Citrus Sinensis ID: 048351


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850
MSSKWFILFQYRVLFSAIILLHLEPKTADSSSIRCIEEERKALLKFKQGLVDEFGFLSSWGSEGEKKDCCNWRGVRCSNQTGHVKVLDLHGTGRVKVLDIQTRVMSGNASLRGTLNPALLKLHYLRHLDLSFNNFSGSQIPMFIGSLSKLEYLDLFAASFSGPIPPLLGNLSRLQYLSLGYNKLLRAGNLDWISQLFSLRYLDLSSCNLSKSTDWLQEVDKIPSLKTLYLEQCDLQLQPTIHRSFSHLNSSPSLETLGLSYNNLTASIYPWLFNVSSIPDAPGPMISLRTLTLSDNELDGEIPKFFQNMFKLEGLSLRGNSLEGVISEHFFSNFSYLKMGPHFPKWLQTQKHFSVLDISSAGISDSIPDWFSDTSHKLADLNFSHNQMTGRFPNYISSMFILESPGIDISSNHLEGPSPSLPSNAFYIDLSKNKFSGPISFLCSFSGQNLVYLDLSSNLLSGKLPDCWLQFNMLRILNLANNNFSGKIPNSCGYLQKMLTLSLHHNNFSGELPSLLKNFTHLRVVALEENSISGNIPAWIGESLLNLVVLDLRSNRFYGKIPFQLCHLADIQILDLSLNNISGNIPKCFNNFTAMTQERSYNSSAITFSYAVPSRTTMLPVHIFFDIVLLTWKGSEYEYKNTLGLVKSVDLSSNKLGGEVPEEIMDLVGLIGLNLSRNNLTGYITPKIGQLQSLDFLDLSRNQFSGGIPSSLSQVNRLSVMDLSHNNLSGKIPTGTQLQSFNASVYDGNPELCGLPLPSKCWDEESAPGPAITKGRDDADTSEDEDQFITLGFFVTLILGFIVGFWGVCGTLLLNNSWKHCFYNFLTVTKDWLYVTAVVNIGKIQQKMRS
cccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccEEEccccccEEEEEccccccccccccHHHcccccccccEEccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEccccccccccccHHHHcccccccEEEccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEcccccccccccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccccEEEccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccHHHcccccccEEEccccccEEcccccccccccccEEEccccEEEEcccHHHHHcccccEEEcccccccccccHHHHHccccccEEEccccccEEcccccccccccccEEEcccccccccccHHcHHHHcccccccccccccEEEEEccccccccccEEEEEEEEEEEcccccEEcccccccEEEEcccccccccccHHHHccccccccccccccccccccHHHHccccccEEccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcEEEEEEEHHHHHHHHHHcc
cccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEcccccEEEEEEcccccccccccccEEEEcccccccccccHHHHccccccEEEccccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHcccccEEEEEccccccccccccHHHcccccccEEEccccccccccccccccHHHcccccccEEEcccccccccccHHHcccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHHHccccccccccccHHHccccccEEEEcccccccccccHHHHHHHHHccEEEcccccccccccHHHccccccEEEEEEcccccccccccccccccEEEEEccccccccccHHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHcHccccccEEEEEccccccccccHHHHcccccEEEEcccccccccccHHHHcccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEcccHHccHHHHHHccccccccccccccccHHHccccccEEEEcccccccccccHHHcccccEEEEEcccccccccccHHHHcHHHHEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccccccHHHccHHHcccccEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MSSKWFILFQYRVLFSAIILLhlepktadsssiRCIEEERKALLKFKQGLVDefgflsswgsegekkdccnwrgvrcsnqtghvkvldlhgtgrvkVLDIQTRVmsgnaslrgtlNPALLKLHYLRHLDlsfnnfsgsqipmfiGSLSKLEYLDLFaasfsgpippllgnlsrLQYLSLGYNKLLRAGNLDWISQLFSLRYldlsscnlskstdwlqevdkipslktLYLEQcdlqlqptihrsfshlnsspsletlglsynnltasiypwlfnvssipdapgpmislrtltlsdneldgeIPKFFQNMFKleglslrgnslegvisehffsnfsylkmgphfpkwlqtqkhfsvldissagisdsipdwfsdtshkladlnfshnqmtgrfpnyiSSMFilespgidissnhlegpspslpsnafyidlsknkfsgpisflcsfsgqnlvyLDLSsnllsgklpdcwlQFNMLRILNLANnnfsgkipnscgYLQKMLTLSlhhnnfsgelpSLLKNFTHLRVVALEensisgnipawIGESLLNLVVLDlrsnrfygkipfqlchladIQILDLslnnisgnipkcfnnftamtqersynssaitfsyavpsrttmlpvHIFFDIVLLTWKGSEYEYKNTLGLVksvdlssnklggevpEEIMDLVGLIGlnlsrnnltgyitpkigqlqsldfldlsrnqfsggipsslsQVNRLSVMDlshnnlsgkiptgtqlqsfnasvydgnpelcglplpskcwdeesapgpaitkgrddadtsededqFITLGFFVTLILGFIVGFWGVCGTLLLNNSWKHCFYNFLTVTKDWLYVTAVVNIGKIQQKMRS
MSSKWFILFQYRVLFSAIILLHLepktadsssiRCIEEERKALLKFKQGLVDEFGflsswgsegeKKDCCNWRGVRCSNQtghvkvldlhgtgrVKVLDIQTRVMSGNASLRGTLNPALLKLHYLRHLDLSFNNFSGSQIPMFIGSLSKLEYLDLFAASFSGPIPPLLGNLSRLQYLSLGYNKLLRAGNLDWISQLFSLRYLDLSSCNLSKSTDWLQEVDKIPSLKTLYLEQCDLQLQPTIHRSFSHLNSSPSLETLGLSYNNLTASIYPWLFNVSSIPDAPGPMISLRTLTLSDNELDGEIPKFFQNMFKLEGLSLRGNSLEGVISEHFFSNFSYLKMGPHFPKWLQTQKHFSVLDISSAGISDSIPDWFSDTSHKLADLNFSHNQMTGRFPNYISSMFILESPGIDISSNHLEGPSPSLPSNAFYIDLSKNKFSGPISFLCSFSGQNLVYLDLSSNLLSGKLPDCWLQFNMLRILNLANNNFSGKIPNSCGYLQKMLTLSLHHNNFSGELPSLLKNFTHLRVVALEENSISGNIPAWIGESLLNLVVLDLRSNRFYGKIPFQLCHLADIQILDLSLNNISGNIPKCFNNFTAMTQERSYNSSAITFSYAVPSRTTMLPVHIFFDIVLLTWKGSEYEYKNTLGLVKSVDLSSNKLGGEVPEEIMDLVGLIGLNLSRNNLTGYITPKIGQLQSLDFLDLSRNQFSGGIPSSLSQVNRLSVMDLSHNNLSGKIPTGTQLQSFNASVYDGNPELCGLPLPSKCWDEESAPGPAITKGRDDADTSEDEDQFITLGFFVTLILGFIVGFWGVCGTLLLNNSWKHCFYNFLTVTKDWLYVTAVVNIGkiqqkmrs
MSSKWFILFQYRVLFSAIILLHLEPKTADSSSIRCIEEERKALLKFKQGLVDEFGFLSSWGSEGEKKDCCNWRGVRCSNQTGHVKVLDLHGTGRVKVLDIQTRVMSGNASLRGTLNPAllklhylrhldlSFNNFSGSQIPMFIGSLSKLEYLDLFAASFSGPIPPLLGNLSRLQYLSLGYNKLLRAGNLDWISQLFSLRYLDLSSCNLSKSTDWLQEVDKIPSLKTLYLEQCDLQLQPTIHRSFSHLNSSPSLETLGLSYNNLTASIYPWLFNVSSIPDAPGPMISLRTLTLSDNELDGEIPKFFQNMFKLEGLSLRGNSLEGVISEHFFSNFSYLKMGPHFPKWLQTQKHFSVLDISSAGISDSIPDWFSDTSHKLADLNFSHNQMTGRFPNYISSMFILESPGIDISSNHLEGPSPSLPSNAFYIDLSKNKFSGPISFLCSFSGQNLVYLDLSSNLLSGKLPDCWLQFNMLRILNLANNNFSGKIPNSCGYLQKMLTLSLHHNNFSGELPSLLKNFTHLRVVALEENSISGNIPAWIGESLLNLVVLDLRSNRFYGKIPFQLCHLADIQILDLSLNNISGNIPKCFNNFTAMTQERSYNSSAITFSYAVPSRTTMLPVHIFFDIVLLTWKGSEYEYKNTLGLVKSVDLSSNKLGGEVPEEIMDLVGLIGLNLSRNNLTGYITPKIGQLQSLDFLDLSRNQFSGGIPSSLSQVNRLSVMDLSHNNLSGKIPTGTQLQSFNASVYDGNPELCGLPLPSKCWDEESAPGPAITKGRDDADTSEDEDQFITLGFFVTLILGFIVGFWGVCGTLLLNNSWKHCFYNFLTVTKDWLYVTAVVNIGKIQQKMRS
***KWFILFQYRVLFSAIILLHLEPKTADSSSIRCIEEERKALLKFKQGLVDEFGFLSSWGSEGEKKDCCNWRGVRCSNQTGHVKVLDLHGTGRVKVLDIQTRVMSGNASLRGTLNPALLKLHYLRHLDLSFNNFSGSQIPMFIGSLSKLEYLDLFAASFSGPIPPLLGNLSRLQYLSLGYNKLLRAGNLDWISQLFSLRYLDLSSCNLSKSTDWLQEVDKIPSLKTLYLEQCDLQLQPTIHRSFSHLNSSPSLETLGLSYNNLTASIYPWLFNVSSIPDAPGPMISLRTLTLSDNELDGEIPKFFQNMFKLEGLSLRGNSLEGVISEHFFSNFSYLKMGPHFPKWLQTQKHFSVLDISSAGISDSIPDWFSDTSHKLADLNFSHNQMTGRFPNYISSMFILESPGID****************AFYIDLSKNKFSGPISFLCSFSGQNLVYLDLSSNLLSGKLPDCWLQFNMLRILNLANNNFSGKIPNSCGYLQKMLTLSLHHNNFSGELPSLLKNFTHLRVVALEENSISGNIPAWIGESLLNLVVLDLRSNRFYGKIPFQLCHLADIQILDLSLNNISGNIPKCFNNFTAMTQERSYNSSAITFSYAVPSRTTMLPVHIFFDIVLLTWKGSEYEYKNTLGLVKSVDLSSNKLGGEVPEEIMDLVGLIGLNLSRNNLTGYITPKIGQLQSLDFLDLSRNQF*********************************LQSFNASVYDGNPELCGLPLPSKCW************************QFITLGFFVTLILGFIVGFWGVCGTLLLNNSWKHCFYNFLTVTKDWLYVTAVVNIGKI******
***KWFILFQYRVLFSAIILLHLEPKTADSSS**CIEEERKALLKFKQGLVDEFGFLSSWGSEGEKKDCCNWRGVRCSNQTGHVKVLDLHGTGRVKVLDIQTRVMSGNASLRGTLNPALLKLHYLRHLDLSFNNFSGSQIPMFIGSLSKLEYLDLFAASFSGPIPPLLGNLSRLQYLSLGYNKLLRAGNLDWISQLFSLRYLDLSSCNLSKSTDWLQEVDKIPSLKTLYLEQCDLQLQPTIHRSFSHLNSSPSLETLGLSYNNLTASIYPWLFNVSSIPDAPGPMISLRTLTLSDNELDGEIPKFFQNMFKLEGLSLRGNSLEGVISEHFFSNFSYLKMGPHFPKWLQTQKHFSVLDISSAGISDSIPDWFSDTSHKLADLNFSHNQMTGRFPNYISSMFILESPGIDISSNHLEGPSPSLPSNAFYIDLSKNKFSGPISFLCSFSGQNLVYLDLSSNLLSGKLPDCWLQFNMLRILNLANNNFSGKIPNSCGYLQKMLTLSLHHNNFSGELPSLLKNFTHLRVVALEENSISGNIPAWIGESLLNLVVLDLRSNRFYGKIPFQLCHLADIQILDLSLNNISGNIPKCFNNFTAMTQERS**SSAITFSYAVPSRTTMLPVHIFFDIVLLTWKGSEYEYKNTLGLVKSVDLSSNKLGGEVPEEIMDLVGLIGLNLSRNNLTGYITPKIGQLQSLDFLDLSRNQFSGGIPSSLSQVNRLSVMDLSHNNLSGKIPTGTQLQSFNASVYDGNPELCGLPLPS**************************DQFITLGFFVTLILGFIVGFWGVCGTLLLNNSWKHCFYNFLTVTKDWLYVTAVVNIGKIQQKM**
MSSKWFILFQYRVLFSAIILLHLEPKTADSSSIRCIEEERKALLKFKQGLVDEFGFLSSWGSEGEKKDCCNWRGVRCSNQTGHVKVLDLHGTGRVKVLDIQTRVMSGNASLRGTLNPALLKLHYLRHLDLSFNNFSGSQIPMFIGSLSKLEYLDLFAASFSGPIPPLLGNLSRLQYLSLGYNKLLRAGNLDWISQLFSLRYLDLSSCNLSKSTDWLQEVDKIPSLKTLYLEQCDLQLQPTIHRSFSHLNSSPSLETLGLSYNNLTASIYPWLFNVSSIPDAPGPMISLRTLTLSDNELDGEIPKFFQNMFKLEGLSLRGNSLEGVISEHFFSNFSYLKMGPHFPKWLQTQKHFSVLDISSAGISDSIPDWFSDTSHKLADLNFSHNQMTGRFPNYISSMFILESPGIDISSNHLEGPSPSLPSNAFYIDLSKNKFSGPISFLCSFSGQNLVYLDLSSNLLSGKLPDCWLQFNMLRILNLANNNFSGKIPNSCGYLQKMLTLSLHHNNFSGELPSLLKNFTHLRVVALEENSISGNIPAWIGESLLNLVVLDLRSNRFYGKIPFQLCHLADIQILDLSLNNISGNIPKCFNNFTAMTQERSYNSSAITFSYAVPSRTTMLPVHIFFDIVLLTWKGSEYEYKNTLGLVKSVDLSSNKLGGEVPEEIMDLVGLIGLNLSRNNLTGYITPKIGQLQSLDFLDLSRNQFSGGIPSSLSQVNRLSVMDLSHNNLSGKIPTGTQLQSFNASVYDGNPELCGLPLPSKCWDEE******************DEDQFITLGFFVTLILGFIVGFWGVCGTLLLNNSWKHCFYNFLTVTKDWLYVTAVVNIGKIQQKMRS
***KWFILFQYRVLFSAIILLHLEPKTADSSSIRCIEEERKALLKFKQGLVDEFGFLSSWGSEGEKKDCCNWRGVRCSNQTGHVKVLDLHGTGRVKVLDIQTRVMSGNASLRGTLNPALLKLHYLRHLDLSFNNFSGSQIPMFIGSLSKLEYLDLFAASFSGPIPPLLGNLSRLQYLSLGYNKLLRAGNLDWISQLFSLRYLDLSSCNLSKSTDWLQEVDKIPSLKTLYLEQCDLQLQPTIHRSFSHLNSSPSLETLGLSYNNLTASIYPWLFNVSSIPDAPGPMISLRTLTLSDNELDGEIPKFFQNMFKLEGLSLRGNSLEGVISEHFFSNFSYLKMGPHFPKWLQTQKHFSVLDISSAGISDSIPDWFSDTSHKLADLNFSHNQMTGRFPNYISSMFILESPGIDISSNHLEGPSPSLPSNAFYIDLSKNKFSGPISFLCSFSGQNLVYLDLSSNLLSGKLPDCWLQFNMLRILNLANNNFSGKIPNSCGYLQKMLTLSLHHNNFSGELPSLLKNFTHLRVVALEENSISGNIPAWIGESLLNLVVLDLRSNRFYGKIPFQLCHLADIQILDLSLNNISGNIPKCFNNFTAMTQERSYNSSAITFSYAVPSRTTMLPVHIFFDIVLLTWKGSEYEYKNTLGLVKSVDLSSNKLGGEVPEEIMDLVGLIGLNLSRNNLTGYITPKIGQLQSLDFLDLSRNQFSGGIPSSLSQVNRLSVMDLSHNNLSGKIPTGTQLQSFNASVYDGNPELCGLPLPSKC*******************TSEDEDQFITLGFFVTLILGFIVGFWGVCGTLLLNNSWKHCFYNFLTVTKDWLYVTAVVNIGKIQQKM**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSKWFILFQYRVLFSAIILLHLEPKTADSSSIRCIEEERKALLKFKQGLVDEFGFLSSWGSEGEKKDCCNWRGVRCSNQTGHVKVLDLHGTGRVKVLDIQTRVMSGNASLRGTLNPALLKLHYLRHLDLSFNNFSGSQIPMFIGSLSKLEYLDLFAASFSGPIPPLLGNLSRLQYLSLGYNKLLRAGNLDWISQLFSLRYLDLSSCNLSKSTDWLQEVDKIPSLKTLYLEQCDLQLQPTIHRSFSHLNSSPSLETLGLSYNNLTASIYPWLFNVSSIPDAPGPMISLRTLTLSDNELDGEIPKFFQNMFKLEGLSLRGNSLEGVISEHFFSNFSYLKMGPHFPKWLQTQKHFSVLDISSAGISDSIPDWFSDTSHKLADLNFSHNQMTGRFPNYISSMFILESPGIDISSNHLEGPSPSLPSNAFYIDLSKNKFSGPISFLCSFSGQNLVYLDLSSNLLSGKLPDCWLQFNMLRILNLANNNFSGKIPNSCGYLQKMLTLSLHHNNFSGELPSLLKNFTHLRVVALEENSISGNIPAWIGESLLNLVVLDLRSNRFYGKIPFQLCHLADIQILDLSLNNISGNIPKCFNNFTAMTQERSYNSSAITFSYAVPSRTTMLPVHIFFDIVLLTWKGSEYEYKNTLGLVKSVDLSSNKLGGEVPEEIMDLVGLIGLNLSRNNLTGYITPKIGQLQSLDFLDLSRNQFSGGIPSSLSQVNRLSVMDLSHNNLSGKIPTGTQLQSFNASVYDGNPELCGLPLPSKCWDEESAPGPAITKGRDDADTSEDEDQFITLGFFVTLILGFIVGFWGVCGTLLLNNSWKHCFYNFLTVTKDWLYVTAVVNIGKIQQKMRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query850 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.867 0.870 0.305 1e-73
Q9FL28 1173 LRR receptor-like serine/ no no 0.836 0.606 0.303 2e-60
Q9SHI2 1101 Leucine-rich repeat recep no no 0.862 0.665 0.292 8e-58
C0LGS2 1136 Probable LRR receptor-lik no no 0.787 0.588 0.287 5e-57
C0LGQ5 1249 LRR receptor-like serine/ no no 0.745 0.507 0.304 2e-55
Q9LVP0 1102 Probable leucine-rich rep no no 0.809 0.624 0.303 8e-55
Q9LYN8 1192 Leucine-rich repeat recep no no 0.758 0.541 0.298 1e-53
Q8VZG8 1045 Probable LRR receptor-lik no no 0.747 0.607 0.292 4e-53
O22476 1196 Protein BRASSINOSTEROID I no no 0.811 0.576 0.295 4e-53
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.744 0.505 0.296 4e-50
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  278 bits (712), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 266/872 (30%), Positives = 399/872 (45%), Gaps = 135/872 (15%)

Query: 8   LFQYRVLFSAIILLHLEPKTADSSSIRCIEEERKALLKFKQGLVDEFGFLSSW------- 60
           +F  R++    +L+H     A SS   C +++R ALL+F+     EF   +SW       
Sbjct: 10  VFSSRIIIFLSLLVH---SLASSSPHFCRDDQRDALLEFR----GEFPINASWHIMNQWR 62

Query: 61  GSEGEKKDCCNWRGVRCSNQTGHVKVLDLHGTGRVKVLDIQTRVMSGNASLRGTLNPALL 120
           G   +  DCC W GV C++++G V  LD+  T     L                 N +L 
Sbjct: 63  GPWNKSTDCCLWNGVTCNDKSGQVISLDIPNTFLNNYLKT---------------NSSLF 107

Query: 121 KLHYLRHLDLSFNNFSGSQIPMFIGSLSKLEYLDLFAASFSGPIPPLLGNLSRLQYLSLG 180
           KL YLRHLDL+  N  G +IP  +G+LS L  ++L+   F G IP  +GNL++L++L L 
Sbjct: 108 KLQYLRHLDLTNCNLYG-EIPSSLGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILA 166

Query: 181 YNKLLRAGNLDWISQLFSLRYLDLSSCNLSKSTDWLQEVDKIP-SLKTL-YLEQCDLQLQ 238
            N +L       +  L  L  L+L S  L         V KIP S+  L  L    L   
Sbjct: 167 -NNVLTGEIPSSLGNLSRLVNLELFSNRL---------VGKIPDSIGDLKQLRNLSLASN 216

Query: 239 PTIHRSFSHLNSSPSLETLGLSYNNLTASIYPWLFNVSSIPDAPGPMISLRTLTLSDNEL 298
             I    S L +  +L  L L++N L          V  +P + G +I LR ++  +N L
Sbjct: 217 NLIGEIPSSLGNLSNLVHLVLTHNQL----------VGEVPASIGNLIELRVMSFENNSL 266

Query: 299 DGEIPKFFQNMFKLEGLSLRGNSLEGVI--SEHFFSNFSYLKM------GPHFPK----- 345
            G IP  F N+ KL    L  N+           F N  Y  +      GP FPK     
Sbjct: 267 SGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGP-FPKSLLLI 325

Query: 346 ------WLQTQKHFSVLDISSAGISDSIPDWFSDTSH-------------KLADLNFSHN 386
                 +LQ  +    ++ ++   S  + D     +               L +L+ SHN
Sbjct: 326 PSLESIYLQENQFTGPIEFANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEELDISHN 385

Query: 387 QMTGRFPNYISSMFILESPGIDISSNHLEGPSPS---------LPSNAF----------- 426
             TG  P  IS +  L    +D+S N+LEG  P+         L  N+F           
Sbjct: 386 NFTGAIPPTISKLVNLLH--LDLSKNNLEGEVPACLWRLNTMVLSHNSFSSFENTSQEEA 443

Query: 427 ---YIDLSKNKFSGPISFL-CSFSGQNLVYLDLSSNLLSGKLPDCWLQFN-MLRILNLAN 481
               +DL+ N F GPI ++ C  S   L +LDLS+NL SG +P C   F+  ++ LNL +
Sbjct: 444 LIEELDLNSNSFQGPIPYMICKLSS--LGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGD 501

Query: 482 NNFSGKIPNSCGYLQKMLTLSLHHNNFSGELPSLLKNFTHLRVVALEENSISGNIPAWIG 541
           NNFSG +P+      ++++L + HN   G+ P  L N   L +V +E N I    P+W+ 
Sbjct: 502 NNFSGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWL- 560

Query: 542 ESLLNLVVLDLRSNRFYGKIPFQLCHLA--DIQILDLSLNNISGNIPKC-FNNFTAMTQE 598
           ESL +L VL+LRSN+FYG +  +   +    ++I+D+S NN SG +P   F+N+  MT  
Sbjct: 561 ESLPSLHVLNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTL 620

Query: 599 RSYNSSAIT--FSYAVPSRTTMLPVHIFFDIVLLTWKGSEYEYKNTLGLVKSVDLSSNKL 656
                  +T  + YA      M  V+          KG +  ++      +++D S NK+
Sbjct: 621 TEEMDQYMTEFWRYADSYYHEMEMVN----------KGVDMSFERIRRDFRAIDFSGNKI 670

Query: 657 GGEVPEEIMDLVGLIGLNLSRNNLTGYITPKIGQLQSLDFLDLSRNQFSGGIPSSLSQVN 716
            G +PE +  L  L  LNLS N  T  I   +  L  L+ LD+SRN+ SG IP  L+ ++
Sbjct: 671 NGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALS 730

Query: 717 RLSVMDLSHNNLSGKIPTGTQLQSFNASVYDGNPELCGLPLPSKCWDEESAPGPAITKGR 776
            LS M+ SHN L G +P GTQ Q    S +  NP L G  L   C D   A  P      
Sbjct: 731 FLSYMNFSHNLLQGPVPRGTQFQRQKCSSFLDNPGLYG--LEDICRD-TGALNPTSQLPE 787

Query: 777 DDADTSEDEDQFI--TLGFFVTLILGFIVGFW 806
           D ++  E+   ++   + +   ++ G ++G +
Sbjct: 788 DLSEAEENMFNWVAAAIAYGPGVLCGLVIGHF 819




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query850
359489995867 PREDICTED: probable LRR receptor-like se 0.9 0.882 0.454 0.0
224115848884 predicted protein [Populus trichocarpa] 0.918 0.883 0.423 1e-179
147811986 1085 hypothetical protein VITISV_012666 [Viti 0.904 0.708 0.456 1e-174
147834202 1270 hypothetical protein VITISV_011552 [Viti 0.882 0.590 0.426 1e-161
359477923 1022 PREDICTED: receptor-like protein 12-like 0.923 0.768 0.408 1e-157
224105895 963 predicted protein [Populus trichocarpa] 0.957 0.845 0.387 1e-156
225464712 1021 PREDICTED: receptor-like protein 12-like 0.803 0.668 0.461 1e-155
225466147 1024 PREDICTED: LRR receptor-like serine/thre 0.86 0.713 0.442 1e-155
359490576 972 PREDICTED: LRR receptor-like serine/thre 0.814 0.711 0.452 1e-154
225470187870 PREDICTED: receptor-like protein kinase 0.907 0.886 0.379 1e-154
>gi|359489995|ref|XP_003634011.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/903 (45%), Positives = 542/903 (60%), Gaps = 138/903 (15%)

Query: 13  VLFSAIILLHLEPKTADSSSIRCIEEERKALLKFKQGLVDEFGFLSSWGSEGEKKDCCNW 72
           +LFS ++L+ +  K    +++ C+E ER+ALL+FK GLVD++G LSSW    + +DCC W
Sbjct: 11  LLFSFLVLVVVCAKAGLGTTVGCVERERQALLRFKHGLVDDYGILSSW----DTRDCCQW 66

Query: 73  RGVRCSNQTGHVKVLDLHGTGRVKVLDIQTRVMSGNASLRGTLNPALLKLHYLRHLDLSF 132
           RGVRCSNQ+GH+ +L L         + +   +    SLRG ++P+LL+L +L HLDLS 
Sbjct: 67  RGVRCSNQSGHIVMLHLPAPPT----EFEDEYVHKFQSLRGEISPSLLELEHLTHLDLSC 122

Query: 133 NNFSGSQIPMFIGSLSKLEYLDLFAASFSG-------------------------PIPPL 167
           N+F  S IP F+ SLSK++YL+L  A+F+G                         PIPP 
Sbjct: 123 NDFERSHIPPFVASLSKIQYLNLSYANFTGRLPSQLGNLSNLLSLDLSSNDFEGRPIPPF 182

Query: 168 LGNLSRLQYLSLG------------------------YNKLLRAGNLDWISQLFSLRYLD 203
           L +L+++Q+LSL                         YN  L  GNL+W+S L SLR+LD
Sbjct: 183 LASLTKIQHLSLSYANFTGRLPSHFGNLSNLLSLDLSYNYDLNCGNLEWLSHLSSLRHLD 242

Query: 204 LSSCNLSKSTDWLQEVDKIPSLKTLYLEQCDLQLQPTIHRSFSHLNSSPSLETLGLSYNN 263
           L   NLSK+  +L      P L T                SFS +NSS  L  L LS N+
Sbjct: 243 LKYVNLSKAIHYL------PPLTT---------------PSFSPVNSSAPLAFLDLSDND 281

Query: 264 LTASIYPWLFNVS----------SIPDAPGPMISLRTLTLSDNELDGEIPKFFQNMFKLE 313
             +SIYPWLFN +          S PD  G   SL+ L L  N+++G +PK    + KLE
Sbjct: 282 YDSSIYPWLFNFTTTLTDNQFAGSFPDFIG-FSSLKELELDHNQINGTLPKSIGQLTKLE 340

Query: 314 GLSLRGNSLEGVISEH---FFSNFSYL-----------------------------KMGP 341
            L +  NSL+GVISE      S  SYL                             ++GP
Sbjct: 341 ALIIGSNSLQGVISEAHLLHLSRLSYLDLSSNSFNFNMSSEWVPPFQLIFLQLTSCQLGP 400

Query: 342 HFPKWLQTQKHFSVLDISSAGISDSIPDWFSDTSHKLADLNFSHNQMTGRFPNYISSMFI 401
            FP WL+TQK    LDIS++ ISD IP WF + +  +   N S+NQ+TG  PN +SS F 
Sbjct: 401 RFPSWLRTQKQLQSLDISTSDISDVIPHWFWNLTSLIYFFNISNNQITGTLPN-LSSKF- 458

Query: 402 LESP-GIDISSNHLEGPSPSLPSNAFYIDLSKNKFSGPISFLCSFSGQNLVYLDLSSNLL 460
            + P  ID+SSNHLEG  P LPS   ++DLS NKFSG I+ LC+ +   L YLDLS+NLL
Sbjct: 459 -DQPLYIDMSSNHLEGSIPQLPSGLSWLDLSNNKFSGSITLLCTVANSYLAYLDLSNNLL 517

Query: 461 SGKLPDCWLQFNMLRILNLANNNFSGKIPNSCGYLQKMLTLSLHHNNFSGELPSLLKNFT 520
           SG+LP+CW Q+  L +LNL NN FS KIP S G LQ + TL L + N  GELPS LK   
Sbjct: 518 SGELPNCWPQWKSLTVLNLENNQFSRKIPESFGSLQLIQTLHLRNKNLIGELPSSLKKCK 577

Query: 521 HLRVVALEENSISGNIPAWIGESLLNLVVLDLRSNRFYGKIPFQLCHLADIQILDLSLNN 580
            L  + L +N +SG IP WIG +L NL+VL+L+SN+F G I  ++C L  IQILDLS NN
Sbjct: 578 SLSFIDLAKNRLSGEIPPWIGGNLPNLMVLNLQSNKFSGSISPEVCQLKKIQILDLSDNN 637

Query: 581 ISGNIPKCFNNFTAMTQERSYNSSAITFSYAVPSRTTMLPVHIFFDIVLLTWKGSEYEYK 640
           +SG IP+C +NFTAMT++ S     IT+++++  +        + D   + WKG E+E+K
Sbjct: 638 MSGTIPRCLSNFTAMTKKESL---TITYNFSMSYQHWS-----YVDKEFVKWKGREFEFK 689

Query: 641 NTLGLVKSVDLSSNKLGGEVPEEIMDLVGLIGLNLSRNNLTGYITPKIGQLQSLDFLDLS 700
           NTLGLVKS+DLSSNKL GE+P+E+ DL+ L+ LN SRNNLTG I   IGQL+SLD LDLS
Sbjct: 690 NTLGLVKSIDLSSNKLTGEIPKEVTDLLELVSLNFSRNNLTGLIPITIGQLKSLDILDLS 749

Query: 701 RNQFSGGIPSSLSQVNRLSVMDLSHNNLSGKIPTGTQLQSFNASVYDGNPELCGLPLPSK 760
           +NQ  G IPSSLS+++RLS +DLS+NNLSG IP GTQLQSFN   Y+GNP LCG PL  K
Sbjct: 750 QNQLIGEIPSSLSEIDRLSTLDLSNNNLSGMIPQGTQLQSFNTFSYEGNPTLCGPPLLKK 809

Query: 761 CWDEESAPGPAITKGRDDADTSEDEDQFITLGFFVTLILGFIVGFWGVCGTLLLNNSWKH 820
           C  +++   P +    DD     ++     + F+V++ LGFIVGFWGVCGTLLLNNSW+H
Sbjct: 810 CPRDKAEGAPNVYSDEDDIQQDGND-----MWFYVSIALGFIVGFWGVCGTLLLNNSWRH 864

Query: 821 CFY 823
            ++
Sbjct: 865 AYF 867




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224115848|ref|XP_002332072.1| predicted protein [Populus trichocarpa] gi|222831958|gb|EEE70435.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147811986|emb|CAN77037.1| hypothetical protein VITISV_012666 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147834202|emb|CAN64227.1| hypothetical protein VITISV_011552 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359477923|ref|XP_002268448.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224105895|ref|XP_002333753.1| predicted protein [Populus trichocarpa] gi|222838401|gb|EEE76766.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225464712|ref|XP_002276171.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225466147|ref|XP_002270042.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490576|ref|XP_003634117.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225470187|ref|XP_002268274.1| PREDICTED: receptor-like protein kinase 5-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query850
TAIR|locus:2825384847 RLP12 "AT1G71400" [Arabidopsis 0.896 0.899 0.297 3.7e-71
TAIR|locus:2137296811 RLP46 "receptor like protein 4 0.864 0.906 0.302 2.6e-70
TAIR|locus:2119430741 RLP47 "receptor like protein 4 0.798 0.916 0.327 4.3e-70
TAIR|locus:2094603835 RLP37 "receptor like protein 3 0.892 0.908 0.299 2.4e-69
TAIR|locus:2046585808 RLP27 "receptor like protein 2 0.776 0.816 0.319 1.7e-68
TAIR|locus:2087253884 RLP39 "AT3G24900" [Arabidopsis 0.767 0.737 0.316 1.5e-67
TAIR|locus:2129246891 RLP50 "receptor like protein 5 0.744 0.710 0.320 6.5e-67
TAIR|locus:2046515864 RLP24 "receptor like protein 2 0.775 0.762 0.309 6.5e-67
TAIR|locus:2086974881 RLP41 "AT3G25010" [Arabidopsis 0.774 0.746 0.308 1.7e-66
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.864 0.735 0.291 2.5e-66
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 720 (258.5 bits), Expect = 3.7e-71, P = 3.7e-71
 Identities = 251/843 (29%), Positives = 396/843 (46%)

Query:     8 LFQYRVLFSAIILLHLEPKTADSSSIRCIEEERKALLKFKQGL-VD-EFGFLSSW-GSEG 64
             +F  R++    +L+H     A SS   C +++R ALL+F+    ++  +  ++ W G   
Sbjct:    10 VFSSRIIIFLSLLVH---SLASSSPHFCRDDQRDALLEFRGEFPINASWHIMNQWRGPWN 66

Query:    65 EKKDCCNWRGVRCSNQTGHVKVLDLHGTGRVKVLDIQTRVMS---------GNASLRGTL 115
             +  DCC W GV C++++G V  LD+  T     L   + +            N +L G +
Sbjct:    67 KSTDCCLWNGVTCNDKSGQVISLDIPNTFLNNYLKTNSSLFKLQYLRHLDLTNCNLYGEI 126

Query:   116 NPAXXXXXXXXXXXXSFNNFSGSQIPMFIGSLSKLEYLDLFAASFSGPIPPLLGNLSRLQ 175
               +             FN F G +IP  IG+L++L +L L     +G IP  LGNLSRL 
Sbjct:   127 PSSLGNLSHLTLVNLYFNKFVG-EIPASIGNLNQLRHLILANNVLTGEIPSSLGNLSRLV 185

Query:   176 YLSLGYNKLLRAGNL-DWISQLFSLRYLDLSSCNLSKSTDWLQEVDKIPSLKTLYLEQCD 234
              L L  N+L+  G + D I  L  LR L L+S NL         +  + +L  L L    
Sbjct:   186 NLELFSNRLV--GKIPDSIGDLKQLRNLSLASNNLIGEIP--SSLGNLSNLVHLVLTHNQ 241

Query:   235 L--QLQPTIH-----RSFSHLNSSPSLETLGLSYNNLTA-SIYPWLFN--VSSIPDAPGP 284
             L  ++  +I      R  S  N+S S   + +S+ NLT  SI+    N   S+ P     
Sbjct:   242 LVGEVPASIGNLIELRVMSFENNSLS-GNIPISFANLTKLSIFVLSSNNFTSTFPFDMSI 300

Query:   285 MISLRTLTLSDNELDGEIPKFFQNMFKLEGLSLRGNSLEGVISEHFFSNFSYLKM----- 339
               +L    +S N   G  PK    +  LE + L+ N   G I   F +  S  K+     
Sbjct:   301 FHNLEYFDVSYNSFSGPFPKSLLLIPSLESIYLQENQFTGPIE--FANTSSSTKLQDLIL 358

Query:   340 ------GPHFPKWLQTQKHFSVLDISSAGISDSIPDWFSDTSHKLADLNFSHNQMTGRFP 393
                   GP  P+ +    +   LDIS    + +IP   S   + L  L+ S N + G  P
Sbjct:   359 GRNRLHGP-IPESISRLLNLEELDISHNNFTGAIPPTISKLVN-LLHLDLSKNNLEGEVP 416

Query:   394 NYISSMFILESPGIDISSNHLEGPSPSLPSNAFY--IDLSKNKFSGPISFL-CSFSGQNL 450
                + ++ L +  + +S N       +    A    +DL+ N F GPI ++ C  S  +L
Sbjct:   417 ---ACLWRLNT--MVLSHNSFSSFENTSQEEALIEELDLNSNSFQGPIPYMICKLS--SL 469

Query:   451 VYLDLSSNLLSGKLPDCWLQFN-MLRILNLANNNFSGKIPNSCGYLQKMLTLSLHHNNFS 509
              +LDLS+NL SG +P C   F+  ++ LNL +NNFSG +P+      ++++L + HN   
Sbjct:   470 GFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKATELVSLDVSHNQLE 529

Query:   510 GELPSLLKNFTHLRVVALEENSISGNIPAWIGESLLNLVVLDLRSNRFYGKIPFQLCHLA 569
             G+ P  L N   L +V +E N I    P+W+ ESL +L VL+LRSN+FYG +  +   + 
Sbjct:   530 GKFPKSLINCKALELVNVESNKIKDIFPSWL-ESLPSLHVLNLRSNKFYGPLYHRHASIG 588

Query:   570 --DIQILDLSLNNISGNIPKC-FNNF---TAMTQERSYNSSAITFSYAVPSRTTMLPVHI 623
                ++I+D+S NN SG +P   F+N+   T +T+E     +   + YA            
Sbjct:   589 FQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTEF-WRYA----------DS 637

Query:   624 FFDIVLLTWKGSEYEYKNTLGLVKSVDLSSNKLGGEVPEEIMDLVGLIGLNLSRNNLTGY 683
             ++  + +  KG +  ++      +++D S NK+ G +PE +  L  L  LNLS N  T  
Sbjct:   638 YYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSV 697

Query:   684 ITPKIGQLQSLDFLDLSRNQFSGGIPSSLSQVNRLSVMDLSHNNLSGKIPTGTQLQSFNA 743
             I   +  L  L+ LD+SRN+ SG IP  L+ ++ LS M+ SHN L G +P GTQ Q    
Sbjct:   698 IPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKC 757

Query:   744 SVYDGNPELCGLPLPSKCWDEESAPGPAITKGRDDADTSEDEDQFIT--LGFFVTLILGF 801
             S +  NP L GL     C D   A  P      D ++  E+   ++   + +   ++ G 
Sbjct:   758 SSFLDNPGLYGLE--DICRDT-GALNPTSQLPEDLSEAEENMFNWVAAAIAYGPGVLCGL 814

Query:   802 IVG 804
             ++G
Sbjct:   815 VIG 817




GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC;RCA
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0048443 "stamen development" evidence=RCA
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119430 RLP47 "receptor like protein 47" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094603 RLP37 "receptor like protein 37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046585 RLP27 "receptor like protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087253 RLP39 "AT3G24900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046515 RLP24 "receptor like protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086974 RLP41 "AT3G25010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_scaffold_208000019
hypothetical protein (884 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query850
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-64
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-09
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 8e-08
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 6e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.004
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  233 bits (597), Expect = 1e-64
 Identities = 214/754 (28%), Positives = 309/754 (40%), Gaps = 210/754 (27%)

Query: 38  EERKALLKFKQGLVDEFGFLSSWGSEGEKKDCCNWRGVRCSNQTGHVKVLDLHG---TGR 94
           EE + LL FK  + D   +LS+W S     D C W+G+ C+N +  V  +DL G   +G+
Sbjct: 29  EELELLLSFKSSINDPLKYLSNWNSSA---DVCLWQGITCNNSS-RVVSIDLSGKNISGK 84

Query: 95  VKVLD-----IQTRVMSGNASLRGTLNPALLKLHY-LRHLDLSFNNFSGS---------- 138
           +         IQT  +S N  L G +   +      LR+L+LS NNF+GS          
Sbjct: 85  ISSAIFRLPYIQTINLSNNQ-LSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLE 143

Query: 139 -----------QIPMFIGSLSKLEYLDLFAASFSGPIPPLLGNLSRLQYLSLGYNKLLRA 187
                      +IP  IGS S L+ LDL      G IP  L NL+ L++L+L  N+L+  
Sbjct: 144 TLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLV-- 201

Query: 188 GNLDWISQLFSLRYLDLSSCNLSKSTDWLQEVDKIPSLKTLYLEQCDLQLQPTIHRSFSH 247
           G +                          +E+ ++ SLK +Y                  
Sbjct: 202 GQIP-------------------------RELGQMKSLKWIY------------------ 218

Query: 248 LNSSPSLETLGLSYNNLTASIYPWLFNVSSIPDAPGPMISLRTLTLSDNELDGEIPKFFQ 307
                      L YNNL+            IP   G + SL  L L  N L G IP    
Sbjct: 219 -----------LGYNNLSG----------EIPYEIGGLTSLNHLDLVYNNLTGPIPSSLG 257

Query: 308 NMFKLEGLSLRGNSLEGVISEHFFSNFSYLKMGPHFPKWLQTQKHFSVLDISSAGISDSI 367
           N+  L+ L L  N L G I    FS              LQ                   
Sbjct: 258 NLKNLQYLFLYQNKLSGPIPPSIFS--------------LQ------------------- 284

Query: 368 PDWFSDTSHKLADLNFSHNQMTGRFPNYISSMFILESPGIDISSNHLEGPSP----SLPS 423
                    KL  L+ S N ++G  P  +  +  LE   + + SN+  G  P    SLP 
Sbjct: 285 ---------KLISLDLSDNSLSGEIPELVIQLQNLEI--LHLFSNNFTGKIPVALTSLPR 333

Query: 424 NAFYIDLSKNKFSGPISFLCSFSGQNLVYLDLSSNLLSGKLPDCWLQFNMLRILNLANNN 483
               + L  NKFSG I         NL  LDLS+N L+G++P+       L  L L +N+
Sbjct: 334 LQV-LQLWSNKFSGEIPKNLG-KHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNS 391

Query: 484 FSGKIPNSCGYLQKMLTLSLHHNNFSGELPSLLKNFTHLRVVA---LEENSISGNIPAWI 540
             G+IP S G  + +  + L  N+FSGELPS    FT L +V    +  N++ G I +  
Sbjct: 392 LEGEIPKSLGACRSLRRVRLQDNSFSGELPS---EFTKLPLVYFLDISNNNLQGRINSRK 448

Query: 541 GESLLNLVVLDLRSNRFYGKIPFQLCHLADIQILDLSLNNISGNIPKCFNNFTAMTQERS 600
            + + +L +L L  N+F+G +P        ++ LDLS N  SG +P+   + + + Q   
Sbjct: 449 WD-MPSLQMLSLARNKFFGGLP-DSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQ--- 503

Query: 601 YNSSAITFSYAVPSRTTMLPVHIFFDIVLLTWKGSEYEYKNTLGLVKSVDLSSNKLGGEV 660
                                                           + LS NKL GE+
Sbjct: 504 ------------------------------------------------LKLSENKLSGEI 515

Query: 661 PEEIMDLVGLIGLNLSRNNLTGYITPKIGQLQSLDFLDLSRNQFSGGIPSSLSQVNRLSV 720
           P+E+     L+ L+LS N L+G I     ++  L  LDLS+NQ SG IP +L  V  L  
Sbjct: 516 PDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQ 575

Query: 721 MDLSHNNLSGKIPTGTQLQSFNASVYDGNPELCG 754
           +++SHN+L G +P+     + NAS   GN +LCG
Sbjct: 576 VNISHNHLHGSLPSTGAFLAINASAVAGNIDLCG 609


Length = 968

>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 850
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
PLN032101153 Resistant to P. syringae 6; Provisional 99.88
PLN032101153 Resistant to P. syringae 6; Provisional 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
KOG4237498 consensus Extracellular matrix protein slit, conta 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
PLN03150623 hypothetical protein; Provisional 99.59
PLN03150623 hypothetical protein; Provisional 99.53
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.34
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.3
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.25
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.23
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.06
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.02
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.01
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.93
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.91
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.84
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.8
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.76
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.73
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.5
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.43
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.34
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.32
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.31
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.31
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.3
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.17
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.08
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.96
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.82
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.75
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.75
PRK15386426 type III secretion protein GogB; Provisional 97.67
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.64
PRK15386426 type III secretion protein GogB; Provisional 97.63
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.62
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.6
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.54
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.49
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.29
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.04
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.95
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.72
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.43
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.14
KOG4341483 consensus F-box protein containing LRR [General fu 95.63
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.01
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.72
KOG4341483 consensus F-box protein containing LRR [General fu 93.92
KOG4308478 consensus LRR-containing protein [Function unknown 93.8
KOG4308478 consensus LRR-containing protein [Function unknown 93.44
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.75
KOG1947482 consensus Leucine rich repeat proteins, some prote 91.67
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 88.86
smart0037026 LRR Leucine-rich repeats, outliers. 87.98
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.98
KOG0473326 consensus Leucine-rich repeat protein [Function un 87.38
smart0037026 LRR Leucine-rich repeats, outliers. 86.53
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.53
KOG1947482 consensus Leucine rich repeat proteins, some prote 84.76
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.16
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 81.12
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.2e-72  Score=698.74  Aligned_cols=584  Identities=33%  Similarity=0.522  Sum_probs=507.4

Q ss_pred             cHHHHHHHHHhhhcCCCCCCCCCCCCCCCCCCCCccccceEecCCCCCEEEEEcCCCCCcccchhhhhccCCCCCCcccc
Q 048351           36 IEEERKALLKFKQGLVDEFGFLSSWGSEGEKKDCCNWRGVRCSNQTGHVKVLDLHGTGRVKVLDIQTRVMSGNASLRGTL  115 (850)
Q Consensus        36 ~~~~~~~Ll~~k~~~~~~~~~l~~W~~~~~~~~~c~w~gv~C~~~~~~v~~l~L~~~~~l~~l~l~~~~~~~~~~l~g~l  115 (850)
                      .++|++||++||+++.+|.+.+.+|.   .+.+||.|.||+|++ .++|+.++|++                 +.++|.+
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~---~~~~~c~w~gv~c~~-~~~v~~L~L~~-----------------~~i~~~~   85 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWN---SSADVCLWQGITCNN-SSRVVSIDLSG-----------------KNISGKI   85 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCC---CCCCCCcCcceecCC-CCcEEEEEecC-----------------CCccccC
Confidence            56899999999999988888889997   467899999999985 57999999998                 5788999


Q ss_pred             cccccCCCCCCEEeCCCCCCCCCCCCcccC-CCCCCCEEeCCCCCCCCCCCcccCCCCCCcEEEccCCCCCCCCCccccc
Q 048351          116 NPALLKLHYLRHLDLSFNNFSGSQIPMFIG-SLSKLEYLDLFAASFSGPIPPLLGNLSRLQYLSLGYNKLLRAGNLDWIS  194 (850)
Q Consensus       116 ~~~l~~l~~L~~L~Ls~n~l~~~~~p~~~~-~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~~~~~l~  194 (850)
                      ++++..+++|++|+|++|.+++. +|..+. .+++|++|+|++|.+++.+|.  +.+++|++|+|++|.+. ...+..++
T Consensus        86 ~~~~~~l~~L~~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~-~~~p~~~~  161 (968)
T PLN00113         86 SSAIFRLPYIQTINLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLS-GEIPNDIG  161 (968)
T ss_pred             ChHHhCCCCCCEEECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCccc-ccCChHHh
Confidence            99999999999999999999985 887655 899999999999999998885  56899999999999863 34455688


Q ss_pred             cCCCccEEeCCCCCCCCCcchhhhhcCCCCCcEEEccCCCCCCCCCccccccccCCCCcccEEEccCCCCCCccchhhhc
Q 048351          195 QLFSLRYLDLSSCNLSKSTDWLQEVDKIPSLKTLYLEQCDLQLQPTIHRSFSHLNSSPSLETLGLSYNNLTASIYPWLFN  274 (850)
Q Consensus       195 ~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~~~~L~~L~Ls~N~l~~~~~~~l~~  274 (850)
                      ++++|++|++++|.+.+.  +|..+.++++|++|++++|.+.+..|    ..+.++ ++|++|++++|++++.+      
T Consensus       162 ~l~~L~~L~L~~n~l~~~--~p~~~~~l~~L~~L~L~~n~l~~~~p----~~l~~l-~~L~~L~L~~n~l~~~~------  228 (968)
T PLN00113        162 SFSSLKVLDLGGNVLVGK--IPNSLTNLTSLEFLTLASNQLVGQIP----RELGQM-KSLKWIYLGYNNLSGEI------  228 (968)
T ss_pred             cCCCCCEEECccCccccc--CChhhhhCcCCCeeeccCCCCcCcCC----hHHcCc-CCccEEECcCCccCCcC------
Confidence            999999999999988774  56788889999999999999888776    566666 88999999999888764      


Q ss_pred             CCCCCCCCCCCCCCcEEEccCCcCCcccchhhhcCCCCcEEEccCCccccccccccccccccccCCCCCChhccCCCCCC
Q 048351          275 VSSIPDAPGPMISLRTLTLSDNELDGEIPKFFQNMFKLEGLSLRGNSLEGVISEHFFSNFSYLKMGPHFPKWLQTQKHFS  354 (850)
Q Consensus       275 l~~ip~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~~~~~~~~l~~~~l~~~~p~~l~~l~~L~  354 (850)
                          |..++.+++|++|++++|.+++.+|..++++++|++|++++|.+.+.+|                 ..+.++++|+
T Consensus       229 ----p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p-----------------~~l~~l~~L~  287 (968)
T PLN00113        229 ----PYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIP-----------------PSIFSLQKLI  287 (968)
T ss_pred             ----ChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCc-----------------hhHhhccCcC
Confidence                4446778889999999999988888889999999999999888876544                 3477788888


Q ss_pred             EEEccCCcCCCCCchhHhhcCcCCCEEecccCcCcccCChhhhhhccCCcCEEEccCCcCcccCCCCCCCCcEEEccCCc
Q 048351          355 VLDISSAGISDSIPDWFSDTSHKLADLNFSHNQMTGRFPNYISSMFILESPGIDISSNHLEGPSPSLPSNAFYIDLSKNK  434 (850)
Q Consensus       355 ~L~Ls~n~l~~~~~~~~~~~~~~L~~L~Ls~N~l~~~~p~~~~~~~~~~L~~L~l~~N~l~~~~~~~~~~L~~L~Ls~n~  434 (850)
                      .|++++|.+.+.+|..+... ++|++|++++|.+.+..|..+ ... ++|+.|++++|.+++.+|..+            
T Consensus       288 ~L~Ls~n~l~~~~p~~~~~l-~~L~~L~l~~n~~~~~~~~~~-~~l-~~L~~L~L~~n~l~~~~p~~l------------  352 (968)
T PLN00113        288 SLDLSDNSLSGEIPELVIQL-QNLEILHLFSNNFTGKIPVAL-TSL-PRLQVLQLWSNKFSGEIPKNL------------  352 (968)
T ss_pred             EEECcCCeeccCCChhHcCC-CCCcEEECCCCccCCcCChhH-hcC-CCCCEEECcCCCCcCcCChHH------------
Confidence            89998888888888877654 678888888888888877766 322 556666666665555444321            


Q ss_pred             CcCccccccccCCCCccEEEccCCCCCCCCCcccccCCCCCEEEcCCCcccccCCCccccccCccEEeccCCccccCCch
Q 048351          435 FSGPISFLCSFSGQNLVYLDLSSNLLSGKLPDCWLQFNMLRILNLANNNFSGKIPNSCGYLQKMLTLSLHHNNFSGELPS  514 (850)
Q Consensus       435 l~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~  514 (850)
                               . .+++|+.|++++|.+++.+|..+..+++|+.|++++|.+.+.+|..++.+++|+.|++++|++++.+|.
T Consensus       353 ---------~-~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~  422 (968)
T PLN00113        353 ---------G-KHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPS  422 (968)
T ss_pred             ---------h-CCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECCh
Confidence                     1 347899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcCCCCcCeeccccccceeecchhHHhcCCCCCEEEccCCccccccCcCcCCCCCcceeecccccCcccCCccccCccc
Q 048351          515 LLKNFTHLRVVALEENSISGNIPAWIGESLLNLVVLDLRSNRFYGKIPFQLCHLADIQILDLSLNNISGNIPKCFNNFTA  594 (850)
Q Consensus       515 ~l~~l~~L~~L~L~~N~l~~~ip~~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~  594 (850)
                      .+..+++|+.|++++|.+++.+|..+. .+++|++|++++|++.+.+|..+ ..++|+.|++++|++++.+|..+.+++.
T Consensus       423 ~~~~l~~L~~L~Ls~N~l~~~~~~~~~-~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~  500 (968)
T PLN00113        423 EFTKLPLVYFLDISNNNLQGRINSRKW-DMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSE  500 (968)
T ss_pred             hHhcCCCCCEEECcCCcccCccChhhc-cCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhc
Confidence            999999999999999999988888776 69999999999999999888765 4689999999999999998887766655


Q ss_pred             CccccccCccccccccccCCCcccCccceEeeEEEEEecCcccccccccccccEEEcCCCCCCCCChhhhhccccCCeEe
Q 048351          595 MTQERSYNSSAITFSYAVPSRTTMLPVHIFFDIVLLTWKGSEYEYKNTLGLVKSVDLSSNKLGGEVPEEIMDLVGLIGLN  674 (850)
Q Consensus       595 L~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~  674 (850)
                      |                                                   +.|+|++|++++.+|..++.+++|++|+
T Consensus       501 L---------------------------------------------------~~L~Ls~N~l~~~~p~~~~~l~~L~~L~  529 (968)
T PLN00113        501 L---------------------------------------------------MQLKLSENKLSGEIPDELSSCKKLVSLD  529 (968)
T ss_pred             c---------------------------------------------------CEEECcCCcceeeCChHHcCccCCCEEE
Confidence            5                                                   8899999999999999999999999999


Q ss_pred             cCCCcCccCCCccccccCCCCeeeCCCCcCcccCcccccCCCCCCEEEcCCCcCcccCCCCCcCCCcCccccCCCCCCCC
Q 048351          675 LSRNNLTGYITPKIGQLQSLDFLDLSRNQFSGGIPSSLSQVNRLSVMDLSHNNLSGKIPTGTQLQSFNASVYDGNPELCG  754 (850)
Q Consensus       675 Ls~N~l~~~ip~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~lc~  754 (850)
                      |++|.+++.+|..++.+++|+.|||++|+++|.+|..+..+++|++||+++|+++|.+|..+++.++...++.|||.+||
T Consensus       530 Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~  609 (968)
T PLN00113        530 LSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCG  609 (968)
T ss_pred             CCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             CC
Q 048351          755 LP  756 (850)
Q Consensus       755 ~~  756 (850)
                      .+
T Consensus       610 ~~  611 (968)
T PLN00113        610 GD  611 (968)
T ss_pred             Cc
Confidence            64



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query850
3rgx_A768 Structural Insight Into Brassinosteroid Perception 7e-54
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 9e-54
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-19
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 209 bits (531), Expect = 7e-54, Method: Compositional matrix adjust. Identities = 203/660 (30%), Positives = 301/660 (45%), Gaps = 87/660 (13%) Query: 147 LSKLEYLDLFAASFSGPIPP---LLGNLSRLQYLSLGYNKLLRAGNLDWISQLFSLRYLD 203 L+ LE LDL A S SG L L++L++ NK+ +G++D +S+ +L +LD Sbjct: 150 LNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKI--SGDVD-VSRCVNLEFLD 206 Query: 204 LSSCNLSKSTDWLQEVDKIPSLKTLYLEQCDLQLQPTIHRSFSHLNSSPSLETLGLSYNN 263 +SS N S +L + + +L+ +L R+ S + L+ L +S N Sbjct: 207 VSSNNFSTGIPFLGDCSALQ-----HLDISGNKLSGDFSRAIS---TCTELKLLNISSNQ 258 Query: 264 LTASIYPWLFNVSSIPDAPGPMISLRTLTLSDNELDGEIPKFFQNMFK-LEGLSLRGNSL 322 I P P+ SL+ L+L++N+ GEIP F L GL L GN Sbjct: 259 FVGPIPPL------------PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHF 306 Query: 323 EGVISEHF------------FSNFSYLKMGPHFPKWLQTQKHFSVLDISSAGISDSIPDW 370 G + F +NFS G L + VLD+S S +P+ Sbjct: 307 YGAVPPFFGSCSLLESLALSSNNFS----GELPMDTLLKMRGLKVLDLSFNEFSGELPES 362 Query: 371 FSDTSHKLADLNFSHNQMTGRFPNYISSMFILESPGIDISSNHLEGPSPSLPSNAFYIDL 430 ++ S L L+ S N +G I N + P +L + L Sbjct: 363 LTNLSASLLTLDLSSNNFSGP-----------------ILPNLCQNPKNTLQE----LYL 401 Query: 431 SKNKFSGPISFLCSFSGQNLVYLDLSSNLLSGKLPDCWLQFNMLRILNLANNNFSGKIPN 490 N F+G I S + LV L LS N LSG +P + LR L L N G+IP Sbjct: 402 QNNGFTGKIPPTLSNCSE-LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ 460 Query: 491 SCGYLQKMLTLSLHHNNFSGELPSLLKNFTHLRVVALEENSISGNIPAWIGESLLNLVVL 550 Y++ + TL L N+ +GE+PS L N T+L ++L N ++G IP WIG L NL +L Sbjct: 461 ELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGR-LENLAIL 519 Query: 551 DLRSNRFYGKIPFQLCHLADIQILDLSLNNISGNIP--------KCFNNFTA-------- 594 L +N F G IP +L + LDL+ N +G IP K NF A Sbjct: 520 KLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIK 579 Query: 595 ---MTQERSYNSSAITFSYAVPSRTTMLPVHIFFDIVLLTWKGSEYEYKNTLGLVKSVDL 651 M +E + + F + L +I + G + G + +D+ Sbjct: 580 NDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDM 639 Query: 652 SSNKLGGEVPEEIMDLVGLIGLNLSRNNLTGYITPKIGQLQSLDFLDLSRNQFSGGIPSS 711 S N L G +P+EI + L LNL N+++G I ++G L+ L+ LDLS N+ G IP + Sbjct: 640 SYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQA 699 Query: 712 LSQVNRLSVMDLSHNNLSGKIPTGTQLQSFNASVYDGNPELCGLPLPSKCWDEESAPGPA 771 +S + L+ +DLS+NNLSG IP Q ++F + + NP LCG PLP +C D +A G A Sbjct: 700 MSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RC-DPSNADGYA 757
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query850
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-180
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-82
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-70
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-46
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-39
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-37
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-71
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-57
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-41
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-31
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-68
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-49
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-42
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-35
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-26
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-66
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-46
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-40
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-40
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-15
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-58
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-53
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-33
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-57
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-53
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-39
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-57
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-52
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-49
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-36
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-22
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-45
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-37
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-28
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-38
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-30
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-09
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-19
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-18
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-19
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-19
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-10
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  537 bits (1385), Expect = e-180
 Identities = 214/814 (26%), Positives = 329/814 (40%), Gaps = 132/814 (16%)

Query: 30  SSSIRCIEEERKALLKFKQGLVDEFGFLSSWGSEGEKKDCCNWRGVRCSNQTGHVKVLDL 89
           +S  + +  E   L+ FK  L D+   L  W S    K+ C + GV C +    V  +DL
Sbjct: 4   ASPSQSLYREIHQLISFKDVLPDK-NLLPDWSSN---KNPCTFDGVTCRD--DKVTSIDL 57

Query: 90  HGTG----------------RVKVLDIQTRVMSG-----------------NASLRGTL- 115
                                ++ L +    ++G                   SL G + 
Sbjct: 58  SSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVT 117

Query: 116 -NPALLKLHYLRHLDLSFNNFSGSQIPMFIGSLSKLEYLDLFAASFSGPIPP---LLGNL 171
              +L     L+ L++S N             L+ LE LDL A S SG       L    
Sbjct: 118 TLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGC 177

Query: 172 SRLQYLSLGYNKLLRAGNLDWISQLFSLRYLDLSSCNLSKSTDWLQEVDKIPSLKTLYLE 231
             L++L++  NK+  +G++D +S+  +L +LD+SS N S           IP        
Sbjct: 178 GELKHLAISGNKI--SGDVD-VSRCVNLEFLDVSSNNFS---------TGIPF------- 218

Query: 232 QCDLQLQPTIHRSFSHLNSSPSLETLGLSYNNLTASIYPWLFNVSSIPDAPGPMISLRTL 291
                           L    +L+ L +S N L+      +               L+ L
Sbjct: 219 ----------------LGDCSALQHLDISGNKLSGDFSRAIST----------CTELKLL 252

Query: 292 TLSDNELDGEIPKFFQNMFKLEGLSLRGNSLEGVISEHFFSNFSYLKM---------GPH 342
            +S N+  G IP     +  L+ LSL  N   G I +        L           G  
Sbjct: 253 NISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGA- 309

Query: 343 FPKWLQTQKHFSVLDISSAGISDSIPDWFSDTSHKLADLNFSHNQMTGRFPNYISSMFI- 401
            P +  +      L +SS   S  +P         L  L+ S N+ +G  P  ++++   
Sbjct: 310 VPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 369

Query: 402 LESPGIDISSNHLEGPSPS-----LPSNAFYIDLSKNKFSGPI-SFLCSFSGQNLVYLDL 455
           L +  +D+SSN+  GP          +    + L  N F+G I   L + S   LV L L
Sbjct: 370 LLT--LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCS--ELVSLHL 425

Query: 456 SSNLLSGKLPDCWLQFNMLRILNLANNNFSGKIPNSCGYLQKMLTLSLHHNNFSGELPSL 515
           S N LSG +P      + LR L L  N   G+IP    Y++ + TL L  N+ +GE+PS 
Sbjct: 426 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSG 485

Query: 516 LKNFTHLRVVALEENSISGNIPAWIGESLLNLVVLDLRSNRFYGKIPFQLCHLADIQILD 575
           L N T+L  ++L  N ++G IP WIG  L NL +L L +N F G IP +L     +  LD
Sbjct: 486 LSNCTNLNWISLSNNRLTGEIPKWIG-RLENLAILKLSNNSFSGNIPAELGDCRSLIWLD 544

Query: 576 LSLNNISGNIPKCFNNFTAMT-------------------QERSYNSSAITFSYAVPSRT 616
           L+ N  +G IP      +                      +E     + + F      + 
Sbjct: 545 LNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQL 604

Query: 617 TMLPVHIFFDIVLLTWKGSEYEYKNTLGLVKSVDLSSNKLGGEVPEEIMDLVGLIGLNLS 676
             L      +I    + G      +  G +  +D+S N L G +P+EI  +  L  LNL 
Sbjct: 605 NRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLG 664

Query: 677 RNNLTGYITPKIGQLQSLDFLDLSRNQFSGGIPSSLSQVNRLSVMDLSHNNLSGKIPTGT 736
            N+++G I  ++G L+ L+ LDLS N+  G IP ++S +  L+ +DLS+NNLSG IP   
Sbjct: 665 HNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMG 724

Query: 737 QLQSFNASVYDGNPELCGLPLPSKCWDEESAPGP 770
           Q ++F  + +  NP LCG PLP            
Sbjct: 725 QFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAH 758


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query850
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.56
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.46
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.42
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.35
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.25
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.21
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.2
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.2
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.2
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.9
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.89
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.83
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.71
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.61
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.55
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.51
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.39
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.34
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.28
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.88
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.6
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.25
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.98
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.85
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.48
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.2e-87  Score=810.67  Aligned_cols=693  Identities=31%  Similarity=0.431  Sum_probs=452.9

Q ss_pred             CCCCcHHHHHHHHHhhhcCCCCCCCCCCCCCCCCCCCCccccceEecCCCCCEEEEEcCCCCCcccchhhhhccCCCCCC
Q 048351           32 SIRCIEEERKALLKFKQGLVDEFGFLSSWGSEGEKKDCCNWRGVRCSNQTGHVKVLDLHGTGRVKVLDIQTRVMSGNASL  111 (850)
Q Consensus        32 ~~~~~~~~~~~Ll~~k~~~~~~~~~l~~W~~~~~~~~~c~w~gv~C~~~~~~v~~l~L~~~~~l~~l~l~~~~~~~~~~l  111 (850)
                      +..+.++||+||++||+++.||. .+++|+   .+++||+|+||+|+  .++|++++|++.                 .+
T Consensus         6 ~~~~~~~~~~all~~k~~~~~~~-~l~~W~---~~~~~C~w~gv~C~--~~~v~~L~L~~~-----------------~l   62 (768)
T 3rgz_A            6 PSQSLYREIHQLISFKDVLPDKN-LLPDWS---SNKNPCTFDGVTCR--DDKVTSIDLSSK-----------------PL   62 (768)
T ss_dssp             --CCHHHHHHHHHHHHTTCSCTT-SSTTCC---TTSCGGGSTTEEEE--TTEEEEEECTTS-----------------CC
T ss_pred             cccCCHHHHHHHHHHHhhCCCcc-cccCCC---CCCCCcCCcceEEC--CCcEEEEECCCC-----------------Cc
Confidence            44568899999999999999988 899997   46899999999998  689999999984                 45


Q ss_pred             ccc---ccccccCCCCCCEEeCCCCCCCCCCCCcccCCCCCCCEEeCCCCCCCCCCCc--ccCCCCCCcEEEccCCCCCC
Q 048351          112 RGT---LNPALLKLHYLRHLDLSFNNFSGSQIPMFIGSLSKLEYLDLFAASFSGPIPP--LLGNLSRLQYLSLGYNKLLR  186 (850)
Q Consensus       112 ~g~---l~~~l~~l~~L~~L~Ls~n~l~~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~--~l~~l~~L~~L~Ls~N~l~~  186 (850)
                      .|.   +|+++.++++|+.++++.|.+.  .+|..++++++|++|+|++|.++|.+|.  .++++++|++|++++|.+..
T Consensus        63 ~g~~~~l~~~l~~L~~L~~l~~~~~~~~--~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~  140 (768)
T 3rgz_A           63 NVGFSAVSSSLLSLTGLESLFLSNSHIN--GSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDF  140 (768)
T ss_dssp             CEEHHHHHHHTTTCTTCCEEECTTSCEE--ECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEEC
T ss_pred             CCccCccChhHhccCcccccCCcCCCcC--CCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCC
Confidence            555   5555555555555555555543  2445555555555555555555555555  55555555555555555432


Q ss_pred             CCCccccccCCCccEEeCCCCCCCCCcchhhh---hcCCCCCcEEEccCCCCCCCCCccccccccCCCCcccEEEccCCC
Q 048351          187 AGNLDWISQLFSLRYLDLSSCNLSKSTDWLQE---VDKIPSLKTLYLEQCDLQLQPTIHRSFSHLNSSPSLETLGLSYNN  263 (850)
Q Consensus       187 ~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~---l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~~~~L~~L~Ls~N~  263 (850)
                      ......+.++++|++|++++|++++.  .+..   +.++++|++|++++|.+++..+      ...+ ++|++|++++|+
T Consensus       141 ~~~~~~~~~l~~L~~L~Ls~n~l~~~--~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~------~~~l-~~L~~L~Ls~n~  211 (768)
T 3rgz_A          141 PGKVSGGLKLNSLEVLDLSANSISGA--NVVGWVLSDGCGELKHLAISGNKISGDVD------VSRC-VNLEFLDVSSNN  211 (768)
T ss_dssp             CSSCCSCCCCTTCSEEECCSSCCEEE--THHHHHHTTCCTTCCEEECCSSEEESCCB------CTTC-TTCCEEECCSSC
T ss_pred             cCCHHHhccCCCCCEEECCCCccCCc--CChhhhhhccCCCCCEEECCCCcccccCC------cccC-CcCCEEECcCCc
Confidence            22222234555555555555555543  1222   4455555555555555544333      1222 455555555555


Q ss_pred             CCCccchhhhcCCC--------------CCCCCCCCCCCcEEEccCCcCCcccchhhhcCCCCcEEEccCCccccccccc
Q 048351          264 LTASIYPWLFNVSS--------------IPDAPGPMISLRTLTLSDNELDGEIPKFFQNMFKLEGLSLRGNSLEGVISEH  329 (850)
Q Consensus       264 l~~~~~~~l~~l~~--------------ip~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~~~~  329 (850)
                      +++.+|. +.+++.              +|..++.+++|++|++++|.+++.+|..  .+++|++|++++|.+++.+|..
T Consensus       212 l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~  288 (768)
T 3rgz_A          212 FSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDF  288 (768)
T ss_dssp             CCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCCC
T ss_pred             CCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCccCHH
Confidence            5443211 000000              1112334445555555555554444432  4455555555555555444443


Q ss_pred             ccc---cc-----ccccCCCCCChhccCCCCCCEEEccCCcCCCCCchhHhhcCcCCCEEecccCcCcccCChhhhhhcc
Q 048351          330 FFS---NF-----SYLKMGPHFPKWLQTQKHFSVLDISSAGISDSIPDWFSDTSHKLADLNFSHNQMTGRFPNYISSMFI  401 (850)
Q Consensus       330 ~~~---~l-----~~~~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~~L~~L~Ls~N~l~~~~p~~~~~~~~  401 (850)
                      ++.   ++     +.|++.+.+|..++.+++|++|++++|.+++.+|......+++|++|++++|.+++.+|..+ ....
T Consensus       289 ~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l-~~l~  367 (768)
T 3rgz_A          289 LSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL-TNLS  367 (768)
T ss_dssp             SCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTH-HHHT
T ss_pred             HHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHH-Hhhh
Confidence            321   11     34455556666666666666666666666666665522334566666666666666666665 2221


Q ss_pred             CCcCEEEccCCcCcccCCCC-----CCCCcEEEccCCcCcCccccccccCCCCccEEEccCCCCCCCCCcccccCCCCCE
Q 048351          402 LESPGIDISSNHLEGPSPSL-----PSNAFYIDLSKNKFSGPISFLCSFSGQNLVYLDLSSNLLSGKLPDCWLQFNMLRI  476 (850)
Q Consensus       402 ~~L~~L~l~~N~l~~~~~~~-----~~~L~~L~Ls~n~l~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~  476 (850)
                      .+++.|++++|.+++.+|..     +++|++|++++|.+++.++.... .+++|++|++++|.+++.+|..+..+++|++
T Consensus       368 ~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~-~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~  446 (768)
T 3rgz_A          368 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS-NCSELVSLHLSFNYLSGTIPSSLGSLSKLRD  446 (768)
T ss_dssp             TTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGG-GCTTCCEEECCSSEEESCCCGGGGGCTTCCE
T ss_pred             cCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHh-cCCCCCEEECcCCcccCcccHHHhcCCCCCE
Confidence            36666777777766655543     34577777777777766554332 4567777777777777777777777777777


Q ss_pred             EEcCCCcccccCCCccccccCccEEeccCCccccCCchhhcCCCCcCeeccccccceeecchhHHhcCCCCCEEEccCCc
Q 048351          477 LNLANNNFSGKIPNSCGYLQKMLTLSLHHNNFSGELPSLLKNFTHLRVVALEENSISGNIPAWIGESLLNLVVLDLRSNR  556 (850)
Q Consensus       477 L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~ip~~~~~~l~~L~~L~L~~N~  556 (850)
                      |++++|.+++.+|..+..+++|++|++++|++++.+|..+.++++|++|++++|++++.+|.++. .+++|++|++++|+
T Consensus       447 L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~-~l~~L~~L~L~~N~  525 (768)
T 3rgz_A          447 LKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIG-RLENLAILKLSNNS  525 (768)
T ss_dssp             EECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGG-GCTTCCEEECCSSC
T ss_pred             EECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHh-cCCCCCEEECCCCc
Confidence            77777777777777777777777777777777777777777777777777777777777777776 57777777777777


Q ss_pred             cccccCcCcCCCCCcceeecccccCcccCCccccCcccCccccccCcccc-------------------ccccccCCCcc
Q 048351          557 FYGKIPFQLCHLADIQILDLSLNNISGNIPKCFNNFTAMTQERSYNSSAI-------------------TFSYAVPSRTT  617 (850)
Q Consensus       557 l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~l~~~~~~~~-------------------~~~~~~~~~~~  617 (850)
                      +++.+|..++.+++|++|++++|+++|.+|..+.....+..+........                   .+.+..+....
T Consensus       526 l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  605 (768)
T 3rgz_A          526 FSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLN  605 (768)
T ss_dssp             CEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGG
T ss_pred             ccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhh
Confidence            77777777777777777777777777777777666554433221110000                   00000010000


Q ss_pred             cCccceEeeEEEEEecCcccccccccccccEEEcCCCCCCCCChhhhhccccCCeEecCCCcCccCCCccccccCCCCee
Q 048351          618 MLPVHIFFDIVLLTWKGSEYEYKNTLGLVKSVDLSSNKLGGEVPEEIMDLVGLIGLNLSRNNLTGYITPKIGQLQSLDFL  697 (850)
Q Consensus       618 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~l~~l~~L~~L  697 (850)
                      .++.....++....+.|..+..+..++.|+.|||++|+++|.+|.+++++++|+.|+|++|+++|.+|..++++++|++|
T Consensus       606 ~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~L  685 (768)
T 3rgz_A          606 RLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNIL  685 (768)
T ss_dssp             GGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEE
T ss_pred             ccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEE
Confidence            00000000000112345556667788999999999999999999999999999999999999999999999999999999


Q ss_pred             eCCCCcCcccCcccccCCCCCCEEEcCCCcCcccCCCCCcCCCcCccccCCCCCCCCCCCCCCCCCCC
Q 048351          698 DLSRNQFSGGIPSSLSQVNRLSVMDLSHNNLSGKIPTGTQLQSFNASVYDGNPELCGLPLPSKCWDEE  765 (850)
Q Consensus       698 ~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~lc~~~~~~~c~~~~  765 (850)
                      ||++|+++|.+|..++.+++|++||+|+|+++|.||.++++.+|...+|.|||++||.|+. .|....
T Consensus       686 dLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~  752 (768)
T 3rgz_A          686 DLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPSN  752 (768)
T ss_dssp             ECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSCC
T ss_pred             ECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCCc
Confidence            9999999999999999999999999999999999999999999999999999999999987 886443



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 850
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-11
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-10
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 7e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 89.8 bits (221), Expect = 4e-20
 Identities = 62/281 (22%), Positives = 102/281 (36%), Gaps = 6/281 (2%)

Query: 481 NNNFSGKIPNSCGYLQKMLTLSLHHNNFSG--ELPSLLKNFTHLRVVALEENSISGNIPA 538
           N  + G + ++     ++  L L   N      +PS L N  +L  + +   +       
Sbjct: 35  NRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIP 94

Query: 539 WIGESLLNLVVLDLRSNRFYGKIPFQLCHLADIQILDLSLNNISGNIPKCFNNFTAMTQE 598
                L  L  L +      G IP  L  +  +  LD S N +SG +P   ++   +   
Sbjct: 95  PAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGI 154

Query: 599 RSYNSSAITFSYAVPSRTTMLPVHIFFDIVLLTWKGSEYEYKNTLGLVKSVDLSSNKLGG 658
               +             + L   +      LT K              +    S  +  
Sbjct: 155 TFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN----LAFVDLSRNMLE 210

Query: 659 EVPEEIMDLVGLIGLNLSRNNLTGYITPKIGQLQSLDFLDLSRNQFSGGIPSSLSQVNRL 718
                +              N   +   K+G  ++L+ LDL  N+  G +P  L+Q+  L
Sbjct: 211 GDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFL 270

Query: 719 SVMDLSHNNLSGKIPTGTQLQSFNASVYDGNPELCGLPLPS 759
             +++S NNL G+IP G  LQ F+ S Y  N  LCG PLP+
Sbjct: 271 HSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLPA 311


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query850
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.81
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.5
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.21
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.2
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.3
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.24
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.7
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.34
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.07
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.68
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=3.5e-38  Score=335.90  Aligned_cols=293  Identities=28%  Similarity=0.408  Sum_probs=195.6

Q ss_pred             CCcHHHHHHHHHhhhcCCCCCCCCCCCCCCCCCCCCcc--ccceEecCCC--CCEEEEEcCCCCCcccchhhhhccCCCC
Q 048351           34 RCIEEERKALLKFKQGLVDEFGFLSSWGSEGEKKDCCN--WRGVRCSNQT--GHVKVLDLHGTGRVKVLDIQTRVMSGNA  109 (850)
Q Consensus        34 ~~~~~~~~~Ll~~k~~~~~~~~~l~~W~~~~~~~~~c~--w~gv~C~~~~--~~v~~l~L~~~~~l~~l~l~~~~~~~~~  109 (850)
                      -|.++||+||++||+++.+|. .+++|.   .++|||.  |+||+|++..  +||+.++|++                 +
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~---~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~-----------------~   60 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSG-----------------L   60 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEEC-----------------C
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-cCCCCC---CCCCCCCCcCCCeEEeCCCCcEEEEEEECCC-----------------C
Confidence            499999999999999998874 689997   5789994  9999998643  4899999998                 4


Q ss_pred             CCcc--cccccccCCCCCCEEeCCC-CCCCCCCCCcccCCCCCCCEEeCCCCCCCCCCCcccCCCCCCcEEEccCCCCCC
Q 048351          110 SLRG--TLNPALLKLHYLRHLDLSF-NNFSGSQIPMFIGSLSKLEYLDLFAASFSGPIPPLLGNLSRLQYLSLGYNKLLR  186 (850)
Q Consensus       110 ~l~g--~l~~~l~~l~~L~~L~Ls~-n~l~~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~  186 (850)
                      +++|  .+|+++++|++|++|||++ |+++|. +|..++++++|++|+|++|++.+..|..+..+.+|+++++++|.+. 
T Consensus        61 ~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~-  138 (313)
T d1ogqa_          61 NLPKPYPIPSSLANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALS-  138 (313)
T ss_dssp             CCSSCEECCGGGGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEE-
T ss_pred             CCCCCCCCChHHhcCccccccccccccccccc-cccccccccccchhhhccccccccccccccchhhhccccccccccc-
Confidence            6666  5789999999999999986 889885 9999999999999999999999988888889999999999988753 


Q ss_pred             CCCccccccCCCccEEeCCCCCCCCCcchhhhhcCCCCC-cEEEccCCCCCCCCCccccccccCCCCcccEEEccCCCCC
Q 048351          187 AGNLDWISQLFSLRYLDLSSCNLSKSTDWLQEVDKIPSL-KTLYLEQCDLQLQPTIHRSFSHLNSSPSLETLGLSYNNLT  265 (850)
Q Consensus       187 ~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L-~~L~L~~n~l~~~~~~~~~~~~~~~~~~L~~L~Ls~N~l~  265 (850)
                      ...+..+.++++|+++++++|.+++.  +|..+..+..+ +.+++++|++++..+    ..+...  ..           
T Consensus       139 ~~~p~~l~~l~~L~~l~l~~n~l~~~--ip~~~~~l~~l~~~l~~~~n~l~~~~~----~~~~~l--~~-----------  199 (313)
T d1ogqa_         139 GTLPPSISSLPNLVGITFDGNRISGA--IPDSYGSFSKLFTSMTISRNRLTGKIP----PTFANL--NL-----------  199 (313)
T ss_dssp             SCCCGGGGGCTTCCEEECCSSCCEEE--CCGGGGCCCTTCCEEECCSSEEEEECC----GGGGGC--CC-----------
T ss_pred             ccCchhhccCcccceeeccccccccc--ccccccccccccccccccccccccccc----cccccc--cc-----------
Confidence            33344566677777777777666543  34444444443 445555555544433    122221  22           


Q ss_pred             CccchhhhcCCCCCCCCCCCCCCcEEEccCCcCCcccchhhhcCCCCcEEEccCCccccccccccccccccccCCCCCCh
Q 048351          266 ASIYPWLFNVSSIPDAPGPMISLRTLTLSDNELDGEIPKFFQNMFKLEGLSLRGNSLEGVISEHFFSNFSYLKMGPHFPK  345 (850)
Q Consensus       266 ~~~~~~l~~l~~ip~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~~~~~~~~l~~~~l~~~~p~  345 (850)
                                             ..++++.+...+.+|..+..+++++.+++++|.+.+.++.                 
T Consensus       200 -----------------------~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~-----------------  239 (313)
T d1ogqa_         200 -----------------------AFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGK-----------------  239 (313)
T ss_dssp             -----------------------SEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGG-----------------
T ss_pred             -----------------------cccccccccccccccccccccccccccccccccccccccc-----------------
Confidence                                   2455555555555555555555555555555555443322                 


Q ss_pred             hccCCCCCCEEEccCCcCCCCCchhHhhcCcCCCEEecccCcCcccCChhhhhhccCCcCEEEccCCc
Q 048351          346 WLQTQKHFSVLDISSAGISDSIPDWFSDTSHKLADLNFSHNQMTGRFPNYISSMFILESPGIDISSNH  413 (850)
Q Consensus       346 ~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~~L~~L~Ls~N~l~~~~p~~~~~~~~~~L~~L~l~~N~  413 (850)
                       +..+++|+.|++++|+++|.+|.++... ++|++|+|++|+++|.+|..  +.. .+++.+++++|+
T Consensus       240 -~~~~~~L~~L~Ls~N~l~g~iP~~l~~L-~~L~~L~Ls~N~l~g~iP~~--~~L-~~L~~l~l~~N~  302 (313)
T d1ogqa_         240 -VGLSKNLNGLDLRNNRIYGTLPQGLTQL-KFLHSLNVSFNNLCGEIPQG--GNL-QRFDVSAYANNK  302 (313)
T ss_dssp             -CCCCTTCCEEECCSSCCEECCCGGGGGC-TTCCEEECCSSEEEEECCCS--TTG-GGSCGGGTCSSS
T ss_pred             -cccccccccccCccCeecccCChHHhCC-CCCCEEECcCCcccccCCCc--ccC-CCCCHHHhCCCc
Confidence             3444555555555555555555555443 45555555555555555532  111 455555566665



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure