Citrus Sinensis ID: 048376

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-
PWKLPLIGNLHQLAGSLPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEVMKTHDVVFASRPHFPPAQIISYNYRDIVFSPYGDSWKQLRKICVSELLSAKRVQSFQSIREKSKIYSLMYGITSRAAFGNRSRDQEAFASVRGEITKLMSGFNIADMFPSVGLLQWLTGYKSQVEKLHQEADRIVKNIINEHKKRKATLKICKIGDDEDLVDVLLKI
cccccccccccccccccHHHHHHHHHHHHcccEEEEcccccEEEEccHHHHHHHHHHcccccccccccccHHHHcccccccEEccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHcccc
cccccEEccHHHHcccccHHHHHHHHHHcccEEEEEcccEEEEEEccHHHHHHHHHHccHHHcccccHHHHHHHEcccccEEEccccHHHHHHHHHHHHHHHcHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHcc
pwklplignlhqlagslphhrlrdltnkygplmllqlgqvpaiiVSSPQVAKEVMKTHDvvfasrphfppaqiisynyrdivfspygdsWKQLRKICVSELLSAKRVQSFQSIREKSKIYSLMYGItsraafgnrsrdQEAFASVRGEITKLMsgfniadmfpsvglLQWLTGYKSQVEKLHQEADRIVKNIINEHKKRKATLkickigddeDLVDVLLKI
PWKLPLIGNLHQLAGSLPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEVMKTHDVVFASRPHFPPAQIISYNYRDIVFSPYGDSWKQLRKICVSELlsakrvqsfqsirekskiySLMYGITsraafgnrsrDQEAFASVRGEITKLMSGFNIADMFPSVGLLQWLTGYKSQVEKLHQEADRIVKNIinehkkrkatlkickigddedLVDVLLKI
PWKLPLIGNLHQLAGSLPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEVMKTHDVVFASRPHFPPAQIISYNYRDIVFSPYGDSWKQLRKICVSELLSAKRVQSFQSIREKSKIYSLMYGITSRAAFGNRSRDQEAFASVRGEITKLMSGFNIADMFPSVGLLQWLTGYKSQVEKLHQEADRIVKNIINEHKKRKATLKICKIGDDEDLVDVLLKI
***LPLIGNLHQLAGSLPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEVMKTHDVVFASRPHFPPAQIISYNYRDIVFSPYGDSWKQLRKICVSELLSAKRVQSFQSIREKSKIYSLMYGITSRAAFGNRS*DQEAFASVRGEITKLMSGFNIADMFPSVGLLQWLTGYKSQVEKLHQEADRIVKNIINEHKKRKATLKICKIGDDEDLVDVLL**
PWKLPLIGNLHQLAGSLPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEVMKTHDVVFASRPHFPPAQIISYNYRDIVFSPYGDSWKQLRKICVSELLSAKRVQSFQSIREKSKIYSLMYGITSRAAFGNRSRDQEAFASVRGEITKLMSGFNIADMFPSVGLLQWLTGYKSQVEKLHQEADRIVKNIIN******************DLVDVLLKI
PWKLPLIGNLHQLAGSLPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEVMKTHDVVFASRPHFPPAQIISYNYRDIVFSPYGDSWKQLRKICVSELLSAKRVQSFQSIREKSKIYSLMYGITSRAAFGNRSRDQEAFASVRGEITKLMSGFNIADMFPSVGLLQWLTGYKSQVEKLHQEADRIVKNIINEHKKRKATLKICKIGDDEDLVDVLLKI
PWKLPLIGNLHQLAGSLPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEVMKTHDVVFASRPHFPPAQIISYNYRDIVFSPYGDSWKQLRKICVSELLSAKRVQSFQSIREKSKIYSLMYGITSRAAFGNRSRDQEAFASVRGEITKLMSGFNIADMFPSVGLLQWLTGYKSQVEKLHQEADRIVKNIINEHKKRK***********EDLVDVLLKI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PWKLPLIGNLHQLAGSLPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEVMKTHDVVFASRPHFPPAQIISYNYRDIVFSPYGDSWKQLRKICVSELLSAKRVQSFQSIREKSKIYSLMYGITSRAAFGNRSRDQEAFASVRGEITKLMSGFNIADMFPSVGLLQWLTGYKSQVEKLHQEADRIVKNIINEHKKRKATLKICKIGDDEDLVDVLLKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query221 2.2.26 [Sep-21-2011]
O81971 496 Cytochrome P450 71D9 OS=G no no 0.990 0.441 0.506 1e-64
O22307 490 Cytochrome P450 71D11 (Fr N/A no 0.995 0.448 0.529 6e-61
A6YIH8 502 Premnaspirodiene oxygenas N/A no 1.0 0.440 0.468 2e-60
P93531 500 Cytochrome P450 71D7 OS=S N/A no 1.0 0.442 0.469 8e-59
O48923 510 Cytochrome P450 71D10 OS= no no 0.986 0.427 0.475 4e-57
P93530 501 Cytochrome P450 71D6 OS=S N/A no 0.981 0.433 0.463 7e-57
O81974 504 Cytochrome P450 71D8 OS=G no no 1.0 0.438 0.457 2e-55
Q94FM7 504 5-epiaristolochene 1,3-di N/A no 1.0 0.438 0.452 6e-55
P98183 495 Tabersonine 16-hydroxylas N/A no 1.0 0.446 0.452 2e-54
D5JBX1 496 Germacrene A oxidase OS=B N/A no 0.968 0.431 0.423 7e-54
>sp|O81971|C71D9_SOYBN Cytochrome P450 71D9 OS=Glycine max GN=CYP71D9 PE=2 SV=1 Back     alignment and function desciption
 Score =  245 bits (626), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 122/241 (50%), Positives = 169/241 (70%), Gaps = 22/241 (9%)

Query: 1   PWKLPLIGNLHQLAGS-LPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEVMKTHD 59
           PWKLP+IGN+H L GS LPHHRLRDL+ KYG LM L+LG+V  I+VSSP+ AKEVMKTHD
Sbjct: 39  PWKLPIIGNMHNLVGSPLPHHRLRDLSAKYGSLMHLKLGEVSTIVVSSPEYAKEVMKTHD 98

Query: 60  VVFASRPHFPPAQIISYNYRDIVFSPYGDSWKQLRKICVSELLSAKRVQSFQSIREK--- 116
            +FASRP+   A+I+ Y+++ + F+PYGD W+QLRKI   ELLS+KRVQSFQ IRE+   
Sbjct: 99  HIFASRPYVLAAEIMDYDFKGVAFTPYGDYWRQLRKIFALELLSSKRVQSFQPIREEVLT 158

Query: 117 -----------------SKIYSLMYGITSRAAFGNRSRDQEAFASVRGEITKLMSGFNIA 159
                             ++ S ++ IT+R A G++SR  +   SV  E  K+  GF++ 
Sbjct: 159 SFIKRMATIEGSQVNVTKEVISTVFTITARTALGSKSRHHQKLISVVTEAAKISGGFDLG 218

Query: 160 DMFPSVGLLQWLTGYKSQVEKLHQEADRIVKNIINEHKKRKATLKICKIGDDEDLVDVLL 219
           D++PSV  LQ ++G K ++EKLHQ+AD+I++NIINEH++ K++      G++E L+DVLL
Sbjct: 219 DLYPSVKFLQHMSGLKPKLEKLHQQADQIMQNIINEHREAKSS-ATGDQGEEEVLLDVLL 277

Query: 220 K 220
           K
Sbjct: 278 K 278

Glycine max (taxid: 3847)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 Back     alignment and function description
>sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 Back     alignment and function description
>sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 Back     alignment and function description
>sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 Back     alignment and function description
>sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1 Back     alignment and function description
>sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 Back     alignment and function description
>sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 Back     alignment and function description
>sp|P98183|C71DC_CATRO Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1 Back     alignment and function description
>sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query221
359494295 554 PREDICTED: LOW QUALITY PROTEIN: cytochro 1.0 0.398 0.551 2e-70
255563438 499 cytochrome P450, putative [Ricinus commu 1.0 0.442 0.535 2e-70
359494299 505 PREDICTED: premnaspirodiene oxygenase-li 1.0 0.437 0.526 5e-67
224106153284 cytochrome P450 [Populus trichocarpa] gi 1.0 0.778 0.522 1e-64
357494829 746 Cytochrome P450 [Medicago truncatula] gi 0.977 0.289 0.520 1e-63
357494831 502 Cytochrome P450 [Medicago truncatula] gi 0.977 0.430 0.520 3e-63
357494825 533 Cytochrome P450 [Medicago truncatula] gi 0.977 0.405 0.533 3e-63
356521096 510 PREDICTED: cytochrome P450 71D11-like [G 0.995 0.431 0.512 5e-63
356495436 506 PREDICTED: cytochrome P450 71D8-like [Gl 0.995 0.434 0.518 7e-63
5915838 496 RecName: Full=Cytochrome P450 71D9; AltN 0.990 0.441 0.506 8e-63
>gi|359494295|ref|XP_003634756.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 71D10-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 170/241 (70%), Gaps = 20/241 (8%)

Query: 1   PWKLPLIGNLHQLAGSLPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEVMKTHDV 60
           PWKLPLIGN+HQL GSLPHH L+ L +KYGP M L+LG+V A++VSSP++A+EVMKTHD 
Sbjct: 87  PWKLPLIGNMHQLVGSLPHHTLKRLASKYGPFMHLELGEVSALVVSSPEIAREVMKTHDT 146

Query: 61  VFASRPHFPPAQIISYNYRDIVFSPYGDSWKQLRKICVSELLSAKRVQSFQSIRE----- 115
           +FA RP    + II+YN   I FSPYGD W+QLRKIC  ELLSAKRV+SFQSIRE     
Sbjct: 147 IFAQRPPLLSSTIINYNATSISFSPYGDYWRQLRKICTIELLSAKRVKSFQSIREXEVSK 206

Query: 116 ---------------KSKIYSLMYGITSRAAFGNRSRDQEAFASVRGEITKLMSGFNIAD 160
                            KI+SL YGITSR+AFG + R Q+AF S   E  +L +GF +AD
Sbjct: 207 LIWSISLNAGSPINLSEKIFSLTYGITSRSAFGKKFRGQDAFVSAILEAVELSAGFCVAD 266

Query: 161 MFPSVGLLQWLTGYKSQVEKLHQEADRIVKNIINEHKKRKATLKICKIGDDEDLVDVLLK 220
           M+PS+  L +++G K ++EK+HQ+ DRI+ NII++H+KRK T K  +    EDLVDVLL 
Sbjct: 267 MYPSLKWLHYISGMKPKLEKVHQKIDRILNNIIDDHRKRKTTTKAGQPETQEDLVDVLLN 326

Query: 221 I 221
           +
Sbjct: 327 L 327

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255563438|ref|XP_002522721.1| cytochrome P450, putative [Ricinus communis] gi|223537959|gb|EEF39572.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359494299|ref|XP_002264079.2| PREDICTED: premnaspirodiene oxygenase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224106153|ref|XP_002333717.1| cytochrome P450 [Populus trichocarpa] gi|222838334|gb|EEE76699.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357494829|ref|XP_003617703.1| Cytochrome P450 [Medicago truncatula] gi|355519038|gb|AET00662.1| Cytochrome P450 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357494831|ref|XP_003617704.1| Cytochrome P450 [Medicago truncatula] gi|355519039|gb|AET00663.1| Cytochrome P450 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357494825|ref|XP_003617701.1| Cytochrome P450 [Medicago truncatula] gi|355519036|gb|AET00660.1| Cytochrome P450 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356521096|ref|XP_003529194.1| PREDICTED: cytochrome P450 71D11-like [Glycine max] Back     alignment and taxonomy information
>gi|356495436|ref|XP_003516583.1| PREDICTED: cytochrome P450 71D8-like [Glycine max] Back     alignment and taxonomy information
>gi|5915838|sp|O81971.1|C71D9_SOYBN RecName: Full=Cytochrome P450 71D9; AltName: Full=Cytochrome P450 CP3 gi|3334661|emb|CAA71514.1| putative cytochrome P450 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query221
TAIR|locus:2079251 500 CYP71B34 ""cytochrome P450, fa 0.565 0.25 0.527 2e-38
TAIR|locus:2149373 496 CYP71A15 ""cytochrome P450, fa 0.524 0.233 0.521 1e-37
TAIR|locus:2093536 504 CYP71B4 ""cytochrome P450, fam 0.520 0.228 0.508 1.6e-36
UNIPROTKB|Q0JF01 502 CYP99A3 "9-beta-pimara-7,15-di 0.601 0.264 0.459 5.4e-36
TAIR|locus:2079306 500 CYP71B35 ""cytochrome P450, fa 0.597 0.264 0.455 8e-36
TAIR|locus:2093531 501 CYP71B23 ""cytochrome P450, fa 0.520 0.229 0.534 1.2e-35
TAIR|locus:2031900 502 CYP71B2 ""cytochrome P450, fam 0.520 0.229 0.5 3.9e-34
TAIR|locus:2152701 497 CYP71A16 "cytochrome P450, fam 0.542 0.241 0.532 2.6e-33
TAIR|locus:2093516 502 CYP71B20 ""cytochrome P450, fa 0.520 0.229 0.491 5.7e-33
TAIR|locus:2102003 498 CYP71B5 "cytochrome p450 71b5" 0.515 0.228 0.513 1.4e-32
TAIR|locus:2079251 CYP71B34 ""cytochrome P450, family 71, subfamily B, polypeptide 34"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 338 (124.0 bits), Expect = 2.0e-38, Sum P(2) = 2.0e-38
 Identities = 67/127 (52%), Positives = 91/127 (71%)

Query:     5 PLIGNLHQLAGSLPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEVMKTHDVVFAS 64
             P+IGNLHQL G LPH  L  L+ KYGP+MLL+LG+VP +IVSS + AK+ +K HD+   S
Sbjct:    39 PIIGNLHQL-GELPHQSLWKLSKKYGPVMLLKLGRVPTVIVSSSETAKQALKIHDLHCCS 97

Query:    65 RPHFPPAQIISYNYRDIVFSPYGDSWKQLRKICVSELLSAKRVQSFQSIREKSKIYSLMY 124
             RP F  A+ +SYNY DI FSPY D WK++RK+ V EL S+K+V S Q I+++ ++  L+ 
Sbjct:    98 RPGFAGARELSYNYLDIAFSPYDDYWKEVRKLAVQELFSSKQVHSIQPIKDE-EVKKLID 156

Query:   125 GITSRAA 131
              I+  AA
Sbjct:   157 SISESAA 163
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2149373 CYP71A15 ""cytochrome P450, family 71, subfamily A, polypeptide 15"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093536 CYP71B4 ""cytochrome P450, family 71, subfamily B, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0JF01 CYP99A3 "9-beta-pimara-7,15-diene oxidase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2079306 CYP71B35 ""cytochrome P450, family 71, subfamily B, polypeptide 35"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093531 CYP71B23 ""cytochrome P450, family 71, subfamily B, polypeptide 23"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031900 CYP71B2 ""cytochrome P450, family 71, subfamily B, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152701 CYP71A16 "cytochrome P450, family 71, subfamily A, polypeptide 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093516 CYP71B20 ""cytochrome P450, family 71, subfamily B, polypeptide 20"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102003 CYP71B5 "cytochrome p450 71b5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00033335001
SubName- Full=Chromosome chr19 scaffold_66, whole genome shotgun sequence; (509 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query221
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 2e-42
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-41
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 3e-41
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 2e-31
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 1e-26
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 2e-22
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 2e-22
pfam00067 461 pfam00067, p450, Cytochrome P450 2e-18
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 2e-14
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 6e-13
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 6e-13
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 1e-12
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 3e-10
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information 
 Score =  149 bits (377), Expect = 2e-42
 Identities = 76/241 (31%), Positives = 130/241 (53%), Gaps = 24/241 (9%)

Query: 1   PWKLPLIGNLHQLAGSLPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEVMKTHDV 60
           P  LP+IGN+  +   L H  L +L  +YG L  +++G +  + VSSP+VA++V++  D 
Sbjct: 41  PKGLPIIGNML-MMDQLTHRGLANLAKQYGGLFHMRMGYLHMVAVSSPEVARQVLQVQDS 99

Query: 61  VFASRPHFPPAQIISYNYRDIVFSPYGDSWKQLRKICVSELLSAKRVQSFQSIREK---- 116
           VF++RP       ++Y+  D+ F+ YG  W+Q+RK+CV +L S KR +S+ S+R++    
Sbjct: 100 VFSNRPANIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWASVRDEVDSM 159

Query: 117 ---------------SKIYSLMYGITSRAAFGNRSRD-QEAFASVRGEITKLMSGFNIAD 160
                            I++L   IT RAAFG+ S + Q+ F  +  E +KL   FN+AD
Sbjct: 160 VRSVSSNIGKPVNIGELIFTLTRNITYRAAFGSSSNEGQDEFIKILQEFSKLFGAFNVAD 219

Query: 161 MFPSVGLLQWLTGYKSQVEKLHQEADRIVKNIINEHKKRKATLKICKIGD--DEDLVDVL 218
             P +G +    G   ++ K  +  D  + +II++H +++         +  + D+VD L
Sbjct: 220 FIPWLGWID-PQGLNKRLVKARKSLDGFIDDIIDDHIQKRKNQNADNDSEEAETDMVDDL 278

Query: 219 L 219
           L
Sbjct: 279 L 279

Length = 516
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 221
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN02971 543 tryptophan N-hydroxylase 99.97
PLN02655 466 ent-kaurene oxidase 99.97
PLN02687 517 flavonoid 3'-monooxygenase 99.96
PLN02183 516 ferulate 5-hydroxylase 99.96
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.96
PLN03234 499 cytochrome P450 83B1; Provisional 99.96
PLN03112 514 cytochrome P450 family protein; Provisional 99.95
PLN00168 519 Cytochrome P450; Provisional 99.95
PLN03018 534 homomethionine N-hydroxylase 99.95
PLN02290 516 cytokinin trans-hydroxylase 99.94
PLN02966 502 cytochrome P450 83A1 99.94
PTZ00404 482 cytochrome P450; Provisional 99.93
PLN02394 503 trans-cinnamate 4-monooxygenase 99.92
PLN02500 490 cytochrome P450 90B1 99.91
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.91
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.9
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.89
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.89
PLN02196 463 abscisic acid 8'-hydroxylase 99.88
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.88
PLN02936 489 epsilon-ring hydroxylase 99.87
PLN02302 490 ent-kaurenoic acid oxidase 99.86
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.85
PLN02774 463 brassinosteroid-6-oxidase 99.85
PLN02738 633 carotene beta-ring hydroxylase 99.85
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.83
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.76
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.63
PLN02648 480 allene oxide synthase 99.39
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.32
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 98.89
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.6e-41  Score=286.30  Aligned_cols=215  Identities=38%  Similarity=0.696  Sum_probs=181.0

Q ss_pred             CCCCcccccccccCCCCccHHHHHHHhhcCCceEEEcCCcCEEEeccHHHHHHHHHhCCCccCCCCC-CchhhhhhcCCC
Q 048376            1 PWKLPLIGNLHQLAGSLPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEVMKTHDVVFASRPH-FPPAQIISYNYR   79 (221)
Q Consensus         1 P~~~PiiGnl~~l~~~~~~~~~~~~~~~YG~i~~l~~g~~~~vvv~~~~~ike~l~~~~~~f~~Rp~-~~~~~~~~~~~~   79 (221)
                      |+|||||||++++....+|..|++|+++|||||++|+|++|+|||||+++|||+|++++..|++||. ......+++++.
T Consensus        31 P~~lPiIGnl~~l~~~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~~~~~~~~~~~  110 (489)
T KOG0156|consen   31 PPPLPIIGNLHQLGSLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTATLKYLSYGGK  110 (489)
T ss_pred             CCCCCccccHHHcCCCchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCchhhHHHhcCCCC
Confidence            6789999999999433489999999999999999999999999999999999999999999999997 334567776778


Q ss_pred             ceeeCCCChHHHHHHHHHHHhhcCHHHHHHhHHHHHH---------------------HHHHHHHHHHHHHHHhCCCCCC
Q 048376           80 DIVFSPYGDSWKQLRKICVSELLSAKRVQSFQSIREK---------------------SKIYSLMYGITSRAAFGNRSRD  138 (221)
Q Consensus        80 ~~~~~~~g~~Wk~~Rr~~~~~~~~~~~~~~~~~i~~~---------------------~~~~~~~~~vi~~~~fG~~~~~  138 (221)
                      ++++++||+.||++||+++..+++.+.++++..++.+                     ..+..+++|||++++||.++++
T Consensus       111 ~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~~~~~~~vdl~~~l~~~~~nvI~~~~fG~rf~~  190 (489)
T KOG0156|consen  111 GIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSKSKKGEPVDLSELLDLLVGNVICRMLFGRRFEE  190 (489)
T ss_pred             ceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHhcCCCceeeHHHHHHHHHHHHHHHHHhCCcccc
Confidence            9999999999999999999999998877766444322                     4778899999999999999986


Q ss_pred             h--h---HHHHHHHHHHHHcCCCccccccc-cccchhhhhchHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhccCCCCC
Q 048376          139 Q--E---AFASVRGEITKLMSGFNIADMFP-SVGLLQWLTGYKSQVEKLHQEADRIVKNIINEHKKRKATLKICKIGDDE  212 (221)
Q Consensus       139 ~--~---~~~~~~~~~~~~~~~~~~~~~~P-~l~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~  212 (221)
                      +  +   ++.+++.+.....+.+.+.+++| +++++++..+..++......++..++++.|++|+++. .   .+  +.+
T Consensus       191 ~~~~~~~~~~~l~~~~~~~~~~~~~~d~~p~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~i~eh~~~~-~---~~--~~~  264 (489)
T KOG0156|consen  191 EDEEEFLELKELVEESLELLGSFNLSDYFPFLLRWLDGISGLEKRLKKVSKRLDEFLERIIDEHREKI-G---DE--EGR  264 (489)
T ss_pred             CCchHHHHHHHHHHHHHHHhCCccHHHHhhHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHHHHhhh-c---cC--CCC
Confidence            3  2   36677888888888888899999 6776654556777787888889999999999999876 2   11  239


Q ss_pred             cHHHHhhcC
Q 048376          213 DLVDVLLKI  221 (221)
Q Consensus       213 d~ld~ll~~  221 (221)
                      ||+|+||++
T Consensus       265 D~vD~lL~~  273 (489)
T KOG0156|consen  265 DFVDALLKL  273 (489)
T ss_pred             cHHHHHHHh
Confidence            999999964

>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query221
3qz1_A 496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 2e-09
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 1e-07
3pm0_A 507 Structural Characterization Of The Complex Between 5e-07
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 1e-06
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 4e-06
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 4e-06
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 5e-06
3czh_A 481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 6e-06
2f9q_A 479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 7e-06
3qm4_A 479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 7e-06
3c6g_A 479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 7e-06
3e4e_A 476 Human Cytochrome P450 2e1 In Complex With The Inhib 3e-05
1dt6_A 473 Structure Of Mammalian Cytochrome P450 2c5 Length = 2e-04
2pg5_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-04
2pg7_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-04
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 2e-04
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 3e-04
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 3e-04
2hi4_A 495 Crystal Structure Of Human Microsomal P450 1a2 In C 4e-04
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 6e-04
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure 
Iteration: 1

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 103/254 (40%), Gaps = 50/254 (19%)
Query: 2   WKL------PLI-GNLHQLAGSLPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEV 54
           WKL      PL+ G LH L  +LP H L  LT K GP+  L+LG    ++++S +  +E 
Sbjct: 23  WKLRNLHLPPLVPGFLHLLQPNLPIHLL-SLTQKLGPVYRLRLGLQEVVVLNSKRTIEEA 81
Query: 55  MKTHDVVFASRPHFPPAQIISYNYRDIVFSPYGDSWKQLRKICVSELLSAK--------- 105
           M    V FA RP  P  +++S   +DI    Y   WK  +K+  S LL            
Sbjct: 82  MIRKWVDFAGRPQIPSYKLVSQRCQDISLGDYSLLWKAHKKLTRSALLLGTRSSMEPWVD 141
Query: 106 ----------RVQSFQSIREKSKIYSLMYGITSRAAFGNRSRDQ-EAFASVRGEITKLMS 154
                     RVQ+   +  + +   L   I     FGN+      AF     ++ K   
Sbjct: 142 QLTQEFCERMRVQAGAPVTIQKEFSLLTCSIICYLTFGNKEDTLVHAFHDCVQDLMKTWD 201
Query: 155 GFNIA--DM------FPSVGLLQWLTGYKSQVEKLHQEADRIVKNIINEHKKRKATLKIC 206
            ++I   DM      FP+ GL +     K  +E      D +V+  +  HK+        
Sbjct: 202 HWSIQILDMVPFLRFFPNPGLWR----LKQAIEN----RDHMVEKQLRRHKESMVA---- 249
Query: 207 KIGDDEDLVDVLLK 220
             G   D+ D +L+
Sbjct: 250 --GQWRDMTDYMLQ 261
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query221
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-55
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 3e-48
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 9e-44
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 6e-42
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 4e-38
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 8e-37
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 6e-34
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 7e-34
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 1e-33
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 1e-32
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-30
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 1e-29
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 2e-29
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 3e-29
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 4e-29
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 6e-23
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-22
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 7e-22
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 7e-20
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 6e-16
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 1e-15
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 1e-15
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-15
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 7e-14
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 2e-12
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 2e-06
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 2e-05
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 6e-04
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
 Score =  182 bits (464), Expect = 2e-55
 Identities = 34/260 (13%), Positives = 79/260 (30%), Gaps = 47/260 (18%)

Query: 1   PWKLPLIGNLHQLAG---SLPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEVMKT 57
           P     +   H          H        KYGP+   +LG V ++ V  P+    + K+
Sbjct: 14  PGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKS 73

Query: 58  HDVVFASRPHFP-PAQIISYNYRDIVFSPYGDSWKQLRKICVSELLSAKRVQSFQSIRE- 115
                      P  A    Y     V      +WK+ R     E+++ +  ++F  + + 
Sbjct: 74  EGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDA 133

Query: 116 -------------------------KSKIYSLMYGITSRAAFGNRSRDQEAFASVRGE-- 148
                                       ++   +   +   FG R    E   +   +  
Sbjct: 134 VSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRF 193

Query: 149 ---ITKLM-SGFNIADMFPSVG---LLQWLTGYKSQVEKLHQEADRIVKNIINEHKKRKA 201
              I ++  +   + ++ P +      +    + +  + +  +AD   +N   E +++ +
Sbjct: 194 IDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGS 253

Query: 202 TLKICKIGDDEDLVDVLLKI 221
                      D   +L ++
Sbjct: 254 --------VHHDYRGILYRL 265
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query221
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.96
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.95
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.95
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.95
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.94
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.94
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.94
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.94
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.94
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.93
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.93
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.93
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.93
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.92
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.9
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.89
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.89
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.89
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.87
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.85
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.85
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.83
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.82
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.81
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.81
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.8
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.8
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.77
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.76
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.75
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.73
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.73
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.72
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.72
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.72
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.72
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.7
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.7
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.69
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.69
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.68
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.67
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.66
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.66
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.66
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.65
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.65
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.65
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.65
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.65
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.64
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.64
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.63
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.63
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.61
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.6
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.59
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.59
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.58
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.58
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.58
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.55
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.52
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.52
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.48
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.48
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 99.44
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.43
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.4
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.37
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.36
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.31
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 99.26
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 98.82
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 98.39
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 96.47
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 92.94
2krb_A81 Eukaryotic translation initiation factor 3 subunit 90.94
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 88.66
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 87.84
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 87.59
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 85.08
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 85.07
2cph_A107 RNA binding motif protein 19; RNA recognition moti 84.73
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 84.28
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 83.36
1x5p_A97 Negative elongation factor E; structure genomics, 82.61
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 82.52
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 81.95
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 81.84
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 81.17
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 81.0
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 80.33
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 80.16
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 80.06
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
Probab=100.00  E-value=9.8e-32  Score=228.54  Aligned_cols=211  Identities=20%  Similarity=0.369  Sum_probs=157.2

Q ss_pred             CCCCcccccccccCCC-CccHHHHHHHhhcCCceEEEcCCcCEEEeccHHHHHHHHHhCCCccCCCCCCchhhhhhcCCC
Q 048376            1 PWKLPLIGNLHQLAGS-LPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEVMKTHDVVFASRPHFPPAQIISYNYR   79 (221)
Q Consensus         1 P~~~PiiGnl~~l~~~-~~~~~~~~~~~~YG~i~~l~~g~~~~vvv~~~~~ike~l~~~~~~f~~Rp~~~~~~~~~~~~~   79 (221)
                      |+++|+|||++++... .++..+.+|+++||+||++++|++++|||+||++|+|+|++++..|++||.......+..++.
T Consensus        13 P~~lPliGnl~~l~~~~~~~~~~~~~~~kYG~i~~~~~g~~~~vvv~~p~~~k~il~~~~~~f~~rp~~~~~~~~~~~~~   92 (494)
T 3swz_A           13 LLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRK   92 (494)
T ss_dssp             CBCCCEEEEESSCTTSSCHHHHHHHTHHHHCSEEEEEETTEEEEEECSHHHHHHHHTTTTTTTBBCCCCHHHHHHTTTTC
T ss_pred             CCCCCeEcchHHhCCCCchhHHHHHHHHHcCCEEEEEeCCCCEEEECCHHHHHHHHHhCcHhhCCCCCcHHHHHhccCCC
Confidence            4559999999998543 568899999999999999999999999999999999999999999999998766655554456


Q ss_pred             ceeeCCCChHHHHHHHHHHHhhcCH--HHHHHhHHHHHH--------------------HHHHHHHHHHHHHHHhCCCCC
Q 048376           80 DIVFSPYGDSWKQLRKICVSELLSA--KRVQSFQSIREK--------------------SKIYSLMYGITSRAAFGNRSR  137 (221)
Q Consensus        80 ~~~~~~~g~~Wk~~Rr~~~~~~~~~--~~~~~~~~i~~~--------------------~~~~~~~~~vi~~~~fG~~~~  137 (221)
                      +++++++|+.||.+||++.+ .|+.  ..+..+..++.+                    ..+..++++||+.++||.+++
T Consensus        93 gl~~~~~g~~wr~~Rr~~~~-~f~~~~~~~~~~~~~i~~~~~~l~~~l~~~~~~~vd~~~~~~~~t~dvi~~~~fG~~~~  171 (494)
T 3swz_A           93 GIAFADSGAHWQLHRRLAMA-TFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYK  171 (494)
T ss_dssp             SSSSSCSSHHHHHHHHHHHH-HTTTTSSSTTCHHHHHHHHHHHHHHHHHHTTTEEECCHHHHHHHHHHHHHHHHHSCCCC
T ss_pred             CeEeCCCCHHHHHHHHHHHH-HHHHhcchHHHHHHHHHHHHHHHHHHHHHcCCCcccHHHHHHHHHHHHHHHHHcCCcCC
Confidence            77778789999999999754 4431  112222222211                    578889999999999999987


Q ss_pred             ChhHH----HHHHHHHHHHcCCCccccccccccchhhhhchHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhccCCCCCc
Q 048376          138 DQEAF----ASVRGEITKLMSGFNIADMFPSVGLLQWLTGYKSQVEKLHQEADRIVKNIINEHKKRKATLKICKIGDDED  213 (221)
Q Consensus       138 ~~~~~----~~~~~~~~~~~~~~~~~~~~P~l~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~d  213 (221)
                      .++..    ....+.+........+.+++|++++++  ....+++.+..+.+.++++++++++++..+.   +   .++|
T Consensus       172 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~l~~~p--~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~---~---~~~d  243 (494)
T 3swz_A          172 NGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFP--NKTLEKLKSHVKIRNDLLNKILENYKEKFRS---D---SITN  243 (494)
T ss_dssp             TTCTHHHHHHHHHHHHHHHHCSSSSCCSSCGGGTSC--CSHHHHHHHHHHHHHHHHHHHHHHHTTTCCT---T---CCCS
T ss_pred             CCCHHHHHHHHHHHHHHHhcccchHHHHHHHHHHcC--cHHHHHHHHHHHHHHHHHHHHHHHHHHhhcc---c---chhH
Confidence            54422    222333334444456678899988652  2334566677788888999999888776543   2   4689


Q ss_pred             HHHHhhc
Q 048376          214 LVDVLLK  220 (221)
Q Consensus       214 ~ld~ll~  220 (221)
                      |+|.||+
T Consensus       244 ~l~~ll~  250 (494)
T 3swz_A          244 MLDTLMQ  250 (494)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
Confidence            9999874
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 221
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 1e-31
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 3e-31
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 6e-29
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 9e-24
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-22
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 6e-21
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 2e-15
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 2e-14
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 3e-14
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score =  118 bits (295), Expect = 1e-31
 Identities = 41/239 (17%), Positives = 75/239 (31%), Gaps = 27/239 (11%)

Query: 1   PWKLPLIGNLHQLAGSLPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEVMKTHDV 60
           P  LP++GNL Q+           L  KYG +  + LG  P +++      +E +     
Sbjct: 7   PSPLPVLGNLLQMDRKGLLRSFLRLREKYGDVFTVYLGSRPVVVLCGTDAIREALVDQAE 66

Query: 61  VFASRPHFPPAQIISYNYRDIVFSPYGDSWKQLRKICVSELLSAKRVQSF---------- 110
            F+ R        I   Y   V    G+ W+ LR+  ++ +      +            
Sbjct: 67  AFSGRGKIAVVDPIFQGYG--VIFANGERWRALRRFSLATMRDFGMGKRSVEERIQEEAR 124

Query: 111 -----------QSIREKSKIYSLMYGITSRAAFGNRSRDQ----EAFASVRGEITKLMSG 155
                        +      +S+   I     FG R   +         +  +   L+S 
Sbjct: 125 CLVEELRKSKGALLDNTLLFHSITSNIICSIVFGKRFDYKDPVFLRLLDLFFQSFSLISS 184

Query: 156 FNIADMFPSVGLLQWLTGYKSQVEKLHQEADRIVKNIINEHKKRKATLKICKIGDDEDL 214
           F+        G L+   G   Q+ +  QE +  +   + +H+            D   L
Sbjct: 185 FSSQVFELFSGFLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDPSNPRDFIDVYLL 243
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query221
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.94
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.92
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.91
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.91
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.91
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.9
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.75
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.68
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.41
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.33
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.32
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.19
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.16
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.03
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 98.96
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 98.84
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 98.81
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 98.64
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 98.31
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 97.72
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 97.71
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 91.08
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 90.74
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 90.74
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 90.62
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 89.62
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 88.8
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 88.45
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 88.17
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 88.12
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 87.9
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 87.83
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 87.15
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 87.14
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 86.37
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 86.07
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 85.89
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 85.66
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 85.53
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 85.15
d2cpja186 Non-POU domain-containing octamer-binding protein, 84.77
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 84.41
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 84.39
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 84.17
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 83.26
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 83.06
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 82.66
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 82.61
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 82.01
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 81.98
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 81.87
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 81.42
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 81.34
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 81.31
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 81.27
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 80.92
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 80.47
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 80.42
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 80.28
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome P450 bm-3
species: Bacillus megaterium [TaxId: 1404]

Probab=99.94  E-value=9.7e-26  Score=187.49  Aligned_cols=204  Identities=15%  Similarity=0.199  Sum_probs=142.9

Q ss_pred             CCCCcccccccccCCCCccHHHHHHHhhcCCceEEEcCCcCEEEeccHHHHHHHHHhCCCccCCCCCCchhhhhhcCCCc
Q 048376            1 PWKLPLIGNLHQLAGSLPHHRLRDLTNKYGPLMLLQLGQVPAIIVSSPQVAKEVMKTHDVVFASRPHFPPAQIISYNYRD   80 (221)
Q Consensus         1 P~~~PiiGnl~~l~~~~~~~~~~~~~~~YG~i~~l~~g~~~~vvv~~~~~ike~l~~~~~~f~~Rp~~~~~~~~~~~~~~   80 (221)
                      |+++|+|||++++..++++..+.+|.++|||||++++|+.++|||+||++|+|+++++...+..++.......+.  |.+
T Consensus         6 P~~~p~lG~l~~l~~~~~~~~~~~~~~kyG~if~~~~~~~~~vvl~~~~~i~~v~~~~~~~~~~~~~~~~~~~~~--g~~   83 (453)
T d2ij2a1           6 PKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFA--GDG   83 (453)
T ss_dssp             CCCCGGGTTGGGGCSSCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHTCTTTEEECCCHHHHHHHHHH--TTS
T ss_pred             CCCcchhhCHHHhCCCCHHHHHHHHHHHhCCEEEEEeCCceEEEECCHHHHHHHHhcCCcccccccHhHHHHHhc--CCc
Confidence            778999999999966678899999999999999999999999999999999999988877776665332333332  345


Q ss_pred             eee-CCCChHHHHHHHHHHHhhcCHHHHHHhHHHHHH---------------------HHHHHHHHHHHHHHHhCCCCCC
Q 048376           81 IVF-SPYGDSWKQLRKICVSELLSAKRVQSFQSIREK---------------------SKIYSLMYGITSRAAFGNRSRD  138 (221)
Q Consensus        81 ~~~-~~~g~~Wk~~Rr~~~~~~~~~~~~~~~~~i~~~---------------------~~~~~~~~~vi~~~~fG~~~~~  138 (221)
                      +++ ..+|+.||++|+++ .+.|+++.++.+.+++.+                     +.+.+++.+++++++||.+++.
T Consensus        84 ~~~~~~~g~~wk~~Rk~l-~~~fs~~~l~~~~~~i~~~~~~li~~l~~~~~~~~idl~~~~~~~~~~~i~~~~fG~~~~~  162 (453)
T d2ij2a1          84 LFTSWTHEKNWKKAHNIL-LPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNS  162 (453)
T ss_dssp             GGGSCTTSHHHHHHHHHH-GGGGSTTTHHHHHHHHHHHHHHHHHHHHTCCTTCCEEHHHHHHHHHHHHHHHHHHSCCCCG
T ss_pred             EEecCCChHHHHHHHHHH-HHHhhhhhhhhhhhhHHHHHHHHHHHhhhcCCCCccchHHHHHHHhhhcchhcccccccch
Confidence            443 35799999999996 467887777766554432                     6788999999999999998852


Q ss_pred             -----hhHHH-HHHHHHHHHcCCCccccccccccchhhhhchHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhccCCCCC
Q 048376          139 -----QEAFA-SVRGEITKLMSGFNIADMFPSVGLLQWLTGYKSQVEKLHQEADRIVKNIINEHKKRKATLKICKIGDDE  212 (221)
Q Consensus       139 -----~~~~~-~~~~~~~~~~~~~~~~~~~P~l~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~  212 (221)
                           .+.+. .....+.......  ....|++..   +....+...+..+.+++++++.++++++..+        ...
T Consensus       163 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~i~~r~~~~~--------~~~  229 (453)
T d2ij2a1         163 FYRDQPHPFITSMVRALDEAMNKL--QRANPDDPA---YDENKRQFQEDIKVMNDLVDKIIADRKASGE--------QSD  229 (453)
T ss_dssp             GGCSSCCHHHHHHHHHHHHHHHTC-----CTTSGG---GHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--------CCS
T ss_pred             hhhccchHHHHhhhhccchhhhhh--hhccccccc---chhhHHHHHHHHHHHHHHHHHHHhhhccccc--------ccc
Confidence                 12332 2332222222211  112233221   2223455666777788888888887766432        357


Q ss_pred             cHHHHhhc
Q 048376          213 DLVDVLLK  220 (221)
Q Consensus       213 d~ld~ll~  220 (221)
                      |+++.++.
T Consensus       230 d~l~~ll~  237 (453)
T d2ij2a1         230 DLLTHMLN  237 (453)
T ss_dssp             SHHHHHHH
T ss_pred             chhhhhhh
Confidence            88888763
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure