Citrus Sinensis ID: 048433


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MSFVFRGTRGDIESGFPGFIAEQPAVRIHATRPVNVNSLAFLVIVLLLFMILNSHQMSPNFLLWLVVGVFLIATSLRMYATCQQLQAQARAHAAAASGLLSHTELRLHVPPSIAFATRGRLQGLRLQLALLDREFDELDYDTLRALDSDNTSTTPSMSEEEINSLPVHKYKVPGPASESVGSSIRQPSSSAATPEQSKQESKKADGSTKSSEDELTCTICLEQVKCGELVRSLPCLHQFHANCIDPWLRQRGTCPVCKFRMGSGWQENRESESDSSDMV
ccEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccEEEEEEEEEcccHHHHHHHHHHHcccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccHHHHHccccEEEEcccccccccccccccccccccccccHHHHHcccccccccccccccccEEccccccccEEEEcccccccccccHHHHHHcccccccccccccccccccccccccccccc
ccEEEEcccccHccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccHHHHccHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccccccccHHHHHHccccEEEEEccccccccccccccccHHHHHHHccEEEcccccEEEccccccEEEEEHHHcccccHHcEccccccccHHHHHHHHHHcccccEEEEEccccccccccccccccccc
msfvfrgtrgdiesgfpgfiaeqpavrihatrpvnVNSLAFLVIVLLLFMILNSHQMSPNFLLWLVVGVFLIATSLRMYATCQQLQAQARAHAAAASGLLShtelrlhvppsiafatRGRLQGLRLQLALLDREFDELDYDtlraldsdntsttpsmseeeinslpvhkykvpgpasesvgssirqpsssaatpeqskqeskkadgstkssedeltcticleqvkcgelvrslpclhqfhancidpwlrqrgtcpvckfrmgsgwqenresesdssdmv
msfvfrgtrgdiesgfpgFIAEQPAVRIHATRPVNVNSLAFLVIVLLLFMILNSHQMSPNFLLWLVVGVFLIATSLRMYATCQQLQAQARAHAAAASGLLSHTELRLHVPPSIAFATRGRLQGLRLQLALLDREFDELDYDTLRaldsdntsttpsmseeeinslPVHKYKVPGPASESvgssirqpsssaatpeqskqeskkadgstkssedelTCTICLEQVKCGELVRSLPCLHQFHANCIDPWLRQRGTCPVCKFRmgsgwqenresesdssdmv
MSFVFRGTRGDIESGFPGFIAEQPAVRIHATRPVNVNSlaflvivlllfmilNSHQMSPNFLLWLVVGVFLIATSLRMYATCqqlqaqarahaaaaSGLLSHTELRLHVPPSIAFATrgrlqglrlqlallDREFDELDYDTLRALDSDNTSTTPSMSEEEINSLPVHKYKVPGPASESVGSSIRQPSSSAATPEQSKQESKKADGSTKSSEDELTCTICLEQVKCGELVRSLPCLHQFHANCIDPWLRQRGTCPVCKFRMGSGWQENRESESDSSDMV
****FRGTRGDIESGFPGFIAEQPAVRIHATRPVNVNSLAFLVIVLLLFMILNSHQMSPNFLLWLVVGVFLIATSLRMYATCQQLQAQARAHAAAASGLLSHTELRLHVPPSIAFATRGRLQGLRLQLALLDREFDELDYDTLR**********************************************************************LTCTICLEQVKCGELVRSLPCLHQFHANCIDPWLRQRGTCPVCKFRMGS****************
*SFVFR*TRGDIESGFPGFIAEQPA***********NSLAFLVIVLLLFMILNSHQMSPNFLLWLVVGVFLIATSLRMYA**************************LHVP***********************EFDELDY*************************************************************************ELTCTICLEQVKCGELVRSLPCLHQFHANCIDPWLRQRGTCPVC**********************
MSFVFRGTRGDIESGFPGFIAEQPAVRIHATRPVNVNSLAFLVIVLLLFMILNSHQMSPNFLLWLVVGVFLIATSLRMYATCQQ************SGLLSHTELRLHVPPSIAFATRGRLQGLRLQLALLDREFDELDYDTLRALDSD************INSLPVHKYKV******************************************LTCTICLEQVKCGELVRSLPCLHQFHANCIDPWLRQRGTCPVCKFRMGSG***************
*SFVFRGTRGDIESGFPGFIAEQPAVRIHATRPVNVNSLAFLVIVLLLFMILNSHQMSPNFLLWLVVGVFLIATSLRMYATCQQLQAQARAHAAAASGLLSHTELRLHVPPSIAFATRGRLQGLRLQLALLDREFDELDYDTLRALDSDNTSTTPSMSEEEINSLPVHKYKVPGPA*********Q*SSSAATPEQSKQESKKADGSTKSSEDELTCTICLEQVKCGELVRSLPCLHQFHANCIDPWLRQRGTCPVCKFRMGS****************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFVFRGTRGDIESGFPGFIAEQPAVRIHATRPVNVNSLAFLVIVLLLFMILNSHQMSPNFLLWLVVGVFLIATSLRMYATCQQLQAQARAHAAAASGLLSHTELRLHVPPSIAFATRGRLQGLRLQLALLDREFDELDYDTLRALDSDNTSTTPSMSEEEINSLPVHKYKVPGPASESVGSSIRQPSSSAATPEQSKQESKKADGSTKSSEDELTCTICLEQVKCGELVRSLPCLHQFHANCIDPWLRQRGTCPVCKFRMGSGWQENRESESDSSDMV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query279 2.2.26 [Sep-21-2011]
Q9M2S6273 E3 ubiquitin-protein liga yes no 0.974 0.996 0.732 1e-109
Q9C1X4513 Uncharacterized RING fing yes no 0.236 0.128 0.424 2e-11
Q6AY01381 E3 ubiquitin-protein liga yes no 0.254 0.186 0.452 7e-11
Q8VEM1419 E3 ubiquitin-protein liga yes no 0.258 0.171 0.378 1e-10
Q6Y290419 E3 ubiquitin-protein liga no no 0.258 0.171 0.378 1e-10
Q9ULK6438 RING finger protein 150 O yes no 0.207 0.132 0.466 1e-10
Q06003461 Protein goliath OS=Drosop no no 0.222 0.134 0.451 1e-10
Q86XS8419 E3 ubiquitin-protein liga no no 0.258 0.171 0.378 2e-10
Q68DV7 783 E3 ubiquitin-protein liga no no 0.240 0.085 0.417 2e-10
Q90972381 E3 ubiquitin-protein liga no no 0.240 0.175 0.420 2e-10
>sp|Q9M2S6|SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana GN=SDIR1 PE=1 SV=1 Back     alignment and function desciption
 Score =  393 bits (1010), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/280 (73%), Positives = 236/280 (84%), Gaps = 8/280 (2%)

Query: 1   MSFVFRGTRGDIESGFPG-FIAEQPAVRIHATRPVNVNSLAFLVIVLLLFMILNSHQMSP 59
           MSFVFRG+RGD+ESGF G F+ E+ A+R+H  RPVN NSLAFLV VLLLFMILNSHQM P
Sbjct: 1   MSFVFRGSRGDLESGFSGGFLPERRAMRVHGARPVNSNSLAFLVTVLLLFMILNSHQMPP 60

Query: 60  NFLLWLVVGVFLIATSLRMYATCQQLQAQARAHAAAASGLLSHTELRLHVPPSIAFATRG 119
           NFLLWLV+GVFL+AT+LRMYATCQQLQA A+A AAAASGL SHTELRLHVPPSIA ATRG
Sbjct: 61  NFLLWLVLGVFLMATTLRMYATCQQLQAHAQAQAAAASGLFSHTELRLHVPPSIALATRG 120

Query: 120 RLQGLRLQLALLDREFDELDYDTLRALDSDNTSTTPSMSEEEINSLPVHKYKVPGPASES 179
           RLQGLRLQLALLDREFD+LDY+TLRALDSDN STT SMSEEEIN+LPVHKYKV  P +  
Sbjct: 121 RLQGLRLQLALLDREFDDLDYETLRALDSDNVSTT-SMSEEEINALPVHKYKVLDPEN-- 177

Query: 180 VGSSIRQPSSSAATPEQSKQESKKADGSTKSSEDELTCTICLEQVKCGELVRSLPCLHQF 239
            G S+ + +S++++ E+       A+ S K +EDELTC++CLEQV  GE+VR+LPCLHQF
Sbjct: 178 -GCSLAKQASTSSSAEKMLD---SANESKKGTEDELTCSVCLEQVTVGEIVRTLPCLHQF 233

Query: 240 HANCIDPWLRQRGTCPVCKFRMGSGWQENRESESDSSDMV 279
           HA CIDPWLRQ+GTCPVCKFR  SGWQE  E + D+SDMV
Sbjct: 234 HAGCIDPWLRQQGTCPVCKFRAHSGWQEQDEIDDDASDMV 273




E3 ubiquitin-protein ligase that acts as a positive regulator of abscisic acid-related stress signal transduction.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9C1X4|YKW3_SCHPO Uncharacterized RING finger protein P32A8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP32A8.03c PE=4 SV=1 Back     alignment and function description
>sp|Q6AY01|RN133_RAT E3 ubiquitin-protein ligase RNF133 OS=Rattus norvegicus GN=Rnf133 PE=2 SV=1 Back     alignment and function description
>sp|Q8VEM1|GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus GN=Rnf130 PE=2 SV=1 Back     alignment and function description
>sp|Q6Y290|GOLI_RAT E3 ubiquitin-protein ligase RNF130 OS=Rattus norvegicus GN=Rnf130 PE=1 SV=1 Back     alignment and function description
>sp|Q9ULK6|RN150_HUMAN RING finger protein 150 OS=Homo sapiens GN=RNF150 PE=2 SV=2 Back     alignment and function description
>sp|Q06003|GOLI_DROME Protein goliath OS=Drosophila melanogaster GN=gol PE=2 SV=3 Back     alignment and function description
>sp|Q86XS8|GOLI_HUMAN E3 ubiquitin-protein ligase RNF130 OS=Homo sapiens GN=RNF130 PE=1 SV=1 Back     alignment and function description
>sp|Q68DV7|RNF43_HUMAN E3 ubiquitin-protein ligase RNF43 OS=Homo sapiens GN=RNF43 PE=1 SV=1 Back     alignment and function description
>sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
224104393275 predicted protein [Populus trichocarpa] 0.985 1.0 0.827 1e-123
359478923279 PREDICTED: E3 ubiquitin-protein ligase S 0.996 0.996 0.778 1e-115
255559032 397 protein binding protein, putative [Ricin 0.971 0.682 0.723 1e-112
359486786275 PREDICTED: E3 ubiquitin-protein ligase S 0.985 1.0 0.749 1e-111
449441410275 PREDICTED: E3 ubiquitin-protein ligase S 0.971 0.985 0.764 1e-110
307136233275 protein binding protein [Cucumis melo su 0.971 0.985 0.764 1e-110
297820308272 zinc finger family protein [Arabidopsis 0.974 1.0 0.749 1e-108
363807434274 uncharacterized protein LOC100816448 [Gl 0.982 1.0 0.734 1e-108
15233298273 E3 ubiquitin-protein ligase SDIR1 [Arabi 0.974 0.996 0.732 1e-107
242041429280 hypothetical protein SORBIDRAFT_01g03974 0.978 0.975 0.681 1e-106
>gi|224104393|ref|XP_002313422.1| predicted protein [Populus trichocarpa] gi|222849830|gb|EEE87377.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  446 bits (1147), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 231/279 (82%), Positives = 252/279 (90%), Gaps = 4/279 (1%)

Query: 1   MSFVFRGTRGDIESGFPGFIAEQPAVRIHATRPVNVNSLAFLVIVLLLFMILNSHQMSPN 60
           MSFVFRG+RGDIESGF GFI E+PAVRIHA RPVN NSLAFLV VLLLFMILNSHQMSPN
Sbjct: 1   MSFVFRGSRGDIESGFSGFIPERPAVRIHAARPVNSNSLAFLVTVLLLFMILNSHQMSPN 60

Query: 61  FLLWLVVGVFLIATSLRMYATCQQLQAQARAHAAAASGLLSHTELRLHVPPSIAFATRGR 120
           FLLWLVVGVFL+ATSLRMYATCQQLQAQARAHAAAASGL+ HTELRLH+PPSIAFATRGR
Sbjct: 61  FLLWLVVGVFLMATSLRMYATCQQLQAQARAHAAAASGLMGHTELRLHMPPSIAFATRGR 120

Query: 121 LQGLRLQLALLDREFDELDYDTLRALDSDNTSTTPSMSEEEINSLPVHKYKVPGPASESV 180
           LQGLRLQLALLDREFD+LDYDTLRALDS N STT SM+EEEIN+LPVHKYKVP    +  
Sbjct: 121 LQGLRLQLALLDREFDDLDYDTLRALDSGNASTT-SMTEEEINALPVHKYKVP---VQEN 176

Query: 181 GSSIRQPSSSAATPEQSKQESKKADGSTKSSEDELTCTICLEQVKCGELVRSLPCLHQFH 240
           GS+  Q +SS++ P ++KQ+SK ADG+ K+SEDELTCTICLEQV  GELVRSLPCLHQFH
Sbjct: 177 GSASLQHASSSSAPAETKQDSKNADGNMKTSEDELTCTICLEQVNRGELVRSLPCLHQFH 236

Query: 241 ANCIDPWLRQRGTCPVCKFRMGSGWQENRESESDSSDMV 279
            NCIDPWLRQ+GTCPVCKF +GSGWQE+RESESD SDMV
Sbjct: 237 TNCIDPWLRQQGTCPVCKFLIGSGWQESRESESDGSDMV 275




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359478923|ref|XP_002283232.2| PREDICTED: E3 ubiquitin-protein ligase SDIR1 [Vitis vinifera] gi|297746043|emb|CBI16099.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255559032|ref|XP_002520539.1| protein binding protein, putative [Ricinus communis] gi|223540381|gb|EEF41952.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359486786|ref|XP_002283148.2| PREDICTED: E3 ubiquitin-protein ligase SDIR1-like [Vitis vinifera] gi|296086209|emb|CBI31650.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449441410|ref|XP_004138475.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|307136233|gb|ADN34069.1| protein binding protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|297820308|ref|XP_002878037.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297323875|gb|EFH54296.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|363807434|ref|NP_001242131.1| uncharacterized protein LOC100816448 [Glycine max] gi|255641194|gb|ACU20874.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|15233298|ref|NP_191112.1| E3 ubiquitin-protein ligase SDIR1 [Arabidopsis thaliana] gi|75311810|sp|Q9M2S6.1|SDIR1_ARATH RecName: Full=E3 ubiquitin-protein ligase SDIR1; AltName: Full=Protein salt- and drought-induced RING finger1 gi|14423516|gb|AAK62440.1|AF386995_1 putative protein [Arabidopsis thaliana] gi|7076796|emb|CAB75911.1| putative protein [Arabidopsis thaliana] gi|30023760|gb|AAP13413.1| At3g55530 [Arabidopsis thaliana] gi|222423557|dbj|BAH19748.1| AT3G55530 [Arabidopsis thaliana] gi|332645876|gb|AEE79397.1| E3 ubiquitin-protein ligase SDIR1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|242041429|ref|XP_002468109.1| hypothetical protein SORBIDRAFT_01g039740 [Sorghum bicolor] gi|241921963|gb|EER95107.1| hypothetical protein SORBIDRAFT_01g039740 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
TAIR|locus:2100021273 SDIR1 "SALT- AND DROUGHT-INDUC 0.974 0.996 0.596 7.2e-84
UNIPROTKB|G4N652 526 MGG_08571 "RING-7 protein" [Ma 0.480 0.254 0.335 1.3e-15
TAIR|locus:2010582634 AT1G04790 [Arabidopsis thalian 0.186 0.082 0.547 5.2e-15
DICTYBASE|DDB_G0282479320 DDB_G0282479 "E3 ubiquitin-pro 0.164 0.143 0.391 1.4e-12
DICTYBASE|DDB_G0293132766 DDB_G0293132 "E3 ubiquitin-pro 0.394 0.143 0.325 3.3e-12
UNIPROTKB|D6RIE5230 RNF150 "RING finger protein 15 0.207 0.252 0.466 9.1e-12
UNIPROTKB|J3KSE3 742 RNF43 "E3 ubiquitin-protein li 0.333 0.125 0.367 1e-11
UNIPROTKB|Q68DV7 783 RNF43 "E3 ubiquitin-protein li 0.333 0.118 0.367 1.1e-11
UNIPROTKB|I3LB70577 LOC100738472 "Uncharacterized 0.189 0.091 0.438 2e-11
UNIPROTKB|F1S6C0141 LOC100620409 "Uncharacterized 0.308 0.609 0.395 2.2e-11
TAIR|locus:2100021 SDIR1 "SALT- AND DROUGHT-INDUCED RING FINGER1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 840 (300.8 bits), Expect = 7.2e-84, P = 7.2e-84
 Identities = 167/280 (59%), Positives = 197/280 (70%)

Query:     1 MSFVFRGTRGDIESGFPG-FIAEQPAVRIHATRPVNVNSXXXXXXXXXXXXXXNSHQMSP 59
             MSFVFRG+RGD+ESGF G F+ E+ A+R+H  RPVN NS              NSHQM P
Sbjct:     1 MSFVFRGSRGDLESGFSGGFLPERRAMRVHGARPVNSNSLAFLVTVLLLFMILNSHQMPP 60

Query:    60 NFLLWLVVGVFLIATSLRMYATCXXXXXXXXXXXXXXSGLLSHTELRLHVPPSIAFATXX 119
             NFLLWLV+GVFL+AT+LRMYATC              SGL SHTELRLHVPPSIA AT  
Sbjct:    61 NFLLWLVLGVFLMATTLRMYATCQQLQAHAQAQAAAASGLFSHTELRLHVPPSIALATRG 120

Query:   120 XXXXXXXXXXXXDREFDELDYDTLRALDSDNTSTTPSMSEEEINSLPVHKYKVPGPASES 179
                         DREFD+LDY+TLRALDSDN STT SMSEEEIN+LPVHKYKV  P +  
Sbjct:   121 RLQGLRLQLALLDREFDDLDYETLRALDSDNVSTT-SMSEEEINALPVHKYKVLDPEN-- 177

Query:   180 VGSSIRQPSSSAATPEQSKQESKKADGSTKSSEDELTCTICLEQVKCGELVRSLPCLHQF 239
              G S+ + +S++++ E+       A+ S K +EDELTC++CLEQV  GE+VR+LPCLHQF
Sbjct:   178 -GCSLAKQASTSSSAEKMLDS---ANESKKGTEDELTCSVCLEQVTVGEIVRTLPCLHQF 233

Query:   240 HANCIDPWLRQRGTCPVCKFRMGSGWQENRESESDSSDMV 279
             HA CIDPWLRQ+GTCPVCKFR  SGWQE  E + D+SDMV
Sbjct:   234 HAGCIDPWLRQQGTCPVCKFRAHSGWQEQDEIDDDASDMV 273




GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0009414 "response to water deprivation" evidence=IEP
GO:0009651 "response to salt stress" evidence=IEP
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0009789 "positive regulation of abscisic acid mediated signaling pathway" evidence=IMP
GO:0016567 "protein ubiquitination" evidence=IDA
GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA
GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA
GO:0006301 "postreplication repair" evidence=RCA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0009086 "methionine biosynthetic process" evidence=RCA
UNIPROTKB|G4N652 MGG_08571 "RING-7 protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TAIR|locus:2010582 AT1G04790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282479 DDB_G0282479 "E3 ubiquitin-protein ligase DMA2" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0293132 DDB_G0293132 "E3 ubiquitin-protein ligase Arkadia" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|D6RIE5 RNF150 "RING finger protein 150" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KSE3 RNF43 "E3 ubiquitin-protein ligase RNF43" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q68DV7 RNF43 "E3 ubiquitin-protein ligase RNF43" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LB70 LOC100738472 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1S6C0 LOC100620409 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M2S6SDIR1_ARATH6, ., 3, ., 2, ., -0.73210.97490.9963yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pm.C_LG_IX0591
hypothetical protein (275 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 6e-16
cd0016245 cd00162, RING, RING-finger (Really Interesting New 3e-11
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-09
smart0018440 smart00184, RING, Ring finger 2e-09
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 1e-08
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 1e-08
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 2e-07
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 5e-07
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 1e-04
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 2e-04
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 2e-04
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 0.003
pfam01292140 pfam01292, Ni_hydr_CYTB, Prokaryotic cytochrome b5 0.003
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 0.004
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
 Score = 69.7 bits (171), Expect = 6e-16
 Identities = 22/43 (51%), Positives = 28/43 (65%)

Query: 216 TCTICLEQVKCGELVRSLPCLHQFHANCIDPWLRQRGTCPVCK 258
            C ICL++ + GE V  LPC H FH  C+D WLR   TCP+C+
Sbjct: 2   ECPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCR 44


Length = 46

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|216416 pfam01292, Ni_hydr_CYTB, Prokaryotic cytochrome b561 Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 279
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.62
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.51
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.25
PHA02929238 N1R/p28-like protein; Provisional 99.2
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 99.16
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.14
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.13
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.11
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.1
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.09
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.02
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.01
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.01
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.94
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.88
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.85
PHA02926242 zinc finger-like protein; Provisional 98.82
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.82
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.78
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.77
PF1463444 zf-RING_5: zinc-RING finger domain 98.76
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.69
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.68
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.5
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.46
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.42
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.39
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.38
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.34
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.31
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.31
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 98.3
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.27
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.24
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.22
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.22
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 98.19
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.17
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.15
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.14
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.95
COG52191525 Uncharacterized conserved protein, contains RING Z 97.94
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.92
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.88
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.8
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.79
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.7
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.64
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.6
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.38
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.36
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.33
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.25
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.17
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.09
KOG1941518 consensus Acetylcholine receptor-associated protei 97.05
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 97.04
KOG2660 331 consensus Locus-specific chromosome binding protei 97.01
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.88
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.84
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.74
COG5152259 Uncharacterized conserved protein, contains RING a 96.62
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.57
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 96.31
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 96.25
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 96.22
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.22
PHA02862156 5L protein; Provisional 95.96
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 95.92
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 95.86
KOG1002 791 consensus Nucleotide excision repair protein RAD16 95.85
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 95.8
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.79
PHA02825162 LAP/PHD finger-like protein; Provisional 95.61
COG5175 480 MOT2 Transcriptional repressor [Transcription] 95.5
PHA03096284 p28-like protein; Provisional 95.48
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 95.45
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 95.42
KOG4739 233 consensus Uncharacterized protein involved in syna 95.08
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 94.98
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 94.89
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 94.67
COG5222427 Uncharacterized conserved protein, contains RING Z 94.58
KOG3002 299 consensus Zn finger protein [General function pred 94.48
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 94.3
PF04641260 Rtf2: Rtf2 RING-finger 94.25
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 94.13
KOG0825 1134 consensus PHD Zn-finger protein [General function 94.06
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 94.0
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 93.86
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 93.82
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 93.53
KOG1940276 consensus Zn-finger protein [General function pred 93.01
KOG0298 1394 consensus DEAD box-containing helicase-like transc 91.93
KOG4367 699 consensus Predicted Zn-finger protein [Function un 91.89
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 91.84
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 91.7
PF10272358 Tmpp129: Putative transmembrane protein precursor; 91.25
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 90.87
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 90.07
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 89.84
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 89.74
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 89.63
KOG03091081 consensus Conserved WD40 repeat-containing protein 89.35
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 88.44
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 87.56
KOG1609 323 consensus Protein involved in mRNA turnover and st 87.07
KOG3053 293 consensus Uncharacterized conserved protein [Funct 86.72
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 86.71
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 85.85
KOG3899381 consensus Uncharacterized conserved protein [Funct 85.68
PLN02189 1040 cellulose synthase 85.68
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 84.66
PLN02436 1094 cellulose synthase A 81.96
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 81.83
KOG0269839 consensus WD40 repeat-containing protein [Function 81.75
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 81.3
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 81.24
KOG1829580 consensus Uncharacterized conserved protein, conta 81.11
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.62  E-value=2.2e-15  Score=140.08  Aligned_cols=59  Identities=51%  Similarity=0.994  Sum_probs=53.1

Q ss_pred             ccccccccccccCceeEEeCCCCcccHhhHHHHHhcCCC-CcccccccCCCCCCCCCCCC
Q 048433          215 LTCTICLEQVKCGELVRSLPCLHQFHANCIDPWLRQRGT-CPVCKFRMGSGWQENRESES  273 (279)
Q Consensus       215 ~~C~ICle~~~~~~~v~~LpC~H~Fh~~CI~~WL~~~~~-CP~CR~~i~~~~~~~~~~~~  273 (279)
                      .+|+||+|+|++|+.++.|||+|.||..||++||.+..+ ||+||+.+.........+|+
T Consensus       230 ~~CaIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~~r~~CPvCK~di~~~~~~~~~~e~  289 (348)
T KOG4628|consen  230 DTCAICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQTRTFCPVCKRDIRTDSGSEPVSED  289 (348)
T ss_pred             ceEEEeecccccCCeeeEecCCCchhhccchhhHhhcCccCCCCCCcCCCCCCCCCccCC
Confidence            489999999999999999999999999999999998755 99999999988877666663



>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 8e-09
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 7e-08
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 3e-07
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 6e-07
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 1e-06
2ecn_A70 Solution Structure Of The Ring Domain Of The Human 7e-05
1chc_A68 Structure Of The C3hc4 Domain By 1h-Nuclear Magneti 1e-04
4ayc_B138 Rnf8 Ring Domain Structure Length = 138 1e-04
4ayc_A138 Rnf8 Ring Domain Structure Length = 138 2e-04
4epo_C149 Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE 2e-04
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 4e-04
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure

Iteration: 1

Score = 57.4 bits (137), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 26/58 (44%), Positives = 33/58 (56%) Query: 201 SKKADGSTKSSEDELTCTICLEQVKCGELVRSLPCLHQFHANCIDPWLRQRGTCPVCK 258 S + G+ + L C +C E GE VR LPC H FH +CI PWL Q +CPVC+ Sbjct: 2 SSGSSGTEEHVGSGLECPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCPVCR 59
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure
>pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 Back     alignment and structure
>pdb|1CHC|A Chain A, Structure Of The C3hc4 Domain By 1h-Nuclear Magnetic Resonance Spectroscopy; A New Structural Class Of Zinc- Finger Length = 68 Back     alignment and structure
>pdb|4AYC|B Chain B, Rnf8 Ring Domain Structure Length = 138 Back     alignment and structure
>pdb|4AYC|A Chain A, Rnf8 Ring Domain Structure Length = 138 Back     alignment and structure
>pdb|4EPO|C Chain C, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 5e-26
2ect_A78 Ring finger protein 126; metal binding protein, st 8e-26
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 3e-25
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 8e-25
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 2e-23
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 6e-21
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 3e-19
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 3e-19
2ecm_A55 Ring finger and CHY zinc finger domain- containing 4e-17
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 2e-15
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 2e-14
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-14
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 7e-14
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 6e-11
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 6e-11
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 8e-11
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 2e-10
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 3e-10
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 3e-10
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 5e-10
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 7e-10
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 8e-10
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 9e-10
1z6u_A150 NP95-like ring finger protein isoform B; structura 2e-09
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 3e-09
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 1e-06
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 6e-09
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-08
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 6e-08
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 1e-07
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 4e-07
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 4e-07
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 7e-07
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 8e-07
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-06
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 2e-06
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 2e-06
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 2e-06
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 3e-06
2ysl_A73 Tripartite motif-containing protein 31; ring-type 4e-06
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 5e-06
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 5e-06
3nw0_A238 Non-structural maintenance of chromosomes element 7e-06
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 7e-06
2ecw_A85 Tripartite motif-containing protein 30; metal bind 8e-06
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 1e-05
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 1e-05
2ysj_A63 Tripartite motif-containing protein 31; ring-type 1e-05
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 3e-05
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 3e-05
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 4e-05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 5e-05
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 7e-05
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 1e-04
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 6e-04
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 7e-04
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
 Score = 96.3 bits (240), Expect = 5e-26
 Identities = 24/58 (41%), Positives = 32/58 (55%)

Query: 202 KKADGSTKSSEDELTCTICLEQVKCGELVRSLPCLHQFHANCIDPWLRQRGTCPVCKF 259
           K+        + E  CTICL  ++ GE VR LPC+H FH  C+D WL     CP+C+ 
Sbjct: 2   KQDGEEGTEEDTEEKCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRV 59


>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.68
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.62
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.58
2ect_A78 Ring finger protein 126; metal binding protein, st 99.58
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.56
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.53
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.46
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.45
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.45
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.45
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.44
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.44
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.41
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.41
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.39
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.37
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.37
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.36
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.35
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.34
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.32
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.32
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.32
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.3
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.26
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.24
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.24
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.23
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.23
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.23
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.22
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.22
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.21
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.2
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.19
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.19
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.19
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.19
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.17
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.15
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.13
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.11
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.1
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.1
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.1
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.07
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.07
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.05
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.05
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.04
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.02
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.0
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.97
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.94
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.92
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.91
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.84
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.82
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.8
2ea5_A68 Cell growth regulator with ring finger domain prot 98.79
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.78
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.72
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.69
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.66
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.64
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.57
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.56
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.5
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.42
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.14
3nw0_A238 Non-structural maintenance of chromosomes element 97.75
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 95.79
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.74
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 93.35
1wil_A89 KIAA1045 protein; ring finger domain, structural g 91.49
1we9_A64 PHD finger family protein; structural genomics, PH 88.85
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 87.39
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 87.2
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 85.74
2k16_A75 Transcription initiation factor TFIID subunit 3; p 85.58
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 85.5
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 84.79
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 84.2
1weu_A91 Inhibitor of growth family, member 4; structural g 83.41
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 82.64
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 82.44
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 81.84
3o36_A 184 Transcription intermediary factor 1-alpha; TRIM24, 81.45
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 80.43
2yt5_A66 Metal-response element-binding transcription facto 80.4
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 80.29
3lqh_A 183 Histone-lysine N-methyltransferase MLL; PHD finger 80.16
1wem_A76 Death associated transcription factor 1; structura 80.09
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.68  E-value=9.3e-17  Score=122.02  Aligned_cols=80  Identities=33%  Similarity=0.717  Sum_probs=66.4

Q ss_pred             CCCCCCCCHHHHhcCCceeeeCCCCCCCCCCCCCCCCCCCCCCcchhhhhhhccCCCCCCCCCcccccccccccccCcee
Q 048433          151 TSTTPSMSEEEINSLPVHKYKVPGPASESVGSSIRQPSSSAATPEQSKQESKKADGSTKSSEDELTCTICLEQVKCGELV  230 (279)
Q Consensus       151 ~~~~~~ls~e~i~~LP~~~~~~~~~s~~s~~s~~~~~ss~~~~~e~~~~~~~~~~~~~~~~~e~~~C~ICle~~~~~~~v  230 (279)
                      .....+++++.+++||...+.....                                  ..+++..|+||++.+..++.+
T Consensus        11 ~~~~~~~s~~~i~~lp~~~~~~~~~----------------------------------~~~~~~~C~IC~~~~~~~~~~   56 (91)
T 2l0b_A           11 MVANPPASKESIDALPEILVTEDHG----------------------------------AVGQEMCCPICCSEYVKGDVA   56 (91)
T ss_dssp             SSCCCCCCHHHHHTSCEEECCTTCS----------------------------------SSSSCSEETTTTEECCTTCEE
T ss_pred             CcCCCCCCHHHHHhCCCeeeccccc----------------------------------ccCCCCCCcccChhhcCCCcE
Confidence            3467789999999999887643211                                  123456899999999988888


Q ss_pred             EEeCCCCcccHhhHHHHHhcCCCCcccccccCCC
Q 048433          231 RSLPCLHQFHANCIDPWLRQRGTCPVCKFRMGSG  264 (279)
Q Consensus       231 ~~LpC~H~Fh~~CI~~WL~~~~~CP~CR~~i~~~  264 (279)
                      ..++|||.||..||.+|++.+.+||+||..+...
T Consensus        57 ~~l~C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~~   90 (91)
T 2l0b_A           57 TELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPPP   90 (91)
T ss_dssp             EEETTTEEEEHHHHHHHHTTTCBCTTTCCBSSCC
T ss_pred             EecCCCChHHHHHHHHHHHcCCcCcCcCccCCCC
Confidence            8999999999999999999999999999998753



>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 279
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 7e-18
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 6e-15
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 4e-12
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 2e-11
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 7e-11
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 5e-10
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 4e-09
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 4e-09
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 1e-08
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 3e-08
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-07
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 8e-07
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 5e-06
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 0.001
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 0.002
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 73.4 bits (180), Expect = 7e-18
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 210 SSEDELTCTICLEQVKCGELVRSLP-CLHQFHANCIDPWLRQRGTCPVCKFR 260
           + +D + C +CL +++ GE  R LP C H FHA C+D WL    TCP+C+  
Sbjct: 1   AMDDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLT 52


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.65
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.58
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.43
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.4
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.4
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.39
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.38
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.24
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.2
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.2
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.19
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.04
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.04
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.02
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.02
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.81
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.48
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 90.34
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 88.61
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 87.51
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 87.33
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 86.94
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 86.08
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 84.97
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 84.66
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 81.33
d1wema_76 Death associated transcription factor 1, Datf1 (DI 80.15
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.65  E-value=2.5e-17  Score=112.47  Aligned_cols=51  Identities=43%  Similarity=1.064  Sum_probs=45.9

Q ss_pred             CCcccccccccccccCceeEEeC-CCCcccHhhHHHHHhcCCCCcccccccC
Q 048433          212 EDELTCTICLEQVKCGELVRSLP-CLHQFHANCIDPWLRQRGTCPVCKFRMG  262 (279)
Q Consensus       212 ~e~~~C~ICle~~~~~~~v~~Lp-C~H~Fh~~CI~~WL~~~~~CP~CR~~i~  262 (279)
                      +++.+|+||+++|..++.+..++ |+|.||..||.+|++++++||+||+++.
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            45567999999999988888876 9999999999999999999999999863



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure