Citrus Sinensis ID: 048290


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250---
NCSQLRVLDLGKNAFFGEIPTWTGESLQNLIVLSLKSNKFHGNIPYQLCHLGFIQVLDLSLNIISGKIPKCFNNFSAMTYERCSNPTIGFAKLIFVPAGTGYYYKYLVNLLLTWKGSENEYKSTLGLVRCLDLSRKIPLGTQLQSFNASVYAGNLELCGLPLANKCPDEESTPSPGTDDDSDTLEDENDQFITLGFYLSSILGFFVGFWGVCGTLMLNRSWRYGFFNFLTSMKDWVYVIWAVNIAKLLRKFRN
ccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHccccccccEEEccccccccccccccccccccccccccccccccccccccccccHHHHccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccEEEEHHHHHHHHHHHHHcc
cccccEEEEcccccccccccHHHHHHHccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccHccHHHccEEEcccccccccccHHHHcccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ncsqlrvldlgknaffgeiptwtgeSLQNLIVLSLksnkfhgnipyqlchLGFIQVLDLSLNiisgkipkcfnnfsamtyercsnptigfaKLIFVPAGTGYYYKYLVNLLLTWKGSENEYKSTLGLVRcldlsrkiplgtqlqsfnasvyagnlelcglplankcpdeestpspgtdddsdtledenDQFITLGFYLSSILGFFVGFWGVCGTLMLNRSWRYGFFNFLTSMKDWVYVIWAVNIAKLLRKFRN
NCSQLRVLDLGKNAFFGEIPTWTGESLQNLIVLSLKSNKFHGNIPYQLCHLGFIQVLDLSLNIISGKIPKCFNNFSAMTYERCSNPTIGFAKLIFVPAGTGYYYKYLVNLLLTWKGSENEYKSTLGLVRCLDLSRKIPLGTQLQSFNASVYAGNLELCGLPLANKCPDEESTpspgtdddsdtLEDENDQFITLGFYLSSILGFFVGFWGVCGTLMLNRSWRYGFFNFLTSMKDWVYVIWAVNIAKLLRKFRN
NCSQLRVLDLGKNAFFGEIPTWTGESLQNLIVLSLKSNKFHGNIPYQLCHLGFIQVLDLSLNIISGKIPKCFNNFSAMTYERCSNPTIGFAKLIFVPAGTGYYYKYLVNLLLTWKGSENEYKSTLGLVRCLDLSRKIPLGTQLQSFNASVYAGNLELCGLPLANKCPDEEstpspgtdddsdtledendQFITLGFYLSSILGFFVGFWGVCGTLMLNRSWRYGFFNFLTSMKDWVYVIWAVNIAKLLRKFRN
****LRVLDLGKNAFFGEIPTWTGESLQNLIVLSLKSNKFHGNIPYQLCHLGFIQVLDLSLNIISGKIPKCFNNFSAMTYERCSNPTIGFAKLIFVPAGTGYYYKYLVNLLLTWKGSENEYKSTLGLVRCLDLSRKIPLGTQLQSFNASVYAGNLELCGLPLAN*************************QFITLGFYLSSILGFFVGFWGVCGTLMLNRSWRYGFFNFLTSMKDWVYVIWAVNIAKLLR****
NCSQLRVLDLGKNAFFGEIPTWTGESLQNLIVLSLKSNKFHGNIPYQLCHLGFIQVLDLSLNIISGKIPKCFNNFSAMTYERCSNPTIGFAKLIFVPAGTGYYYKYLVNLLLTWKGSENEYKSTLGLVRCLDLSRKIPLGTQLQSFNASVYAGNLELCGLPLAN*************************QFITLGFYLSSILGFFVGFWGVCGTLMLNRSWRYGFFNFLTSMKDWVYVIWAVNIAKLLRKF**
NCSQLRVLDLGKNAFFGEIPTWTGESLQNLIVLSLKSNKFHGNIPYQLCHLGFIQVLDLSLNIISGKIPKCFNNFSAMTYERCSNPTIGFAKLIFVPAGTGYYYKYLVNLLLTWKGSENEYKSTLGLVRCLDLSRKIPLGTQLQSFNASVYAGNLELCGLPLANKC****************TLEDENDQFITLGFYLSSILGFFVGFWGVCGTLMLNRSWRYGFFNFLTSMKDWVYVIWAVNIAKLLRKFRN
*CSQLRVLDLGKNAFFGEIPTWTGESLQNLIVLSLKSNKFHGNIPYQLCHLGFIQVLDLSLNIISGKIPKCFNNFSAMTYERCSNPTIGFAKLIFVPAGTGYYYKYLVNLLLTWKGSENEYKSTLGLVRCLDLSRKIPLGTQLQSFNASVYAGNLELCGLPLANKC**********************DQFITLGFYLSSILGFFVGFWGVCGTLMLNRSWRYGFFNFLTSMKDWVYVIWAVNIAKLLRK***
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NCSQLRVLDLGKNAFFGEIPTWTGESLQNLIVLSLKSNKFHGNIPYQLCHLGFIQVLDLSLNIISGKIPKCFNNFSAMTYERCSNPTIGFAKLIFVPAGTGYYYKYLVNLLLTWKGSENEYKSTLGLVRCLDLSRKIPLGTQLQSFNASVYAGNLELCGLPLANKCPDEESTPSPGTDDDSDTLEDENDQFITLGFYLSSILGFFVGFWGVCGTLMLNRSWRYGFFNFLTSMKDWVYVIWAVNIAKLLRKFRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query253 2.2.26 [Sep-21-2011]
Q9C9Y8 640 Probable inactive recepto no no 0.584 0.231 0.284 1e-08
Q9SYQ8 980 Receptor protein kinase C no no 0.739 0.190 0.298 1e-08
C0LGQ5 1249 LRR receptor-like serine/ no no 0.288 0.058 0.445 2e-08
Q9LHP4 1141 Receptor-like protein kin no no 0.280 0.062 0.424 9e-08
C0LGF5 1072 Probable LRR receptor-lik no no 0.288 0.068 0.391 1e-07
O49318 1124 Probable leucine-rich rep no no 0.304 0.068 0.384 1e-07
Q8RWZ1 768 Protein STRUBBELIG OS=Ara no no 0.292 0.096 0.402 2e-07
O22476 1196 Protein BRASSINOSTEROID I no no 0.280 0.059 0.416 3e-07
Q9ZUI0 980 Putative leucine-rich rep no no 0.347 0.089 0.395 4e-07
C0LGS3 768 Probable LRR receptor-lik no no 0.826 0.272 0.263 4e-07
>sp|Q9C9Y8|Y3868_ARATH Probable inactive receptor kinase At3g08680 OS=Arabidopsis thaliana GN=At3g08680 PE=1 SV=1 Back     alignment and function desciption
 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 81/197 (41%), Gaps = 49/197 (24%)

Query: 1   NCSQLRVLDLGKNAFFGEIPTWTGESLQNLIVLSLKSNKFHGNIPYQLCHLGFIQV---- 56
           N +++  L L  +  +G +P  T E L  L ++SL+SN   GNIP  +  L FI+     
Sbjct: 65  NNARVTALRLPGSGLYGPLPEKTFEKLDALRIISLRSNHLQGNIPSVILSLPFIRSLYFH 124

Query: 57  ------------------LDLSLNIISGKIPKCFNNFSAMTYERCSNPTIGFAKLIFVPA 98
                             LDLS N +SG IP    N + +T     N ++        P 
Sbjct: 125 ENNFSGTIPPVLSHRLVNLDLSANSLSGNIPTSLQNLTQLTDLSLQNNSLSGPIPNLPP- 183

Query: 99  GTGYYYKYLVNLLLTWKGSENEYKSTLGLVRCLDLSRKIPLGTQLQSFNASVYAGNLELC 158
                 KYL NL                     +L+  +P  + ++SF AS + GN  LC
Sbjct: 184 ----RLKYL-NLSFN------------------NLNGSVP--SSVKSFPASSFQGNSLLC 218

Query: 159 GLPLANKCPDEESTPSP 175
           G PL   CP+  + PSP
Sbjct: 219 GAPL-TPCPENTTAPSP 234





Arabidopsis thaliana (taxid: 3702)
>sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q8RWZ1|SUB_ARATH Protein STRUBBELIG OS=Arabidopsis thaliana GN=SUB PE=1 SV=1 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 Back     alignment and function description
>sp|C0LGS3|Y4372_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g37250 OS=Arabidopsis thaliana GN=At4g37250 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query253
147807651 971 hypothetical protein VITISV_018647 [Viti 0.996 0.259 0.371 5e-46
358344148 371 Receptor-like protein kinase [Medicago t 0.968 0.660 0.323 5e-42
359496388 1014 PREDICTED: brassinosteroid LRR receptor 0.972 0.242 0.375 4e-40
359496717 1014 PREDICTED: brassinosteroid LRR receptor 0.972 0.242 0.371 1e-39
359488633 981 PREDICTED: LRR receptor-like serine/thre 0.984 0.253 0.342 2e-39
147790721 780 hypothetical protein VITISV_031879 [Viti 0.901 0.292 0.380 3e-39
359488591 981 PREDICTED: probable leucine-rich repeat 0.984 0.253 0.339 4e-39
147770493 1024 hypothetical protein VITISV_019847 [Viti 0.972 0.240 0.368 6e-39
359496701 904 PREDICTED: LRR receptor-like serine/thre 0.960 0.268 0.369 9e-39
359496699 1007 PREDICTED: LRR receptor-like serine/thre 0.960 0.241 0.363 2e-38
>gi|147807651|emb|CAN64389.1| hypothetical protein VITISV_018647 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  190 bits (483), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 120/323 (37%), Positives = 159/323 (49%), Gaps = 71/323 (21%)

Query: 1   NCSQLRVLDLGKNAFFGEIPTWTGESLQNLIVLSLKSNKFHGNIPYQLCHLGFIQVLDLS 60
           NC  LR++DLGKN   G+I  W G SL +LIVL+L+SN+F+G+IP  LC L  IQ+LDLS
Sbjct: 648 NCRALRLIDLGKNKLSGKITAWMGGSLSDLIVLNLRSNEFNGSIPSSLCQLKQIQMLDLS 707

Query: 61  LNIISGKIPKCFNNFSAMTYER-----------CSNPTIGFAKLIFVPAGTGYYYKYLVN 109
            N +SGKIPKC  N +AM  +R            SNP       +    G    YK  + 
Sbjct: 708 SNNLSGKIPKCLKNLTAMAQKRSQVLFYDTWYDASNPHYYVDSTLVQWKGKEQEYKKTLG 767

Query: 110 LLLTWKGSENEY----------------------------KSTLG---LVRCLDLSR--- 135
           L+ +   S N+                              +T+G   L+  LDLS+   
Sbjct: 768 LIKSIDFSSNKLIGEIPIEVTDLVELVSLNLSSNNLIGSIPTTIGQLKLLDVLDLSQNQL 827

Query: 136 --------------------------KIPLGTQLQSFNASVYAGNLELCGLPLANKCPDE 169
                                     KIPLGTQLQSF+AS Y GN  LCG PL  +CP++
Sbjct: 828 NGRIPDTLSQIADLSVLDLSNNTLLGKIPLGTQLQSFDASTYEGNPGLCGPPLLKRCPED 887

Query: 170 ESTPSPGTDDDSDTLEDENDQFITLGFYLSSILGFFVGFWGVCGTLMLNRSWRYGFFNFL 229
           E          S   ED  D    + FY + +LGF +GFWGVCGTL+ N SWRY +F  L
Sbjct: 888 ELGGVSFISGLSSKKEDIQDDANNIWFYGNIVLGFIIGFWGVCGTLLFNSSWRYAYFQLL 947

Query: 230 TSMKDWVYVIWAVNIAKLLRKFR 252
           + +KDW+YV   VN+ ++ R  +
Sbjct: 948 SKIKDWLYVTTIVNMNRIRRSLQ 970




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|358344148|ref|XP_003636154.1| Receptor-like protein kinase [Medicago truncatula] gi|355502089|gb|AES83292.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|359496388|ref|XP_003635224.1| PREDICTED: brassinosteroid LRR receptor kinase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496717|ref|XP_003635312.1| PREDICTED: brassinosteroid LRR receptor kinase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488633|ref|XP_002264905.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147790721|emb|CAN65307.1| hypothetical protein VITISV_031879 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488591|ref|XP_003633783.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147770493|emb|CAN78141.1| hypothetical protein VITISV_019847 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496701|ref|XP_003635305.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496699|ref|XP_003635304.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query253
TAIR|locus:2044767905 AT2G34930 "AT2G34930" [Arabido 0.541 0.151 0.381 1.1e-16
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.320 0.083 0.421 1.3e-16
TAIR|locus:2101943 891 RLP45 "AT3G53240" [Arabidopsis 0.308 0.087 0.443 5.4e-14
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.276 0.074 0.402 2.9e-12
TAIR|locus:2144392 957 RLP53 "receptor like protein 5 0.312 0.082 0.462 9.3e-11
TAIR|locus:2037313 1000 RLP13 "AT1G74170" [Arabidopsis 0.268 0.068 0.457 1.9e-10
TAIR|locus:2129246891 RLP50 "receptor like protein 5 0.249 0.070 0.437 2e-10
TAIR|locus:2119535725 RLP48 "receptor like protein 4 0.316 0.110 0.372 2.4e-10
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.276 0.077 0.402 4e-10
TAIR|locus:2046515864 RLP24 "receptor like protein 2 0.521 0.152 0.302 5.5e-10
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 218 (81.8 bits), Expect = 1.1e-16, P = 1.1e-16
 Identities = 55/144 (38%), Positives = 82/144 (56%)

Query:     1 NCSQLRVLDLGKNAFFGEIPTWTGESLQNLIVLSLKSNKFHGNIPYQLCHLGFIQVLDLS 60
             NCS L  +DLG N   G++P+W G+ L +L +L L+SN F G IP  LC++  +++LDLS
Sbjct:   685 NCSGLTNIDLGGNKLTGKLPSWVGK-LSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLS 743

Query:    61 LNIISGKIPKCFNNFSAMTYERCSNPTIGFAKLIFVPAGTGYYYKYLVNLLLTWKGSENE 120
              N ISG IPKC +N +A+   R +N  + F  L+F+      Y     ++ L+      E
Sbjct:   744 GNKISGPIPKCISNLTAIA--RGTNNEV-FQNLVFIVTRAREYEAIANSINLSGNNISGE 800

Query:   121 Y-KSTLGLV--RCLDLSRKIPLGT 141
               +  LGL+  R L+LSR    G+
Sbjct:   801 IPREILGLLYLRILNLSRNSMAGS 824


GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119535 RLP48 "receptor like protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046515 RLP24 "receptor like protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00014061001
SubName- Full=Chromosome chr16 scaffold_10, whole genome shotgun sequence; (623 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query253
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 54.1 bits (130), Expect = 3e-08
 Identities = 35/81 (43%), Positives = 44/81 (54%), Gaps = 4/81 (4%)

Query: 1   NCSQLRVLDLGKNAFFGEIPTWTGESLQNLIVLSLKSNKFHGNIPYQLCHLGFIQVLDLS 60
           +  +L  LDL  N+  GEIP    + LQNL +L L SN F G IP  L  L  +QVL L 
Sbjct: 282 SLQKLISLDLSDNSLSGEIPELVIQ-LQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLW 340

Query: 61  LNIISGKIPKCF---NNFSAM 78
            N  SG+IPK     NN + +
Sbjct: 341 SNKFSGEIPKNLGKHNNLTVL 361


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 253
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.81
PLN03150623 hypothetical protein; Provisional 99.76
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.57
PLN03150623 hypothetical protein; Provisional 99.32
KOG0617264 consensus Ras suppressor protein (contains leucine 99.28
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.13
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.07
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.04
KOG0617264 consensus Ras suppressor protein (contains leucine 99.03
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.01
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.89
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.78
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.73
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.72
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.7
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.68
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.65
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.59
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.52
KOG4237498 consensus Extracellular matrix protein slit, conta 98.47
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.46
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.42
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.41
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.4
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.35
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.34
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.34
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.25
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.23
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.21
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.17
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.1
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.98
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.96
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.94
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.92
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.75
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.72
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.72
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.63
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.35
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.28
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.21
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.19
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.16
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.04
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.96
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.89
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.84
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 96.81
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.27
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.85
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.74
KOG2982418 consensus Uncharacterized conserved protein [Funct 95.58
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 95.51
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.79
PRK15386 426 type III secretion protein GogB; Provisional 94.74
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.65
smart0037026 LRR Leucine-rich repeats, outliers. 94.65
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.5
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 94.3
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.92
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 93.81
KOG2982418 consensus Uncharacterized conserved protein [Funct 92.78
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.77
PRK15386 426 type III secretion protein GogB; Provisional 92.56
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 92.35
smart0037026 LRR Leucine-rich repeats, outliers. 91.89
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.89
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.73
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 89.21
KOG0473326 consensus Leucine-rich repeat protein [Function un 87.95
KOG2123 388 consensus Uncharacterized conserved protein [Funct 87.9
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 87.4
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 86.97
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 85.88
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 85.85
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 83.42
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 83.38
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 82.28
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 82.02
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.81  E-value=8.8e-20  Score=179.79  Aligned_cols=147  Identities=27%  Similarity=0.396  Sum_probs=109.9

Q ss_pred             CCcceEEECCCCcCccCCChhHhhcCCCccEEEccCCcCcccCcccccCCCCCCEEeccCCccCCCcChhhhccccCccc
Q 048290            2 CSQLRVLDLGKNAFFGEIPTWTGESLQNLIVLSLKSNKFHGNIPYQLCHLGFIQVLDLSLNIISGKIPKCFNNFSAMTYE   81 (253)
Q Consensus         2 l~~L~~L~Ls~N~l~g~~p~~~~~~l~~L~~L~L~~N~l~g~ip~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L   81 (253)
                      +++|+.|+|++|++.|.+|..+.  .++|+.|+|++|+++|.+|..+..+++|+.|+|++|+++|.+|..+.++++|+.|
T Consensus       451 l~~L~~L~L~~n~~~~~~p~~~~--~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L  528 (968)
T PLN00113        451 MPSLQMLSLARNKFFGGLPDSFG--SKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSL  528 (968)
T ss_pred             CCCCcEEECcCceeeeecCcccc--cccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEE
Confidence            46677777777777777776553  5777777777777777777777777777777777777777777777777777777


Q ss_pred             c--CCCCCcccccccccC-------CCcccccceeeeeEEEeecccccccccccceeeeccCC-----CCCCCCCCCCCC
Q 048290           82 R--CSNPTIGFAKLIFVP-------AGTGYYYKYLVNLLLTWKGSENEYKSTLGLVRCLDLSR-----KIPLGTQLQSFN  147 (253)
Q Consensus        82 ~--~n~~~~~~~~~ip~~-------~~l~~~~~~~~~~~~~l~g~~p~~~~~l~~L~~LdLS~-----~iP~~~~l~~~~  147 (253)
                      +  .|.+.    +.+|..       ..+.+.+|.       ++|.+|..+..++.|+.+|+++     .+|..+++.++.
T Consensus       529 ~Ls~N~l~----~~~p~~~~~l~~L~~L~Ls~N~-------l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~  597 (968)
T PLN00113        529 DLSHNQLS----GQIPASFSEMPVLSQLDLSQNQ-------LSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAIN  597 (968)
T ss_pred             ECCCCccc----ccCChhHhCcccCCEEECCCCc-------ccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccC
Confidence            7  33332    223322       223344444       6899999999999999999998     799999999999


Q ss_pred             ccccCCcCCCCCcc
Q 048290          148 ASVYAGNLELCGLP  161 (253)
Q Consensus       148 ~~~~~gN~~LCg~~  161 (253)
                      ..++.||+++||.+
T Consensus       598 ~~~~~~n~~lc~~~  611 (968)
T PLN00113        598 ASAVAGNIDLCGGD  611 (968)
T ss_pred             hhhhcCCccccCCc
Confidence            99999999999865



>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query253
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-08
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-08
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 55.5 bits (132), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 1/72 (1%) Query: 1 NCSQLRVLDLGKNAFFGEIPTWTGESLQNLIVLSLKSNKFHGNIPYQLCHLGFIQVLDLS 60 NC+ L + L N GEIP W G L+NL +L L +N F GNIP +L + LDL+ Sbjct: 488 NCTNLNWISLSNNRLTGEIPKWIGR-LENLAILKLSNNSFSGNIPAELGDCRSLIWLDLN 546 Query: 61 LNIISGKIPKCF 72 N+ +G IP Sbjct: 547 TNLFNGTIPAAM 558
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query253
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-25
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-17
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-15
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-16
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  104 bits (262), Expect = 1e-25
 Identities = 42/177 (23%), Positives = 66/177 (37%), Gaps = 46/177 (25%)

Query: 1   NCSQLRVLDLGKNAFFGEIPTWTGESLQNLIVLSLKSNKFHGNIPYQLCHLGFIQVLDLS 60
           N   +  LD+  N   G IP   G S+  L +L+L  N   G+IP ++  L  + +LDLS
Sbjct: 630 NNGSMMFLDMSYNMLSGYIPKEIG-SMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLS 688

Query: 61  LNIISGKIPKCFNNFSAMTYERCSNPTIGFAKLIFVPAGTGYYYKYLVNLLLTWKGSENE 120
            N + G+IP+  +  + +T                            ++L      S N 
Sbjct: 689 SNKLDGRIPQAMSALTMLTE---------------------------IDL------SNN- 714

Query: 121 YKSTLGLVRCLDLSRKIPLGTQLQSFNASVYAGNLELCGLPLANKCPDEESTPSPGT 177
                      +LS  IP   Q ++F  + +  N  LCG PL    P      +   
Sbjct: 715 -----------NLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQ 760


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query253
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.8
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.66
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.66
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.65
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.64
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.63
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.63
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.63
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.63
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.62
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.62
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.61
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.6
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.59
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.58
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.58
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.56
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.56
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.55
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.55
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.54
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.54
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.53
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.53
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.52
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.52
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.49
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.49
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.48
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.48
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.48
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.48
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.48
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.47
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.47
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.47
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.47
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.47
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.46
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.45
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.44
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.44
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.44
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.43
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.42
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.42
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.42
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.42
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.42
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.42
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.42
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.41
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.41
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.41
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.41
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.4
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.4
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.4
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.4
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.39
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.39
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.38
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.38
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.37
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.36
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.36
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.36
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.36
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.36
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.36
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.35
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.35
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.35
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.34
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.34
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.34
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.32
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.31
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.3
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.3
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.3
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.3
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.29
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.29
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.28
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.28
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.26
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.25
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.25
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.25
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.24
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.24
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.24
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.22
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.11
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.06
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.03
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.02
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.01
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.96
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.96
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.94
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.9
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.89
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.89
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.79
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.77
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.76
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.76
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.66
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.51
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.49
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.43
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.31
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.09
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 97.86
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.79
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.75
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.49
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.1
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.1
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.0
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 96.98
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.58
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.56
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.48
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.46
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 95.99
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 94.94
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 94.67
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.64
4gt6_A394 Cell surface protein; leucine rich repeats, putati 94.54
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.29
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 86.33
2k1k_A38 Ephrin type-A receptor 1; EPHA1, receptor tyrosine 80.77
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.89  E-value=2e-23  Score=199.59  Aligned_cols=108  Identities=26%  Similarity=0.378  Sum_probs=78.4

Q ss_pred             CCCCEEeccCCccCCCcChhhhccccCcccc--CCCCCcccccccccC-------CCcccccceeeeeEEEeeccccccc
Q 048290           52 GFIQVLDLSLNIISGKIPKCFNNFSAMTYER--CSNPTIGFAKLIFVP-------AGTGYYYKYLVNLLLTWKGSENEYK  122 (253)
Q Consensus        52 ~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~--~n~~~~~~~~~ip~~-------~~l~~~~~~~~~~~~~l~g~~p~~~  122 (253)
                      ++|+.|||++|+++|.+|..++++++|+.|+  .|.+    .|.+|..       ..+++++|.       ++|.+|..+
T Consensus       632 ~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l----~g~ip~~l~~L~~L~~LdLs~N~-------l~g~ip~~l  700 (768)
T 3rgz_A          632 GSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDI----SGSIPDEVGDLRGLNILDLSSNK-------LDGRIPQAM  700 (768)
T ss_dssp             BCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCC----CSCCCGGGGGCTTCCEEECCSSC-------CEECCCGGG
T ss_pred             ccccEEECcCCcccccCCHHHhccccCCEEeCcCCcc----CCCCChHHhCCCCCCEEECCCCc-------ccCcCChHH
Confidence            4455566666666666666666666666666  3334    3345543       223445554       688899999


Q ss_pred             ccccceeeeccCC-----CCCCCCCCCCCCccccCCcCCCCCccCCCCCCCCCC
Q 048290          123 STLGLVRCLDLSR-----KIPLGTQLQSFNASVYAGNLELCGLPLANKCPDEES  171 (253)
Q Consensus       123 ~~l~~L~~LdLS~-----~iP~~~~l~~~~~~~~~gN~~LCg~~~~~~C~~~~~  171 (253)
                      +.++.|+.||||+     .||.+++|.+++..+|.|||+|||.|+. +|.....
T Consensus       701 ~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~~  753 (768)
T 3rgz_A          701 SALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPSNA  753 (768)
T ss_dssp             GGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSCC-
T ss_pred             hCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCCcc
Confidence            9999999999887     8999999999999999999999999987 8975543



>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 253
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 40.8 bits (94), Expect = 9e-05
 Identities = 20/69 (28%), Positives = 22/69 (31%), Gaps = 5/69 (7%)

Query: 1   NCSQLRVLDLGKNAFFGEIPTWTGESLQNLIVLSLKSNKFHGNIPYQLCHLGFIQVLDLS 60
           N   L  L L  N      P     SL  L  L   +NK        L +L  I  L   
Sbjct: 305 NLKNLTYLTLYFNNISDISPV---SSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAG 359

Query: 61  LNIISGKIP 69
            N IS   P
Sbjct: 360 HNQISDLTP 368


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query253
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.79
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.51
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.47
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.46
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.41
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.34
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.31
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.3
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.29
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.12
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.08
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.05
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.03
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.01
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.0
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.99
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.97
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.96
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.89
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.84
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.79
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.63
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.62
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.53
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.5
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.45
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.19
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.11
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.0
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.96
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.68
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.62
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.29
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.66
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.58
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.09
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.44
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.79  E-value=4.6e-20  Score=156.09  Aligned_cols=163  Identities=27%  Similarity=0.360  Sum_probs=103.1

Q ss_pred             CCcceEEECCC-CcCccCCChhHhhcCCCccEEEccCCcCcccCcccccCCCCCCEEeccCCccCCCcChhhhccccCcc
Q 048290            2 CSQLRVLDLGK-NAFFGEIPTWTGESLQNLIVLSLKSNKFHGNIPYQLCHLGFIQVLDLSLNIISGKIPKCFNNFSAMTY   80 (253)
Q Consensus         2 l~~L~~L~Ls~-N~l~g~~p~~~~~~l~~L~~L~L~~N~l~g~ip~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~   80 (253)
                      |++|++|||++ |+++|.+|.+++ ++++|++|+|++|++.+..|..+..+..|+.+++++|.+.+.+|..+.+++.++.
T Consensus        75 L~~L~~L~Ls~~N~l~g~iP~~i~-~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~  153 (313)
T d1ogqa_          75 LPYLNFLYIGGINNLVGPIPPAIA-KLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVG  153 (313)
T ss_dssp             CTTCSEEEEEEETTEESCCCGGGG-GCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCE
T ss_pred             Cccccccccccccccccccccccc-cccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccce
Confidence            56666777764 666666776666 6777777777776666666655666666666666666666666666666666666


Q ss_pred             cc--CCCCCccc---------------------cc-----------------------ccccC----CCc---cccccee
Q 048290           81 ER--CSNPTIGF---------------------AK-----------------------LIFVP----AGT---GYYYKYL  107 (253)
Q Consensus        81 L~--~n~~~~~~---------------------~~-----------------------~ip~~----~~l---~~~~~~~  107 (253)
                      ++  .|.+....                     .+                       .+|..    ..+   .+.++.+
T Consensus       154 l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l  233 (313)
T d1ogqa_         154 ITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSL  233 (313)
T ss_dssp             EECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEE
T ss_pred             eecccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            55  22221100                     00                       01100    000   0000000


Q ss_pred             e----------------eeEEEeecccccccccccceeeeccCC-----CCCCCCCCCCCCccccCCcCCCCCccCCCCC
Q 048290          108 V----------------NLLLTWKGSENEYKSTLGLVRCLDLSR-----KIPLGTQLQSFNASVYAGNLELCGLPLANKC  166 (253)
Q Consensus       108 ~----------------~~~~~l~g~~p~~~~~l~~L~~LdLS~-----~iP~~~~l~~~~~~~~~gN~~LCg~~~~~~C  166 (253)
                      .                -....++|.+|+.++.+++|+.||||+     .||....++.++...+.||+.+||.|++ .|
T Consensus       234 ~~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~plp-~c  312 (313)
T d1ogqa_         234 AFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP-AC  312 (313)
T ss_dssp             CCBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTTSS-CC
T ss_pred             cccccccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCccccCCCCC-CC
Confidence            0                000125889999999999999999998     7998888999999999999999999886 77



>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure