Citrus Sinensis ID: 048402


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------
FIHLEYLSLRNNKLQGTIDSEALGNLTSISRLDLSLNTGPEGRIPRSMASLCNLKSINLRGVHLSQEISEILNIFSGCVSIELESLDLRSSSISGHLTDQLGQFKNLDNLDLANNSIVGPIPQSLGHLSNLRVLQIYNNKLNGTLSEIHFSNLTKLSWFRVGGNKLTLEVRHDWIPPFQLVALGFHNCYVGSRFPQWLHSQKHLQYLNLLNSGMSDLFPIRFLKSAFQLKFLDLGLNQFHGQITDLTKVTQLLFLSVHSNNMSGPLPLISSNLVYLDLSNNSFSGSVSHYLCYRINEPKSLIGLKLKDNSLQGEIPDCWMSYQNLEILELSNNKFTGKLPNSLGSLTSLIWLLLGKNRLSGTIPVSLKNCTALESLDVGENEFVGNIPTWTGERFSRMVVLILRSNNFHGPLPTRLCDLAFLQILDLADNNLFGTIPKCINNITGMVAANSFTRSSQQYLPLPLDGDVILTEKASVVSEGEAIEYDEILNLVKETDVSRNNLTKSIPLEMTNLKATQSLNFSHNSFTGRIPESIGAMRSLESIDFSVNQLSGEIPQSMSNLMSLNHLNLSNNKLTGKIPSSTQLQSFDASSFTGNDLCGAPLPKNCAENVSVSEDENGDEDEDEVDHWLYVSIALGFVVGFGCFIGPLIFNRRWRYNYYHFLNRLENIIVGVVRKCS
cccccEEEccccccccccccccccccccccEEEccccccccccccHHccccccccEEEccccccccccHHHHHHccccccccccEEEcccccccEEccccccccccccEEEcccccccccccccccccccccEEEccccccEEEEccccccccccccEEEccccEEEEEEcccccccccccEEEcccccccccccHHccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEcccccccccccEEEccccccccccccccccccEEEcccccccccccHHHHHcccccccccEEEccccEEEccccccccccccccEEEccccccEEcccccccccccccEEEccccEEEEcccHHccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHHHHHcccccccccccccccccccccccEEEEEEEEEEccccEEHHHHcccEEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccEEEEEEEEcc
cccEEEEEcccccccccccHHHHHccccccEEEccccccccccccHHHcccccccEEEcccccccccccHHHccccHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHccccccccEEEEEccccccccccHHHHcccccEEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccEEEEcccccccccccHHHccHHHHHHHHccccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHHccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEccccccccccccHHccccEEEEcccccccccccHHHcccccEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHcccccccEEEcccccccccccccHcccccccEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEcc
fihleylslrnnklqgtidsealgnltsisrldlslntgpegriprsmaslcnlksinlrgVHLSQEISEILNIFSGCVSIElesldlrsssisghltdqlgqfknldnldlannsivgpipqslghlsnlrVLQIYNNklngtlseihfsnltklswfrvggnkltlevrhdwippfqlvalgfhncyvgsrfpqwlhsqKHLQYLNLLnsgmsdlfpiRFLKSAFQLKFLDLGLNQFHGQITDLTKVTQLLFLSVHsnnmsgplplissnlvyldlsnnsfsgsVSHYLCYRinepksliglklkdnslqgeipdcwmsYQNLEILElsnnkftgklpnslgSLTSLIWLLLgknrlsgtipvslknctalesldvgenefvgniptwtgERFSRMVVLILRsnnfhgplptrLCDLAFLQILDLadnnlfgtipkcinnitgmvaansftrssqqylplpldgdviltekasvvsegeaieYDEILNLVKEtdvsrnnltksiplemtnlkatqslnfshnsftgripesigaMRSLESIDFsvnqlsgeipqsMSNLMslnhlnlsnnkltgkipsstqlqsfdassftgndlcgaplpkncaenvsvsedengdededeVDHWLYVSIALGFVVGfgcfigplifnrrwrYNYYHFLNRLENIIVGVVRKCS
FIHLEYLSLRNNKLQGTIDSEALGNLTSISRLDLSLNTGPEGRIPRSMASLCNLKSINLRGVHLSQEISEILNIFSGCVSIELESLDLRSSSISGHLTDQLGQFKNLDNLDLANNSIVGPIPQSLGHLSNLRVLQIYNNKLNGTLSEIHFSNLTKLSWFRVGGNKLTLEVRHDWIPPFQLVALGFHNCYVGSRFPQWLHSQKHLQYLNLLNSGMSDLFPIRFLKSAFQLKFLDLGLNQFHGQITDLTKVTQLLFLSVHSNNMSGPLPLISSNLVYLDLSNNSFSGSVSHYLCYRINEPKSLIGLKLKDNSLQGEIPDCWMSYQNLEILELSNNKFTGKLPNSLGSLTSLIWLLLGKNRLSGTIPVSLKNCTALESLDVGENEFVGNIPTWTGERFSRMVVLILRSNNFHGPLPTRLCDLAFLQILDLADNNLFGTIPKCINNITGMVAANSFTRSSQQYLPLPLDGDVILTEKASVvsegeaieydeilnlvketdvsrnnLTKSIPLEMTNLKATQSLNFSHNSFTGRIPESIGAMRSLESIDFSVNQLSGEIPQSMSNLMSLNHLNLSNNKLTGKIPSSTQLQSFDASSFTGNDLCGAPLPKNCAENVSVSEDENGDEDEDEVDHWLYVSIALGFVVGFGCFIGPLIFNRRWRYNYYHFLNRLENIIVGVVRKCS
FIHLEYLSLRNNKLQGTIDSEALGNLTSISRLDLSLNTGPEGRIPRSMASLCNLKSINLRGVHLSQEISEILNIFSGCVSIELESLDLRSSSISGHLTDQLGQFKNLDNLDLANNSIVGPIPQSLGHLSNLRVLQIYNNKLNGTLSEIHFSNLTKLSWFRVGGNKLTLEVRHDWIPPFQLVALGFHNCYVGSRFPQWLHSQKHLQYLNLLNSGMSDLFPIRFLKSAFQLKFLDLGLNQFHGQITDLTKVTQLLFLSVHSNNMSGPLPLISSNLVYLDLSNNSFSGSVSHYLCYRINEPKSLIGLKLKDNSLQGEIPDCWMSYQNLEILELSNNKFTGKLPNslgsltsliwlllGKNRLSGTIPVSLKNCTALESLDVGENEFVGNIPTWTGERFSRMVVLILRSNNFHGPLPTRLCDLAFLQILDLADNNLFGTIPKCINNITGMVAANSFTRSSQQYLPLPLDGDVILTEKASVVSEGEAIEYDEILNLVKETDVSRNNLTKSIPLEMTNLKATQSLNFSHNSFTGRIPESIGAMRSLESIDFSVNQLSGEIPQsmsnlmslnhlnlsnnKLTGKIPSSTQLQSFDASSFTGNDLCGAPLPKNCAENVSVSedengdededevdHWLYVSIALGFVVGFGCFIGPLIFNRRWRYNYYHFLNRLENIIVGVVRKCS
*****YLSL*************LGNLTSISRLDL************SMASLCNLKSINLRGVHLSQEISEILNIFSGCVSIELESLDLRSSSISGHLTDQLGQFKNLDNLDLANNSIVGPIPQSLGHLSNLRVLQIYNNKLNGTLSEIHFSNLTKLSWFRVGGNKLTLEVRHDWIPPFQLVALGFHNCYVGSRFPQWLHSQKHLQYLNLLNSGMSDLFPIRFLKSAFQLKFLDLGLNQFHGQITDLTKVTQLLFLSVHSNNMSGPLPLISSNLVYLDLSNNSFSGSVSHYLCYRINEPKSLIGLKLKDNSLQGEIPDCWMSYQNLEILELSNNKFTGKLPNSLGSLTSLIWLLLGKNRLSGTIPVSLKNCTALESLDVGENEFVGNIPTWTGERFSRMVVLILRSNNFHGPLPTRLCDLAFLQILDLADNNLFGTIPKCINNITGMVAANSFTRSSQQYLPLPLDGDVILTEKASVVSEGEAIEYDEILNLVKETDVSRNNL***I**********************************************************************************************************************VDHWLYVSIALGFVVGFGCFIGPLIFNRRWRYNYYHFLNRLENIIVGVVR***
FIHLEYLSLRNNKLQGTIDSEALGNLTSISRLDLSLNTGPEGRIPRSMASLCNLKSINLRGVHLSQEISEILNIFSGCVSIELESLDLRSSSISGHLTDQLGQFKNLDNLDLANNSIVGPIPQSLGHLSNLRVLQIYNNKLNGTLSEIHFSNLTKLSWFRVGGNKLTLEVRHDWIPPFQLVALGFHNCYVGSRFPQWLHSQKHLQYLNLLNSGMSDLFPIRFLKSAFQLKFLDLGLNQFHGQITDLTKVTQLLFLSVHSNNMSGPLPLISSNLVYLDLSNNSFSGSVSHYLCYRINEPKSLIGLKLKDNSLQGEIPDCWMSYQNLEILELSNNKFTGKLPNSLGSLTSLIWLLLGKNRLSGTIPVSLKNCTALESLDVGENEFVGNIPTWTGERFSRMVVLILRSNNFHGPLPTRLCDLAFLQILDLADNNLFGTIPKCINNITGMVAANS**RSSQQYLPLPLDGDVILTEKASVVSEGEAIEYDEILNLVKETDVSRNNLTKSIPLEMTNLKATQSLNFSHNSFTGRIPESIGAMRSLESIDFSVNQLSGEIPQSMSNLMSLNHLNLSNNKLTGKIPSSTQLQSFDASSFTGNDLCGAP**************************WLYVSIALGFVVGFGCFIGPLIFNRRWRYNYYHFLNRLENIIVGVVRKCS
FIHLEYLSLRNNKLQGTIDSEALGNLTSISRLDLSLNTGPEGRIPRSMASLCNLKSINLRGVHLSQEISEILNIFSGCVSIELESLDLRSSSISGHLTDQLGQFKNLDNLDLANNSIVGPIPQSLGHLSNLRVLQIYNNKLNGTLSEIHFSNLTKLSWFRVGGNKLTLEVRHDWIPPFQLVALGFHNCYVGSRFPQWLHSQKHLQYLNLLNSGMSDLFPIRFLKSAFQLKFLDLGLNQFHGQITDLTKVTQLLFLSVHSNNMSGPLPLISSNLVYLDLSNNSFSGSVSHYLCYRINEPKSLIGLKLKDNSLQGEIPDCWMSYQNLEILELSNNKFTGKLPNSLGSLTSLIWLLLGKNRLSGTIPVSLKNCTALESLDVGENEFVGNIPTWTGERFSRMVVLILRSNNFHGPLPTRLCDLAFLQILDLADNNLFGTIPKCINNITGMVAANSFTRSSQQYLPLPLDGDVILTEKASVVSEGEAIEYDEILNLVKETDVSRNNLTKSIPLEMTNLKATQSLNFSHNSFTGRIPESIGAMRSLESIDFSVNQLSGEIPQSMSNLMSLNHLNLSNNKLTGKIPSSTQLQSFDASSFTGNDLCGAPLPKNCAENV*************EVDHWLYVSIALGFVVGFGCFIGPLIFNRRWRYNYYHFLNRLENIIVGVVRKCS
FIHLEYLSLRNNKLQGTIDSEALGNLTSISRLDLSLNTGPEGRIPRSMASLCNLKSINLRGVHLSQEISEILNIFSGCVSIELESLDLRSSSISGHLTDQLGQFKNLDNLDLANNSIVGPIPQSLGHLSNLRVLQIYNNKLNGTLSEIHFSNLTKLSWFRVGGNKLTLEVRHDWIPPFQLVALGFHNCYVGSRFPQWLHSQKHLQYLNLLNSGMSDLFPIRFLKSAFQLKFLDLGLNQFHGQITDLTKVTQLLFLSVHSNNMSGPLPLISSNLVYLDLSNNSFSGSVSHYLCYRINEPKSLIGLKLKDNSLQGEIPDCWMSYQNLEILELSNNKFTGKLPNSLGSLTSLIWLLLGKNRLSGTIPVSLKNCTALESLDVGENEFVGNIPTWTGERFSRMVVLILRSNNFHGPLPTRLCDLAFLQILDLADNNLFGTIPKCINNITGMVAANSFTRSSQQYLPLPLDGDVILTEKASVVSEGEAIEYDEILNLVKETDVSRNNLTKSIPLEMTNLKATQSLNFSHNSFTGRIPESIGAMRSLESIDFSVNQLSGEIPQSMSNLMSLNHLNLSNNKLTGKIPSSTQLQSFDASSFTGNDLCGAPLPKNCAENVSVSEDENGDEDEDEVDHWLYVSIALGFVVGFGCFIGPLIFNRRWRYNYYHFLNRLENIIVGVVRKCS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FIHLEYLSLRNNKLQGTIDSEALGNLTSISRLDLSLNTGPEGRIPRSMASLCNLKSINLRGVHLSQEISEILNIFSGCVSIELESLDLRSSSISGHLTDQLGQFKNLDNLDLANNSIVGPIPQSLGHLSNLRVLQIYNNKLNGTLSEIHFSNLTKLSWFRVGGNKLTLEVRHDWIPPFQLVALGFHNCYVGSRFPQWLHSQKHLQYLNLLNSGMSDLFPIRFLKSAFQLKFLDLGLNQFHGQITDLTKVTQLLFLSVHSNNMSGPLPLISSNLVYLDLSNNSFSGSVSHYLCYRINEPKSLIGLKLKDNSLQGEIPDCWMSYQNLEILELSNNKFTGKLPNSLGSLTSLIWLLLGKNRLSGTIPVSLKNCTALESLDVGENEFVGNIPTWTGERFSRMVVLILRSNNFHGPLPTRLCDLAFLQILDLADNNLFGTIPKCINNITGMVAANSFTRSSQQYLPLPLDGDVILTEKASVVSEGEAIEYDEILNLVKETDVSRNNLTKSIPLEMTNLKATQSLNFSHNSFTGRIPESIGAMRSLESIDFSVNQLSGEIPQSMSNLMSLNHLNLSNNKLTGKIPSSTQLQSFDASSFTGNDLCGAPLPKNCAENVSVSEDENGDEDEDEVDHWLYVSIALGFVVGFGCFIGPLIFNRRWRYNYYHFLNRLENIIVGVVRKCS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query677 2.2.26 [Sep-21-2011]
C0LGQ5 1249 LRR receptor-like serine/ no no 0.836 0.453 0.327 2e-63
Q9C9H7847 Receptor-like protein 12 no no 0.923 0.737 0.312 2e-62
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.794 0.429 0.323 3e-61
Q9FL28 1173 LRR receptor-like serine/ no no 0.821 0.473 0.305 5e-59
C0LGV1 1135 LRR receptor-like serine/ no no 0.853 0.509 0.312 3e-51
Q42371 976 LRR receptor-like serine/ no no 0.734 0.509 0.297 4e-51
Q9LVP0 1102 Probable leucine-rich rep no no 0.830 0.509 0.298 6e-51
Q9SHI2 1101 Leucine-rich repeat recep no no 0.836 0.514 0.288 1e-50
O49318 1124 Probable leucine-rich rep no no 0.799 0.481 0.285 4e-49
Q9ZPS9 1143 Serine/threonine-protein no no 0.813 0.482 0.302 1e-48
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  244 bits (622), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 214/654 (32%), Positives = 322/654 (49%), Gaps = 88/654 (13%)

Query: 3   HLEYLSLRNNKLQGTIDSEALGNLTSISRLDLSLNTGPEGRIPRSMASLCNLKSINLRGV 62
           +LE L+L NN L G I S+ LG ++ +  L L  N   +G IP+S+A L NL++++L   
Sbjct: 240 NLEILNLANNSLTGEIPSQ-LGEMSQLQYLSLMANQ-LQGLIPKSLADLGNLQTLDLSAN 297

Query: 63  HLSQEISEIL-------------NIFSGCV-------SIELESLDLRSSSISGHLTDQLG 102
           +L+ EI E               N  SG +       +  LE L L  + +SG +  +L 
Sbjct: 298 NLTGEIPEEFWNMSQLLDLVLANNHLSGSLPKSICSNNTNLEQLVLSGTQLSGEIPVELS 357

Query: 103 QFKNLDNLDLANNSIVGPIPQSLGHLSNLRVLQIYNNKLNGTLSEIHFSNLTKLSWFRVG 162
           + ++L  LDL+NNS+ G IP++L  L  L  L ++NN L GTLS    SNLT L W  + 
Sbjct: 358 KCQSLKQLDLSNNSLAGSIPEALFELVELTDLYLHNNTLEGTLSP-SISNLTNLQWLVLY 416

Query: 163 GNKLTLEVRHDWIPPFQLVALGFHNCYVGSRFPQWLHSQKHLQYLNLLNSGMSDLFPIRF 222
            N L  ++  +     +L  L  +        PQ + +   L+ +++  +      P   
Sbjct: 417 HNNLEGKLPKEISALRKLEVLFLYENRFSGEIPQEIGNCTSLKMIDMFGNHFEGEIPPSI 476

Query: 223 -----------------------LKSAFQLKFLDLGLNQFHGQITD----LTKVTQLLFL 255
                                  L +  QL  LDL  NQ  G I      L  + QL+  
Sbjct: 477 GRLKELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQLSGSIPSSFGFLKGLEQLM-- 534

Query: 256 SVHSNNMSGPLP--LIS-SNLVYLDLSNNSFSGSVSHYLCYRINEPKSLIGLKLKDNSLQ 312
            +++N++ G LP  LIS  NL  ++LS+N  +G++ H LC       S +   + +N  +
Sbjct: 535 -LYNNSLQGNLPDSLISLRNLTRINLSHNRLNGTI-HPLCGS----SSYLSFDVTNNGFE 588

Query: 313 GEIPDCWMSYQNLEILELSNNKFTGKLPNSLGSLTSLIWLLLGKNRLSGTIPVSLKNCTA 372
            EIP    + QNL+ L L  N+ TGK+P +LG +  L  L +  N L+GTIP+ L  C  
Sbjct: 589 DEIPLELGNSQNLDRLRLGKNQLTGKIPWTLGKIRELSLLDMSSNALTGTIPLQLVLCKK 648

Query: 373 LESLDVGENEFVGNIPTWTGERFSRMVVLILRSNNFHGPLPTRLCDLAFLQILDLADNNL 432
           L  +D+  N   G IP W G + S++  L L SN F   LPT L +   L +L L  N+L
Sbjct: 649 LTHIDLNNNFLSGPIPPWLG-KLSQLGELKLSSNQFVESLPTELFNCTKLLVLSLDGNSL 707

Query: 433 FGTIPKCINNITGMVAANSFTRSSQQYLPLPLDGDVILTEKASVVSEGEAIEYDEILNLV 492
            G+IP+ I N+  +   N         LP  +                        L+ +
Sbjct: 708 NGSIPQEIGNLGALNVLNLDKNQFSGSLPQAMGK----------------------LSKL 745

Query: 493 KETDVSRNNLTKSIPLEMTNLKATQS-LNFSHNSFTGRIPESIGAMRSLESIDFSVNQLS 551
            E  +SRN+LT  IP+E+  L+  QS L+ S+N+FTG IP +IG +  LE++D S NQL+
Sbjct: 746 YELRLSRNSLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGTLSKLETLDLSHNQLT 805

Query: 552 GEIPQSMSNLMSLNHLNLSNNKLTGKIPSSTQLQSFDASSFTGND-LCGAPLPK 604
           GE+P S+ ++ SL +LN+S N L GK+    Q   + A SF GN  LCG+PL +
Sbjct: 806 GEVPGSVGDMKSLGYLNVSFNNLGGKL--KKQFSRWPADSFLGNTGLCGSPLSR 857




Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query677
224072885 1024 predicted protein [Populus trichocarpa] 0.973 0.643 0.490 1e-169
255543977 1075 serine/threonine-protein kinase bri1, pu 0.977 0.615 0.448 1e-161
255581850 1082 leucine-rich repeat receptor protein kin 0.970 0.607 0.457 1e-157
315436720 1020 verticillium wilt resistance-like protei 0.970 0.644 0.463 1e-155
356561588 1074 PREDICTED: LRR receptor-like serine/thre 0.964 0.608 0.426 1e-144
356561552 1019 PREDICTED: LRR receptor-like serine/thre 0.966 0.641 0.436 1e-143
255539443 1054 serine-threonine protein kinase, plant-t 0.970 0.623 0.430 1e-143
356561661 1020 PREDICTED: LRR receptor-like serine/thre 0.960 0.637 0.432 1e-143
209970607 1045 M18S-3Ap [Malus floribunda] 0.945 0.612 0.448 1e-143
356561667 1018 PREDICTED: leucine-rich repeat receptor 0.961 0.639 0.429 1e-143
>gi|224072885|ref|XP_002303927.1| predicted protein [Populus trichocarpa] gi|222841359|gb|EEE78906.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 344/701 (49%), Positives = 454/701 (64%), Gaps = 42/701 (5%)

Query: 1    FIHLEYLSLRNNKLQGTIDSEALGNLTSISRLDLSLN--TGPEGRIPRSMASLCNLKSIN 58
            F HL+ L+L +N LQG + S A+GN+TS+  LDLSLN     EG IP S   LCNL++++
Sbjct: 329  FEHLKLLNLGSNNLQGVL-SSAIGNMTSLISLDLSLNHELKFEGGIPGSFKKLCNLRTLS 387

Query: 59   LRGVHLSQEISEILNIFSGCVSIELESLDLRSSSISGHLTDQLGQFKNLDNLDLANNSIV 118
            L  V L+Q+I+E+L +  GCVS E+ESLDL    + G LT+ LG+F+NL  L L +NSI 
Sbjct: 388  LSNVKLNQDIAEVLEVLLGCVSEEVESLDLAGCLLFGQLTNHLGKFRNLAYLGLRSNSIS 447

Query: 119  GPIPQSLGHLSNLRVLQIYNNKLNGTL------------------------SEIHFSNLT 154
            GPIP +LG L +LR L + +NKLNGTL                        SE+HF+NL 
Sbjct: 448  GPIPMALGELVSLRSLVLSDNKLNGTLPKSFGELTKLEEMDISHNLFQGEVSEVHFANLK 507

Query: 155  KLSWFRVGGNKLTLEVRHDWIPPFQLVALGFHNCYVGSRFPQWLHSQKHLQYLNLLNSGM 214
             L  F   GN+L L V  DWIPP QLV +   +  VG +FP+W+   +HL YL++ NS +
Sbjct: 508  NLRNFSAAGNQLNLRVSPDWIPP-QLVFIDLRSWNVGPQFPKWVRPLEHLSYLDISNSSI 566

Query: 215  SDLFPIRFLKSAFQLKFLDLGLNQFHGQIT-----DLTKVTQLLFLSVHSNNMSGPLPLI 269
            S   PI F   +F++++L+L  NQ  G I      D T    L+ LS  SN   GPLP I
Sbjct: 567  SSTIPIWFWTMSFRMEYLNLSHNQIQGVIPSKLKLDFTASYPLVDLS--SNQFKGPLPSI 624

Query: 270  SSNLVYLDLSNNSFSGSVSHYLCYRINEPKSLIGLKLKDNSLQGEIPDCWMSYQNLEILE 329
             SN+  LDLSNNSFSGS+ ++LC++I+E K++  L L +N L G IPDCW S+Q L  ++
Sbjct: 625  FSNVGALDLSNNSFSGSMLNFLCHKIDELKNMQVLNLGENLLSGVIPDCWSSWQYLVAIK 684

Query: 330  LSNNKFTGKLPNSLGSLTSLIWLLLGKNRLSGTIPVSLKNCTALESLDVGENEFVGNIPT 389
            LSNNK +G +P+S+G+L+ L  L +  + LSG +P+SLKNCT L +LDV ENE VG++P 
Sbjct: 685  LSNNKLSGNIPDSIGALSLLESLHIRNSSLSGKLPISLKNCTKLITLDVAENELVGSMPA 744

Query: 390  WTGERFSRMVVLILRSNNFHGPLPTRLCDLAFLQILDLADNNLFGTIPKCINNITGMVAA 449
            W G+RFS MVVL +R+N FHG +P  LC+LA LQILDLA N L  +IP C N ++ M   
Sbjct: 745  WIGKRFSSMVVLNMRANKFHGRIPRELCNLASLQILDLAHNRLSWSIPTCFNKLSAMATR 804

Query: 450  NSFTRSSQQYLPLPLDGDVILTEKASVVSEGEAIEYDEILNLVKETDVSRNNLTKSIPLE 509
            N           + LD      +   +V +G+ +EY  IL  V+  D+S N L   IP E
Sbjct: 805  N------DSLGKIYLDSGSSTFDNVLLVMKGKVVEYSTILKFVRSIDLSSNALCGEIPEE 858

Query: 510  MTNLKATQSLNFSHNSFTGRIPESIGAMRSLESIDFSVNQLSGEIPQSMSNLMSLNHLNL 569
            +T L   QSLN S NS TGRIPE IG++R LES+DFSVNQLSGEIPQSMS+L  L+HLNL
Sbjct: 859  VTRLSELQSLNLSQNSLTGRIPEGIGSLRYLESMDFSVNQLSGEIPQSMSDLTFLSHLNL 918

Query: 570  SNNKLTGKIPSSTQLQSFDASSFTGNDLCGAPLPKNCAENVSVSEDENGDEDEDEVD-HW 628
            S+N+L G+IPS TQLQSF  SSF+GN+LCG PL KNC+ +     +   +ED + +   W
Sbjct: 919  SDNRLRGRIPSGTQLQSFGPSSFSGNELCGPPLSKNCSVDNKFHVEHEREEDGNGLKGRW 978

Query: 629  LYVSIALGFVVGFGCFIGPLIFNRRWRYNYYHFLNRLENII 669
             YVS+ LGF+VGF   +GPL+FNRRWRY YYHFL+RL + I
Sbjct: 979  FYVSMVLGFIVGFWGVVGPLMFNRRWRYVYYHFLDRLRDQI 1019




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255543977|ref|XP_002513051.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223548062|gb|EEF49554.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255581850|ref|XP_002531725.1| leucine-rich repeat receptor protein kinase exs precursor, putative [Ricinus communis] gi|223528628|gb|EEF30645.1| leucine-rich repeat receptor protein kinase exs precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|315436720|gb|ADU18533.1| verticillium wilt resistance-like protein [Gossypium barbadense] Back     alignment and taxonomy information
>gi|356561588|ref|XP_003549063.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Glycine max] Back     alignment and taxonomy information
>gi|356561552|ref|XP_003549045.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Glycine max] Back     alignment and taxonomy information
>gi|255539443|ref|XP_002510786.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223549901|gb|EEF51388.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356561661|ref|XP_003549098.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Glycine max] Back     alignment and taxonomy information
>gi|209970607|gb|ACJ03066.1| M18S-3Ap [Malus floribunda] Back     alignment and taxonomy information
>gi|356561667|ref|XP_003549101.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query677
TAIR|locus:2044767905 AT2G34930 "AT2G34930" [Arabido 0.877 0.656 0.314 1.4e-64
TAIR|locus:2119430741 RLP47 "receptor like protein 4 0.936 0.855 0.305 6e-64
TAIR|locus:2137296811 RLP46 "receptor like protein 4 0.868 0.725 0.297 3.3e-63
TAIR|locus:2129246891 RLP50 "receptor like protein 5 0.923 0.701 0.306 5e-60
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.935 0.723 0.293 2.4e-56
TAIR|locus:2173777792 RLP54 "receptor like protein 5 0.920 0.786 0.294 4.2e-56
TAIR|locus:2046397589 RLP22 "receptor like protein 2 0.841 0.967 0.313 2.9e-55
TAIR|locus:2096349860 RLP31 "receptor like protein 3 0.923 0.726 0.290 4.5e-55
TAIR|locus:2087253884 RLP39 "AT3G24900" [Arabidopsis 0.859 0.658 0.303 5.8e-55
TAIR|locus:2086979890 RLP42 "receptor like protein 4 0.930 0.707 0.292 1.7e-54
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 658 (236.7 bits), Expect = 1.4e-64, P = 1.4e-64
 Identities = 195/621 (31%), Positives = 289/621 (46%)

Query:     4 LEYLSLRNN-KLQGTIDSEALGNLTSISRLDLSLNTGPEGRIPRSMASLCNLKSINLRGV 62
             LE L L NN  LQG I S  LG+L  +  LDLS N    G+I   + +    K  +L  +
Sbjct:   297 LETLDLSNNLALQGEIPS-VLGDLPQLKFLDLSANE-LNGQIHGFLDAFSRNKGNSLVFL 354

Query:    63 HLSQ-EISEILNIFSGCVSIELESLDLRSSSISGHLTDQLGQFKNLDNLDLANNSIVGPI 121
              LS  +++  L    G +   L++LDL S+S +G +   +G   +L  LDL+NN++ G I
Sbjct:   355 DLSSNKLAGTLPESLGSLR-NLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTI 413

Query:   122 PQSLGHLSNLRVLQIYNNKLNGTLSEIHFSNLTKLSWFRVGGN---KLTLEVRHDWIPPF 178
              +SLG L+ L  L +  N   G L + HF NL  L   R+       L  ++   WIPPF
Sbjct:   414 AESLGQLAELVDLNLMANTWGGVLQKSHFVNLRSLKSIRLTTEPYRSLVFKLPSTWIPPF 473

Query:   179 QLVALGFHNCYVGSRFPQWLHSQKHLQYLNLLNSGMSDLFPIRFLKS-AFQLKFLDLGLN 237
             +L  +   NC +G  FP WL  Q  L ++ L N+G+ D  P  +    + ++ +L L  N
Sbjct:   474 RLELIQIENCRIGL-FPMWLQVQTKLNFVTLRNTGIEDTIPDSWFSGISSKVTYLILANN 532

Query:   238 QFHGQITDLTKVTQLLFLSVHSNNMSGPLPLISSNLVYLDLSNNSFSGSVSHYLCYRINE 297
             +  G++       +L  + + SNN  G  PL S+N   L L  N+FSGS+   +   +  
Sbjct:   533 RIKGRLPQKLAFPKLNTIDLSSNNFEGTFPLWSTNATELRLYENNFSGSLPQNI--DVLM 590

Query:   298 PKSLIGLKLKDNSLQGEIPDCWMSYQNLEILELSNNKFTGKLPNXXXXXXXXXXXXXGKN 357
             P+ +  + L  NS  G IP        L+IL L  N F+G  P               +N
Sbjct:   591 PR-MEKIYLFSNSFTGNIPSSLCEVSGLQILSLRKNHFSGSFPKCWHRQFMLWGIDVSEN 649

Query:   358 RLSGTIPVSLKNCTALESLDVGENEFVGNIPTWTGERFSRMVVLILRSNNFHGPLPTRLC 417
              LSG IP SL    +L  L + +N   G IP  +    S +  + L  N   G LP+ + 
Sbjct:   650 NLSGEIPESLGMLPSLSVLLLNQNSLEGKIPE-SLRNCSGLTNIDLGGNKLTGKLPSWVG 708

Query:   418 DLAFLQILDLADNNLFGTIPKCINNITGMVAANSFTRSSQQYLPLPLDGDVILTEKAS-- 475
              L+ L +L L  N+  G IP  + N+  +   +         +P  +     +    +  
Sbjct:   709 KLSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSGNKISGPIPKCISNLTAIARGTNNE 768

Query:   476 -----VVSEGEAIEYDEILNLVKETDVSRNNLTKSIPLEMTNLKATQSLNFSHNSFTGRI 530
                  V     A EY+ I N +   ++S NN++  IP E+  L   + LN S NS  G I
Sbjct:   769 VFQNLVFIVTRAREYEAIANSI---NLSGNNISGEIPREILGLLYLRILNLSRNSMAGSI 825

Query:   531 PESIGAMRSLESIDFSVNQLSGEIPQXXXXXXXXXXXXXXXXKLTGKIPSSTQLQSFDAS 590
             PE I  +  LE++D S N+ SG IPQ                KL G IP   + Q  D S
Sbjct:   826 PEKISELSRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKLEGSIPKLLKFQ--DPS 883

Query:   591 SFTGNDL-CGAPLPKNCAENV 610
              + GN+L CG PLPK C +++
Sbjct:   884 IYIGNELLCGKPLPKKCPKDI 904


GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2119430 RLP47 "receptor like protein 47" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173777 RLP54 "receptor like protein 54" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046397 RLP22 "receptor like protein 22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096349 RLP31 "receptor like protein 31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087253 RLP39 "AT3G24900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086979 RLP42 "receptor like protein 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00031679
hypothetical protein (1024 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query677
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-53
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-47
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-39
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-38
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-37
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-28
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-20
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-19
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.003
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.004
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.004
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  197 bits (502), Expect = 3e-53
 Identities = 161/566 (28%), Positives = 276/566 (48%), Gaps = 75/566 (13%)

Query: 25  NLTSISRLDLSLNTGPEGRIPRSMASLCNLKSINLRGVHLSQEISEILNIFSGCVSIELE 84
           N + +  +DLS      G+I  ++  L  +++INL    LS  I +  +IF+   S  L 
Sbjct: 67  NSSRVVSIDLS-GKNISGKISSAIFRLPYIQTINLSNNQLSGPIPD--DIFTTSSS--LR 121

Query: 85  SLDLRSSSISGHLTDQLGQFKNLDNLDLANNSIVGPIPQSLGHLSNLRVLQIYNNKLNGT 144
            L+L +++ +G +    G   NL+ LDL+NN + G IP  +G  S+L+VL +  N L G 
Sbjct: 122 YLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGK 179

Query: 145 LSEIHFSNLTKLSWFRVGGNKLTLEVRHDW--IPPFQLVALGFHNCYVGSRFPQWLHSQK 202
           +     +NLT L +  +  N+L  ++  +   +   + + LG++N  +    P  +    
Sbjct: 180 IP-NSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNN--LSGEIPYEIGGLT 236

Query: 203 HLQYLNLLNSGMSDLFPIRFLKSAFQLKFLDLGLNQFHGQI-TDLTKVTQLLFLSVHSNN 261
            L +L+L+ + ++   P   L +   L++L L  N+  G I   +  + +L+ L +  N+
Sbjct: 237 SLNHLDLVYNNLTGPIPSS-LGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNS 295

Query: 262 MSGPLP-LISS--NLVYLDLSNNSFSGSVSHYLCYRINEPKSLIGLKLKDNSLQGEIPDC 318
           +SG +P L+    NL  L L +N+F+G +   L    + P+  + L+L  N   GEIP  
Sbjct: 296 LSGEIPELVIQLQNLEILHLFSNNFTGKIPVALT---SLPRLQV-LQLWSNKFSGEIPKN 351

Query: 319 WMSYQNLEILELSNNKFTGKLPNSLGSLTSLIWLLLGKNRLSGTIPVSLKNCTALESLDV 378
              + NL +L+LS N  TG++P  L S  +L  L+L  N L G IP SL  C +L  + +
Sbjct: 352 LGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRL 411

Query: 379 GENEFVGNIPTWTGERFSRMVV---LILRSNNFHGPLPTRLCDLAFLQILDLADNNLFGT 435
            +N F G +P+     F+++ +   L + +NN  G + +R  D+  LQ+L LA N  FG 
Sbjct: 412 QDNSFSGELPS----EFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGG 467

Query: 436 IPKCINNITGMVAANSFTRSSQQYLPLPLDGDVILTEKASVVSEGEAIEYDEILNLVKET 495
           +P                 S +                                  ++  
Sbjct: 468 LP-------------DSFGSKR----------------------------------LENL 480

Query: 496 DVSRNNLTKSIPLEMTNLKATQSLNFSHNSFTGRIPESIGAMRSLESIDFSVNQLSGEIP 555
           D+SRN  + ++P ++ +L     L  S N  +G IP+ + + + L S+D S NQLSG+IP
Sbjct: 481 DLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIP 540

Query: 556 QSMSNLMSLNHLNLSNNKLTGKIPSS 581
            S S +  L+ L+LS N+L+G+IP +
Sbjct: 541 ASFSEMPVLSQLDLSQNQLSGEIPKN 566


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 677
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG4237498 consensus Extracellular matrix protein slit, conta 99.93
PLN032101153 Resistant to P. syringae 6; Provisional 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
PLN03150623 hypothetical protein; Provisional 99.55
PLN03150623 hypothetical protein; Provisional 99.3
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.24
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.18
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.16
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.14
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.14
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.14
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.13
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.08
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.07
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.03
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.01
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.0
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.96
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.92
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.88
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.84
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.78
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.75
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.6
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.55
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.47
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.39
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.34
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.23
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.12
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.12
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.1
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.97
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.87
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.86
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.86
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.83
PRK15386426 type III secretion protein GogB; Provisional 97.81
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.75
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.67
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.63
PRK15386426 type III secretion protein GogB; Provisional 97.6
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.55
KOG4341483 consensus F-box protein containing LRR [General fu 97.41
KOG4341483 consensus F-box protein containing LRR [General fu 97.18
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.82
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.73
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.14
KOG4308478 consensus LRR-containing protein [Function unknown 96.02
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.99
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.96
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.57
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.47
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.37
KOG4308478 consensus LRR-containing protein [Function unknown 94.34
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.93
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.65
smart0037026 LRR Leucine-rich repeats, outliers. 90.39
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.39
smart0037026 LRR Leucine-rich repeats, outliers. 90.17
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.17
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.86
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 88.76
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.68
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 85.58
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.27
PF15102146 TMEM154: TMEM154 protein family 80.43
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.2e-63  Score=582.11  Aligned_cols=537  Identities=33%  Similarity=0.524  Sum_probs=467.9

Q ss_pred             CcccEEEccCCCCceecCCccccCCCCCCEEecCCCCCCCccCchhhc-CCCCCCEEEccCCcCCcccchhhhhccccCc
Q 048402            2 IHLEYLSLRNNKLQGTIDSEALGNLTSISRLDLSLNTGPEGRIPRSMA-SLCNLKSINLRGVHLSQEISEILNIFSGCVS   80 (677)
Q Consensus         2 ~~L~~L~Ls~n~~~~~i~~~~~~~l~~L~~L~Ls~~~~~~~~~~~~l~-~l~~L~~L~l~~n~l~~~~~~~~~~l~~~~~   80 (677)
                      .+++.|+|++|.+.|.+ +..|..+++|++|+|+ ++.+.+.+|..+. .+++|++|++++|.+++.+|.  +.++    
T Consensus        69 ~~v~~L~L~~~~i~~~~-~~~~~~l~~L~~L~Ls-~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~----  140 (968)
T PLN00113         69 SRVVSIDLSGKNISGKI-SSAIFRLPYIQTINLS-NNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIP----  140 (968)
T ss_pred             CcEEEEEecCCCccccC-ChHHhCCCCCCEEECC-CCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccC----
Confidence            36788999999988777 7788899999999999 7777878887665 889999999999998887775  3455    


Q ss_pred             CCccEEEcccCcCccccccccCCCCCCCEEECcCCccccCCCcCCCCCCCCCEEEccccccccccChhhhhCCCCCCEEE
Q 048402           81 IELESLDLRSSSISGHLTDQLGQFKNLDNLDLANNSIVGPIPQSLGHLSNLRVLQIYNNKLNGTLSEIHFSNLTKLSWFR  160 (677)
Q Consensus        81 ~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~i~~~l~~~~~~~l~~L~~L~  160 (677)
                       +|++|++++|.+++.+|..++++++|++|++++|.+.+..|..++++++|++|++++|.+.+.+|. .++++++|+.|+
T Consensus       141 -~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~-~l~~l~~L~~L~  218 (968)
T PLN00113        141 -NLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPR-ELGQMKSLKWIY  218 (968)
T ss_pred             -CCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCCh-HHcCcCCccEEE
Confidence             899999999999888888899999999999999998888899999999999999999998877887 788999999999


Q ss_pred             eeccccceecCCCCCCCcCccEEEeecccCCCCCChhccCCCCCCEEEccCCCCCCccchHHHhccCCccEEECCCccCc
Q 048402          161 VGGNKLTLEVRHDWIPPFQLVALGFHNCYVGSRFPQWLHSQKHLQYLNLLNSGMSDLFPIRFLKSAFQLKFLDLGLNQFH  240 (677)
Q Consensus       161 l~~n~l~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~i~~~~~~~~~~~~~~L~~L~Ls~n~l~  240 (677)
                      +++|.+.+..+..+..+++|++|++++|.+.+..|..++++++|++|++++|.+++..|..+. .+++|++|++++|.+.
T Consensus       219 L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~-~l~~L~~L~Ls~n~l~  297 (968)
T PLN00113        219 LGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIF-SLQKLISLDLSDNSLS  297 (968)
T ss_pred             CcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHh-hccCcCEEECcCCeec
Confidence            999999888888888899999999999999888899999999999999999998887776663 5788999999999888


Q ss_pred             cccCC-ccccccccEEEcccCCCCCCCCCC---CCCccEEEccCCcccccCChhHhhccCCCCCcCeEecCCCCCcccCC
Q 048402          241 GQITD-LTKVTQLLFLSVHSNNMSGPLPLI---SSNLVYLDLSNNSFSGSVSHYLCYRINEPKSLIGLKLKDNSLQGEIP  316 (677)
Q Consensus       241 ~~~~~-~~~~~~L~~L~l~~n~~~~~~~~~---~~~L~~L~l~~n~l~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~  316 (677)
                      +.++. +..+++|+.|++++|.+.+..|..   +++|+.|++++|.+.+..|..+.    .+++|+.|++++|.+.+..|
T Consensus       298 ~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~----~~~~L~~L~Ls~n~l~~~~p  373 (968)
T PLN00113        298 GEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLG----KHNNLTVLDLSTNNLTGEIP  373 (968)
T ss_pred             cCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHh----CCCCCcEEECCCCeeEeeCC
Confidence            76665 455688999999999888877654   67889999999988887776554    37889999999999988888


Q ss_pred             cccccCCCCceecccCccccccCCcCcCCCCCccEEECcCCcccccCCccCcCCCCCCEEecCCCcccccCChhhhhccC
Q 048402          317 DCWMSYQNLEILELSNNKFTGKLPNSLGSLTSLIWLLLGKNRLSGTIPVSLKNCTALESLDVGENEFVGNIPTWTGERFS  396 (677)
Q Consensus       317 ~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~l~  396 (677)
                      ..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|++++..|..|..+++|+.|++++|.+.+.+|.... .++
T Consensus       374 ~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~-~l~  452 (968)
T PLN00113        374 EGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKW-DMP  452 (968)
T ss_pred             hhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhc-cCC
Confidence            8888888999999999999888888888899999999999999888888888999999999999998887777655 688


Q ss_pred             CceEEEcCCCcccccCCccccCCCCCCEEeCCCCcCCCCcCccccccccCccccccCcccCccCCCCCCCcccccceeeE
Q 048402          397 RMVVLILRSNNFHGPLPTRLCDLAFLQILDLADNNLFGTIPKCINNITGMVAANSFTRSSQQYLPLPLDGDVILTEKASV  476 (677)
Q Consensus       397 ~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  476 (677)
                      +|+.|++++|++.+.+|..+ ..++|+.|++++|++.+.+|..+.++++                               
T Consensus       453 ~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~-------------------------------  500 (968)
T PLN00113        453 SLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSE-------------------------------  500 (968)
T ss_pred             CCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhc-------------------------------
Confidence            89999999999888877765 4578999999999988887776655444                               


Q ss_pred             eecCCchhhhhhhccccEEEcccCcccccCCcccCCCCCCcEEeccCCcceeecccccccCCCCcEEECCCCcccccCcc
Q 048402          477 VSEGEAIEYDEILNLVKETDVSRNNLTKSIPLEMTNLKATQSLNFSHNSFTGRIPESIGAMRSLESIDFSVNQLSGEIPQ  556 (677)
Q Consensus       477 ~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~  556 (677)
                                     |+.|++++|++.+.+|..+.++++|++|+|++|.+++.+|..|+++++|++|++++|++++.+|.
T Consensus       501 ---------------L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~  565 (968)
T PLN00113        501 ---------------LMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPK  565 (968)
T ss_pred             ---------------cCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCCh
Confidence                           58999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCCEEEcccCcccccCCCCCCCCCcCcccccCC-CCCCCC
Q 048402          557 SMSNLMSLNHLNLSNNKLTGKIPSSTQLQSFDASSFTGN-DLCGAP  601 (677)
Q Consensus       557 ~l~~l~~L~~L~ls~N~l~~~~p~~~~~~~l~~~~~~~n-~l~~~~  601 (677)
                      .+..+++|++|++++|++.|.+|..+++.++...++.|| .+||.+
T Consensus       566 ~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        566 NLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             hHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            999999999999999999999999988888888889999 688754



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15102 TMEM154: TMEM154 protein family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query677
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-35
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-35
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-11
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-09
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 5e-06
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 2e-05
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-05
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 3e-05
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 3e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 3e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 3e-05
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 147 bits (370), Expect = 3e-35, Method: Compositional matrix adjust. Identities = 184/665 (27%), Positives = 276/665 (41%), Gaps = 109/665 (16%) Query: 4 LEYLSLRNNKLQGTIDSEALGNLTSISRLDLSLNT-GPEGRIPRSMASLCN-LKSINLRG 61 L++L++ +N L L S+ LDLS N+ + ++ C LK + + G Sbjct: 125 LKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISG 184 Query: 62 VHLSQEISEILNIFSGCVSIELESLDLRSSSISGHLTDQLGQFKNLDNLDLANNSIVGPI 121 +S ++ S CV++E LD+ S++ S + LG L +LD++ N + G Sbjct: 185 NKISGDVD-----VSRCVNLEF--LDVSSNNFSTGIP-FLGDCSALQHLDISGNKLSGDF 236 Query: 122 PQSLGHLSNLRVLQIYNNKLNGTLSEIHFSNLTKLSWFRVGGNKLTLEVRHDWIPPF--- 178 +++ + L++L I +N+ G + + L L + + NK T E IP F Sbjct: 237 SRAISTCTELKLLNISSNQFVGPIPPLP---LKSLQYLSLAENKFTGE-----IPDFLSG 288 Query: 179 ---QLVALGFHNCYVGSRFPQWLHSQKHLQYLNLLNSGMSDLFPIRFLKSAFQLKFLDLG 235 L L + P + S L+ L L ++ S P+ L LK LDL Sbjct: 289 ACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLS 348 Query: 236 LNQFHGQITD-LTKVT-QLLFLSVHSNNMSGP-LPLISSN----LVYLDLSNNSFSGSVS 288 N+F G++ + LT ++ LL L + SNN SGP LP + N L L L NN F+G + Sbjct: 349 FNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP 408 Query: 289 ----------------HYLCYRINEPKSLIGL-KLKD-----NSLQGEIPDCWMSYQNLE 326 +YL I P SL L KL+D N L+GEIP M + LE Sbjct: 409 PTLSNCSELVSLHLSFNYLSGTI--PSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLE 466 Query: 327 ILELSNNKFTGKLPNXXXXXXXXXXXXXGKNRLSGTIPVSLKNCTALESLDVGENEFVGN 386 L L N TG++P+ NRL+G IP + L L + N F GN Sbjct: 467 TLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGN 526 Query: 387 IPTWTGERFSRMVVLILRSNNFHGPLPTRLCDLAFLQILDLADNNLFGTIPKCINNITGM 446 IP G D L LDL N GTIP + +G Sbjct: 527 IPAELG-------------------------DCRSLIWLDLNTNLFNGTIPAAMFKQSGK 561 Query: 447 VAANSFTRSSQQYLPLPLDGDVILTEKASVVSEGEAIEYDEILNLVKET----------- 495 +AAN + ++Y+ + DG A + E + I +++ L Sbjct: 562 IAANFI--AGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGG 619 Query: 496 ---------------DVSRNNLTKSIPLEMTNLKATQSLNFSHNSFTGRIPESIGAMRSL 540 D+S N L+ IP E+ ++ LN HN +G IP+ +G +R L Sbjct: 620 HTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGL 679 Query: 541 ESIDFSVNQLSGEIPQXXXXXXXXXXXXXXXXKLTGKIPSSTQLQSFDASSFTGN-DLCG 599 +D S N+L G IPQ L+G IP Q ++F + F N LCG Sbjct: 680 NILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCG 739 Query: 600 APLPK 604 PLP+ Sbjct: 740 YPLPR 744
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query677
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-130
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-101
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-67
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-42
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-32
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-30
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-62
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-60
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-59
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-51
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-40
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-52
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-43
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-43
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-36
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-60
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-51
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-47
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-26
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-24
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-54
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-44
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-41
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-39
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-31
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-28
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-22
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-45
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-33
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-25
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-19
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-39
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-35
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-30
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-24
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-24
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-08
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-14
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-14
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-18
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-08
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-07
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-12
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 5e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 9e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  401 bits (1033), Expect = e-130
 Identities = 164/616 (26%), Positives = 252/616 (40%), Gaps = 73/616 (11%)

Query: 3   HLEYLSLRNNKLQGTIDSEALGNLTSISRLDLSLNTGPEGRIPRSMASLCNLKSINLRGV 62
           +LE+L + +N     I    LG+ +++  LD+S N    G   R++++   LK +N+   
Sbjct: 201 NLEFLDVSSNNFSTGIPF--LGDCSALQHLDISGN-KLSGDFSRAISTCTELKLLNISSN 257

Query: 63  HLSQEISEILNIFSGCVSIELESLDLRSSSISGHLTDQL-GQFKNLDNLDLANNSIVGPI 121
                I           S  L+ L L  +  +G + D L G    L  LDL+ N   G +
Sbjct: 258 QFVGPIPP-----LPLKS--LQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAV 310

Query: 122 PQSLGHLSNLRVLQIYNNKLNGTLSEIHFSNLTKLSWFRVGGNKLTLEVRHDWIPPFQLV 181
           P   G  S L  L + +N  +G L       +  L    +  N+ +       +P     
Sbjct: 311 PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFS-----GELPES--- 362

Query: 182 ALGFHNCYVGSRFPQWLHSQKHLQYLNLLNSGMSDLFPIRFLKSAF-QLKFLDLGLNQFH 240
                N                L  L+L ++  S        ++    L+ L L  N F 
Sbjct: 363 ---LTNL------------SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 407

Query: 241 GQI-TDLTKVTQLLFLSVHSNNMSGPLPL---ISSNLVYLDLSNNSFSGSVSHYLCYRIN 296
           G+I   L+  ++L+ L +  N +SG +P      S L  L L  N   G +   L     
Sbjct: 408 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELM---- 463

Query: 297 EPKSLIGLKLKDNSLQGEIPDCWMSYQNLEILELSNNKFTGKLPNSLGSLTSLIWLLLGK 356
             K+L  L L  N L GEIP    +  NL  + LSNN+ TG++P  +G L +L  L L  
Sbjct: 464 YVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSN 523

Query: 357 NRLSGTIPVSLKNCTALESLDVGENEFVGNIPTWTGERFSRMVVLILRSNNFHGPLPTRL 416
           N  SG IP  L +C +L  LD+  N F G IP    ++        + +N   G     +
Sbjct: 524 NSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQS-----GKIAANFIAGKRYVYI 578

Query: 417 CDLAFLQILDLADN--NLFGTIPKCINNITGMVAANSFTRSSQQYLPLPLDGDVILTEKA 474
            +    +    A N     G   + +N ++                 +            
Sbjct: 579 KNDGMKKECHGAGNLLEFQGIRSEQLNRLSTR-----------NPCNI-----------T 616

Query: 475 SVVSEGEAIEYDEILNLVKETDVSRNNLTKSIPLEMTNLKATQSLNFSHNSFTGRIPESI 534
           S V  G      +    +   D+S N L+  IP E+ ++     LN  HN  +G IP+ +
Sbjct: 617 SRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEV 676

Query: 535 GAMRSLESIDFSVNQLSGEIPQSMSNLMSLNHLNLSNNKLTGKIPSSTQLQSFDASSFTG 594
           G +R L  +D S N+L G IPQ+MS L  L  ++LSNN L+G IP   Q ++F  + F  
Sbjct: 677 GDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLN 736

Query: 595 ND-LCGAPLPKNCAEN 609
           N  LCG PLP+    N
Sbjct: 737 NPGLCGYPLPRCDPSN 752


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query677
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.65
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.6
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.44
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.4
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.37
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.34
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.23
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.15
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.14
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.11
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.7
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.61
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.47
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.41
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.3
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.24
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.02
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.95
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.49
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.28
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.26
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.65
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=4.6e-71  Score=627.36  Aligned_cols=593  Identities=32%  Similarity=0.470  Sum_probs=379.1

Q ss_pred             CCcccEEEccCCCCceecCCc--cccCCCCCCEEecCCCCCCCccCchhh-cCCCCCCEEEccCCcCCcccchh---hhh
Q 048402            1 FIHLEYLSLRNNKLQGTIDSE--ALGNLTSISRLDLSLNTGPEGRIPRSM-ASLCNLKSINLRGVHLSQEISEI---LNI   74 (677)
Q Consensus         1 ~~~L~~L~Ls~n~~~~~i~~~--~~~~l~~L~~L~Ls~~~~~~~~~~~~l-~~l~~L~~L~l~~n~l~~~~~~~---~~~   74 (677)
                      +++|++|+|++|.+.|.+ +.  .++++++|++|+++ ++.+.+..|..+ .++++|++|++++|.+++..+..   +..
T Consensus        99 l~~L~~L~Ls~n~l~~~~-~~~~~l~~l~~L~~L~Ls-~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~  176 (768)
T 3rgz_A           99 SASLTSLDLSRNSLSGPV-TTLTSLGSCSGLKFLNVS-SNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDG  176 (768)
T ss_dssp             CTTCCEEECCSSEEEEEG-GGGGGGGGCTTCCEEECC-SSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTC
T ss_pred             CCCCCEEECCCCcCCCcC-CChHHHhCCCCCCEEECc-CCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhcc
Confidence            467888999999888777 55  78888888888888 666666666655 77888888888888888777665   444


Q ss_pred             ccccCcCCccEEEcccCcCccccccccCCCCCCCEEECcCCccccCCCcCCCCCCCCCEEEccccccccccChhhhhCCC
Q 048402           75 FSGCVSIELESLDLRSSSISGHLTDQLGQFKNLDNLDLANNSIVGPIPQSLGHLSNLRVLQIYNNKLNGTLSEIHFSNLT  154 (677)
Q Consensus        75 l~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~i~~~l~~~~~~~l~  154 (677)
                      ++     +|++|++++|.+++..+  +.++++|++|++++|.+++.+|. ++++++|++|++++|.+++.+|. .+.+++
T Consensus       177 l~-----~L~~L~Ls~n~l~~~~~--~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~-~l~~l~  247 (768)
T 3rgz_A          177 CG-----ELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSR-AISTCT  247 (768)
T ss_dssp             CT-----TCCEEECCSSEEESCCB--CTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHH-HTTTCS
T ss_pred             CC-----CCCEEECCCCcccccCC--cccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccH-HHhcCC
Confidence            44     55566555555554333  24555555555555555544444 55555555555555555544443 455555


Q ss_pred             CCCEEEeeccccc----------------------eecCCCCCCC-cCccEEEeecccCCCCCChhccCCCCCCEEEccC
Q 048402          155 KLSWFRVGGNKLT----------------------LEVRHDWIPP-FQLVALGFHNCYVGSRFPQWLHSQKHLQYLNLLN  211 (677)
Q Consensus       155 ~L~~L~l~~n~l~----------------------~~~~~~~~~~-~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~  211 (677)
                      +|++|++++|.+.                      +..+..+... ++|++|++++|.+.+.+|..++.+++|++|++++
T Consensus       248 ~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~  327 (768)
T 3rgz_A          248 ELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSS  327 (768)
T ss_dssp             SCCEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCS
T ss_pred             CCCEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCC
Confidence            5555555555544                      4444444332 5555555555555555555555555555555555


Q ss_pred             CCCCCccchHHHhccCCccEEECCCccCccccCC-ccccc-cccEEEcccCCCCCCCCCC-----CCCccEEEccCCccc
Q 048402          212 SGMSDLFPIRFLKSAFQLKFLDLGLNQFHGQITD-LTKVT-QLLFLSVHSNNMSGPLPLI-----SSNLVYLDLSNNSFS  284 (677)
Q Consensus       212 n~i~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~-~~~~~-~L~~L~l~~n~~~~~~~~~-----~~~L~~L~l~~n~l~  284 (677)
                      |.+++..|...+..+++|++|++++|.+.+.++. +...+ +|+.|++++|.+.+..|..     +++|++|++++|.++
T Consensus       328 n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~  407 (768)
T 3rgz_A          328 NNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT  407 (768)
T ss_dssp             SEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEE
T ss_pred             CcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccc
Confidence            5555444444334455555555555555543332 22333 5555555555555444332     334566666666655


Q ss_pred             ccCChhHhhccCCCCCcCeEecCCCCCcccCCcccccCCCCceecccCccccccCCcCcCCCCCccEEECcCCcccccCC
Q 048402          285 GSVSHYLCYRINEPKSLIGLKLKDNSLQGEIPDCWMSYQNLEILELSNNKFTGKLPNSLGSLTSLIWLLLGKNRLSGTIP  364 (677)
Q Consensus       285 ~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~  364 (677)
                      +.+|..+..    +++|+.|++++|.+++..|..+..+++|++|++++|.+.+.+|..+..+++|+.|++++|++++..|
T Consensus       408 ~~~p~~l~~----l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p  483 (768)
T 3rgz_A          408 GKIPPTLSN----CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIP  483 (768)
T ss_dssp             EECCGGGGG----CTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCC
T ss_pred             cccCHHHhc----CCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCC
Confidence            555544433    5566666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             ccCcCCCCCCEEecCCCcccccCChhhhhccCCceEEEcCCCcccccCCccccCCCCCCEEeCCCCcCCCCcCccccccc
Q 048402          365 VSLKNCTALESLDVGENEFVGNIPTWTGERFSRMVVLILRSNNFHGPLPTRLCDLAFLQILDLADNNLFGTIPKCINNIT  444 (677)
Q Consensus       365 ~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~~~~l~  444 (677)
                      ..+.++++|++|++++|++.+.+|.++. .+++|++|++++|++++.+|..+..+++|+.|++++|++.|.+|..+....
T Consensus       484 ~~l~~l~~L~~L~L~~N~l~~~~p~~~~-~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~  562 (768)
T 3rgz_A          484 SGLSNCTNLNWISLSNNRLTGEIPKWIG-RLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQS  562 (768)
T ss_dssp             GGGGGCTTCCEEECCSSCCCSCCCGGGG-GCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTT
T ss_pred             HHHhcCCCCCEEEccCCccCCcCChHHh-cCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhccc
Confidence            6666666666666666666656665554 466666666666666666666666666666666666666666666555544


Q ss_pred             cCccccccCcccCccCCC-C-------------CCCcc-----cc-----cceeeEeecCCchhhhhhhccccEEEcccC
Q 048402          445 GMVAANSFTRSSQQYLPL-P-------------LDGDV-----IL-----TEKASVVSEGEAIEYDEILNLVKETDVSRN  500 (677)
Q Consensus       445 ~l~~~~~~~~~~~~~~~~-~-------------~~~~~-----~~-----~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n  500 (677)
                      .+................ .             +.+..     ..     .........+..+..+..+++|+.||+++|
T Consensus       563 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N  642 (768)
T 3rgz_A          563 GKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYN  642 (768)
T ss_dssp             TCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSS
T ss_pred             chhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCC
Confidence            443322211000000000 0             00000     00     000001112333445566889999999999


Q ss_pred             cccccCCcccCCCCCCcEEeccCCcceeecccccccCCCCcEEECCCCcccccCccccccCCCCCEEEcccCcccccCCC
Q 048402          501 NLTKSIPLEMTNLKATQSLNFSHNSFTGRIPESIGAMRSLESIDFSVNQLSGEIPQSMSNLMSLNHLNLSNNKLTGKIPS  580 (677)
Q Consensus       501 ~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~~~~p~  580 (677)
                      +++|.+|..++++++|+.|+|++|+++|.+|+.++++++|++|||++|++++.+|..++.+++|++||+++|+++|.+|.
T Consensus       643 ~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~  722 (768)
T 3rgz_A          643 MLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE  722 (768)
T ss_dssp             CCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCS
T ss_pred             cccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCcCcccccCC-CCCCCCCCCCCCCCC
Q 048402          581 STQLQSFDASSFTGN-DLCGAPLPKNCAENV  610 (677)
Q Consensus       581 ~~~~~~l~~~~~~~n-~l~~~~~~~~c~~~~  610 (677)
                      ..++.++...+|.|| .+||.|+. .|....
T Consensus       723 ~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~  752 (768)
T 3rgz_A          723 MGQFETFPPAKFLNNPGLCGYPLP-RCDPSN  752 (768)
T ss_dssp             SSSGGGSCGGGGCSCTEEESTTSC-CCCSCC
T ss_pred             chhhccCCHHHhcCCchhcCCCCc-CCCCCc
Confidence            999999999999999 89999987 886443



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 677
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-19
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 9e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.001
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 86.7 bits (213), Expect = 3e-19
 Identities = 63/285 (22%), Positives = 107/285 (37%), Gaps = 28/285 (9%)

Query: 324 NLEILELSNNKFTGK--LPNSLGSLTSLIWLLLGKN-RLSGTIPVSLKNCTALESLDVGE 380
            +  L+LS         +P+SL +L  L +L +G    L G IP ++   T L  L +  
Sbjct: 51  RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITH 110

Query: 381 NEFVGNIPTWTGERFSRMVVLILRSNNFHGPLPTRLCDLAFLQILDLADNNLFGTIPKCI 440
               G IP +  +  + + +     N   G LP  +  L  L  +    N + G IP   
Sbjct: 111 TNVSGAIPDFLSQIKTLVTLDFSY-NALSGTLPPSISSLPNLVGITFDGNRISGAIPDSY 169

Query: 441 NNITGMVAANSFTRSSQQYLPLPLDGDVILTEKASVVSEGEAIEYDEILNLVKETDVSRN 500
            + + +  + + +R+                                  NL         
Sbjct: 170 GSFSKLFTSMTISRNRLTG-----------------------KIPPTFANLNLAFVDLSR 206

Query: 501 NLTKSIPLEMTNLKATQSLNFSHNSFTGRIPESIGAMRSLESIDFSVNQLSGEIPQSMSN 560
           N+ +     +              +        +G  ++L  +D   N++ G +PQ ++ 
Sbjct: 207 NMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQ 266

Query: 561 LMSLNHLNLSNNKLTGKIPSSTQLQSFDASSFTGND-LCGAPLPK 604
           L  L+ LN+S N L G+IP    LQ FD S++  N  LCG+PLP 
Sbjct: 267 LKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLPA 311


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query677
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.8
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.3
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.17
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.11
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.91
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.7
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.41
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.06
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.97  E-value=6.4e-31  Score=263.26  Aligned_cols=258  Identities=29%  Similarity=0.513  Sum_probs=226.3

Q ss_pred             CCcCeEecCCCCCcc--cCCcccccCCCCceecccC-ccccccCCcCcCCCCCccEEECcCCcccccCCccCcCCCCCCE
Q 048402          299 KSLIGLKLKDNSLQG--EIPDCWMSYQNLEILELSN-NKFTGKLPNSLGSLTSLIWLLLGKNRLSGTIPVSLKNCTALES  375 (677)
Q Consensus       299 ~~L~~L~l~~n~l~~--~~~~~~~~l~~L~~L~L~~-n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~  375 (677)
                      ..+++|+++++.+.+  .+|..++++++|++|+|++ |.+.+.+|..|+++++|++|++++|++.+..+..+..+.+|+.
T Consensus        50 ~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~  129 (313)
T d1ogqa_          50 YRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVT  129 (313)
T ss_dssp             CCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCE
T ss_pred             EEEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcc
Confidence            357788888888776  4778899999999999986 7888888999999999999999999999888888888999999


Q ss_pred             EecCCCcccccCChhhhhccCCceEEEcCCCcccccCCccccCCCCC-CEEeCCCCcCCCCcCccccccccCccccccCc
Q 048402          376 LDVGENEFVGNIPTWTGERFSRMVVLILRSNNFHGPLPTRLCDLAFL-QILDLADNNLFGTIPKCINNITGMVAANSFTR  454 (677)
Q Consensus       376 L~l~~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L-~~L~Ls~n~l~~~~p~~~~~l~~l~~~~~~~~  454 (677)
                      +++++|.+.+.+|..+. .++.++.+++++|.+.+.+|..+..+..+ +.+++++|++++..|..+.++..         
T Consensus       130 l~l~~N~~~~~~p~~l~-~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~---------  199 (313)
T d1ogqa_         130 LDFSYNALSGTLPPSIS-SLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNL---------  199 (313)
T ss_dssp             EECCSSEEESCCCGGGG-GCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCC---------
T ss_pred             cccccccccccCchhhc-cCcccceeecccccccccccccccccccccccccccccccccccccccccccc---------
Confidence            99999988888888776 78999999999999998888888888776 88999999998877776554332         


Q ss_pred             ccCccCCCCCCCcccccceeeEeecCCchhhhhhhccccEEEcccCcccccCCcccCCCCCCcEEeccCCcceeeccccc
Q 048402          455 SSQQYLPLPLDGDVILTEKASVVSEGEAIEYDEILNLVKETDVSRNNLTKSIPLEMTNLKATQSLNFSHNSFTGRIPESI  534 (677)
Q Consensus       455 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~~  534 (677)
                                                            ..++++++...+.+|..+..+++++.+++++|.+.+.+| .+
T Consensus       200 --------------------------------------~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~  240 (313)
T d1ogqa_         200 --------------------------------------AFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KV  240 (313)
T ss_dssp             --------------------------------------SEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GC
T ss_pred             --------------------------------------ccccccccccccccccccccccccccccccccccccccc-cc
Confidence                                                  568999999999999999999999999999999996655 68


Q ss_pred             ccCCCCcEEECCCCcccccCccccccCCCCCEEEcccCcccccCCCCCCCCCcCcccccCC-CCCCCCCCCCC
Q 048402          535 GAMRSLESIDFSVNQLSGEIPQSMSNLMSLNHLNLSNNKLTGKIPSSTQLQSFDASSFTGN-DLCGAPLPKNC  606 (677)
Q Consensus       535 ~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~~l~~~~~~~n-~l~~~~~~~~c  606 (677)
                      +.+++|+.|++++|++++.+|+.|+++++|++|||++|+++|.+|+...+..++.+++.+| .+||.|++ .|
T Consensus       241 ~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~plp-~c  312 (313)
T d1ogqa_         241 GLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP-AC  312 (313)
T ss_dssp             CCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTTSS-CC
T ss_pred             ccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCccccCCCCC-CC
Confidence            8999999999999999999999999999999999999999999999888899999999999 59998864 44



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure