCHHHHHHHHHHSCCCTTCCCTTSCCHHHHHHHHSCTTTHHHHHHHHH-HTTCCTTCCCGGGCCHHHHHHHTTCH
T ss_pred             HHHHCCCHHHHHHHHhccCCCcCccCCCCCcHHHHHHHHcCcccHHHHHHHHH-HCCCCCCCcCCCCCCHHHHHHHhhhh
Confidence            99999999999999987777899999999999999887554   2 3455555 45566788999999999999999999


Q ss_pred             hHHHHHHhhCCCCccccccCCCcHHHHHHHcCChhHHHHHhcCcccccccccCCCCCCcHHHHHHHcCChhHHHHHhhcC
Q 048248          236 SILENLLHSYPDSIEFIDNKNRNILHLAAQNGHADVVVFILKQPEVEDLINSSDVDGNTPLHLAAINNHFNIILVLARNM  315 (316)
Q Consensus       236 ~iv~~Ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~~~~~Ll~~~~~~~~~~~~d~~g~t~L~~A~~~~~~~~~~~Ll~~~  315 (316)
                      ++++.|+...+.+++.+|..|+||||+|++.|+.+++++|++.|.        |-++.+|||+|++.|+.++|++|+++|
T Consensus       253 ~~v~~Ll~~~~~~vn~~d~~G~TpL~~A~~~g~~~iv~~Ll~~GA--------d~n~~~~L~~A~~~~~~~iv~~Ll~~G  324 (337)
T 4g8k_A          253 GLVQRLLEQEHIEINDTDSDGKTALLLAVELKLKKIAELLCKRGA--------STDCGDLVMTARRNYDHSLVKVLLSHG  324 (337)
T ss_dssp             HHHHHHHTSTTCCTTCBCTTSCBHHHHHHHTTCHHHHHHHHTTSC--------SSTTCCHHHHHHHTTCHHHHHHHHHTT
T ss_pred             HHHHHHHHhcCCcccCcCCCCCCHHHHHHHcCCHHHHHHHHHCCC--------CCCCCCHHHHHHHcCCHHHHHHHHHCc
Confidence            999999988777889999999999999999999999999999874        224568999999999999999999987


Q ss_pred             C
Q 048248          316 S  316 (316)
Q Consensus       316 ~  316 (316)
                      +
T Consensus       325 A  325 (337)
T 4g8k_A          325 A  325 (337)
T ss_dssp             C
T ss_pred             C
Confidence            4



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 316
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-26
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-22
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-20
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-14
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-22
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-22
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-21
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-12
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-11
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-19
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-16
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-04
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.001
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-16
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-11
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-16
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-14
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-13
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.004
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-15
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-14
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-12
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-15
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-15
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-14
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-04
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.003
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-13
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-11
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 9e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.002
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 8e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.002
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.002
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.002
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  103 bits (258), Expect = 9e-26
 Identities = 76/302 (25%), Positives = 118/302 (39%), Gaps = 44/302 (14%)

Query: 40  TALHIAARFGHEILVMEILKHQSDLVSVPNHKSETPMHVAARAGNFGAAQIFMRPHGNGN 99
           T LH+A+  GH  +V  +L+  +   +V N K ETP+H+AARAG+   A+  ++     N
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGAS-PNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVN 60

Query: 100 NTGTFDDILRKRDEEGNTPLHNAVRKCDGKMAFTMIKKDPEPIRYNNK------------ 147
                      + ++  TPLH A R     M   +++ +  P                  
Sbjct: 61  ----------AKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREG 110

Query: 148 ---------------AKQGPNNLTLLHSAIIKSQFVVMAKILEAKRDLINVRDERNRNPL 192
                          A       T LH A    +  V   +LE      N   +    PL
Sbjct: 111 HVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAH-PNAAGKNGLTPL 169

Query: 193 RYAAALGHFKIACRLSDEDDSLVYQHDCNGQSPLHLASQNGQLSILENLLHSYPDSIEFI 252
             A    +  I   L     S  +    NG +PLH+A++  Q+ +  +LL     +    
Sbjct: 170 HVAVHHNNLDIVKLLLPRGGS-PHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAE- 227

Query: 253 DNKNRNILHLAAQNGHADVVVFILKQPEVEDLINSSDVDGNTPLHLAAINNHFNIILVLA 312
             +    LHLAAQ GHA++V  +L +       N  +  G TPLHL A   H  +  VL 
Sbjct: 228 SVQGVTPLHLAAQEGHAEMVALLLSKQAN---GNLGNKSGLTPLHLVAQEGHVPVADVLI 284

Query: 313 RN 314
           ++
Sbjct: 285 KH 286


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.95
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.93
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.92
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.91
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.9
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.9
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.87
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.85
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.5e-43  Score=314.53  Aligned_cols=299  Identities=25%  Similarity=0.331  Sum_probs=245.5

Q ss_pred             HHHHHHHhcCChHHHHHHHHhcCCccccccCCCChHHHHHHHhCCHHHHHHHHhcCCCccccCCCCCCcHHHHHHHhCCh
Q 048248            6 HKLFRALRHGYTDKVREFARLNGNRILGTSQNGDTALHIAARFGHEILVMEILKHQSDLVSVPNHKSETPMHVAARAGNF   85 (316)
Q Consensus         6 ~~l~~a~~~g~~~~~~~ll~~~~~~~~~~~~~g~t~Lh~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~tpLh~A~~~g~~   85 (316)
                      +|||.||..|+.+.|+.|+.. |.+++..+..|+||||+|+..|+.++|++|++.|+++ ...+.+|+||||+|+..|+.
T Consensus         2 TpL~~Aa~~g~~~~v~~Ll~~-g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gadi-~~~~~~g~t~L~~A~~~g~~   79 (408)
T d1n11a_           2 TPLHVASFMGHLPIVKNLLQR-GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKV-NAKAKDDQTPLHCAARIGHT   79 (408)
T ss_dssp             CHHHHHHHHTCHHHHHHHHHT-TCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCS-SCCCTTSCCHHHHHHHHTCH
T ss_pred             ChHHHHHHCcCHHHHHHHHHC-CCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCcCCC-CCCCCCCCCHHHHHHHcCCH
Confidence            599999999999999888876 5778999999999999999999999999999999874 56788999999999999999


Q ss_pred             hHHHHhhccCCCCCCCC-----------------------------------cc-----------hh----------hhh
Q 048248           86 GAAQIFMRPHGNGNNTG-----------------------------------TF-----------DD----------ILR  109 (316)
Q Consensus        86 ~~~~~l~~~~~~~~~~~-----------------------------------~~-----------~~----------~~~  109 (316)
                      +++++|+..........                                   +.           .+          .+.
T Consensus        80 ~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~~~~  159 (408)
T d1n11a_          80 NMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPN  159 (408)
T ss_dssp             HHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTT
T ss_pred             HHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHHcCCCCC
Confidence            99999886443211000                                   00           00          112


Q ss_pred             ccCCCCCcHHHHHHhcCChhHHHHHHhhCCCcccc---------------------------cccccCCCCCchHHHHHH
Q 048248          110 KRDEEGNTPLHNAVRKCDGKMAFTMIKKDPEPIRY---------------------------NNKAKQGPNNLTLLHSAI  162 (316)
Q Consensus       110 ~~~~~g~t~L~~a~~~~~~~~~~~ll~~~~~~~~~---------------------------~~~~~~~~~~~t~lh~A~  162 (316)
                      ..+.+|.+|||+|+..++.++++.|+..+.++...                           ......+..+.||+|+|+
T Consensus       160 ~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~~a~  239 (408)
T d1n11a_         160 AAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAA  239 (408)
T ss_dssp             CCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHH
T ss_pred             cCCCcCchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchhhhccchhhhhhhhhhccccccccCCCCCCHHHHHH
Confidence            34668889999999999999999999887654211                           011123446778888888


Q ss_pred             HhCcHHHHHHHHHhccccccccccCCCcHHHHHHHhCcHHHHHHhhcCCCCcccccCCCCCcHHHHHHhcCCHhHHHHHH
Q 048248          163 IKSQFVVMAKILEAKRDLINVRDERNRNPLRYAAALGHFKIACRLSDEDDSLVYQHDCNGQSPLHLASQNGQLSILENLL  242 (316)
Q Consensus       163 ~~~~~~~~~~ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~~~~~ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~iv~~Ll  242 (316)
                      ..+..++++.++.... ..+..+..|.|||+.|++.++.++++.|++.+. +++..+..+.||||.|+..++.++++.++
T Consensus       240 ~~~~~~~~~~~~~~~~-~~~~~~~~g~~~l~~a~~~~~~~i~~~Ll~~g~-~~~~~~~~~~t~L~~~~~~~~~~~~~~ll  317 (408)
T d1n11a_         240 QEGHAEMVALLLSKQA-NGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGV-MVDATTRMGYTPLHVASHYGNIKLVKFLL  317 (408)
T ss_dssp             HTTCHHHHHHHHTTTC-CTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTC-CTTCCCSSCCCHHHHHHHSSCSHHHHHHH
T ss_pred             HhCcHhHhhhhhcccc-ccccccCCCCChhhhhhhcCcHHHHHHHHHCCC-ccccccccccccchhhcccCcceeeeeec
Confidence            8888888887776543 467788899999999999999999999987554 45667888999999999999999999999


Q ss_pred             hhCCCCccccccCCCcHHHHHHHcCChhHHHHHhcCcccccccccCCCCCCcHHHHHHHcCChhHHHHHh
Q 048248          243 HSYPDSIEFIDNKNRNILHLAAQNGHADVVVFILKQPEVEDLINSSDVDGNTPLHLAAINNHFNIILVLA  312 (316)
Q Consensus       243 ~~~~~~~~~~d~~g~tpLh~A~~~g~~~~~~~Ll~~~~~~~~~~~~d~~g~t~L~~A~~~~~~~~~~~Ll  312 (316)
                      +.+ .+++.+|..|.||||+|+++|+.+++++|++.|.   .++.+|.+|+||||+|++.||.++|++|.
T Consensus       318 ~~g-~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GA---d~n~~d~~G~t~L~~A~~~~~~~iv~~L~  383 (408)
T d1n11a_         318 QHQ-ADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA---SPNEVSSDGTTPLAIAKRLGYISVTDVLK  383 (408)
T ss_dssp             HTT-CCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTC---CSCCCCSSSCCHHHHHHHTTCHHHHHHHH
T ss_pred             ccc-ccccccCCCCCCHHHHHHHcCCHHHHHHHHHCCC---CCCCCCCCCCCHHHHHHHcCCHHHHHHHH
Confidence            875 4579999999999999999999999999999874   37889999999999999999999999874



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure