Citrus Sinensis ID: 048450
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 133 | ||||||
| 147769144 | 628 | hypothetical protein VITISV_033996 [Viti | 0.872 | 0.184 | 0.380 | 3e-14 | |
| 46576968 | 970 | RecName: Full=Disease resistance protein | 0.849 | 0.116 | 0.431 | 4e-14 | |
| 207693269 | 970 | late blight resistance protein Rpi-pta1 | 0.819 | 0.112 | 0.437 | 4e-14 | |
| 207693267 | 970 | late blight resistance protein Rpi-sto1 | 0.819 | 0.112 | 0.437 | 4e-14 | |
| 224115778 | 1234 | nbs-lrr resistance protein [Populus tric | 0.812 | 0.087 | 0.437 | 5e-14 | |
| 147772835 | 920 | hypothetical protein VITISV_006248 [Viti | 0.849 | 0.122 | 0.398 | 1e-13 | |
| 413924744 | 399 | hypothetical protein ZEAMMB73_765808 [Ze | 0.796 | 0.265 | 0.445 | 2e-13 | |
| 147815461 | 856 | hypothetical protein VITISV_018645 [Viti | 0.849 | 0.132 | 0.398 | 2e-13 | |
| 212721874 | 152 | uncharacterized protein LOC100192812 [Ze | 0.857 | 0.75 | 0.384 | 4e-13 | |
| 224134406 | 987 | cc-nbs-lrr resistance protein [Populus t | 0.541 | 0.072 | 0.534 | 7e-13 |
| >gi|147769144|emb|CAN62986.1| hypothetical protein VITISV_033996 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 83.6 bits (205), Expect = 3e-14, Method: Compositional matrix adjust.
Identities = 46/121 (38%), Positives = 70/121 (57%), Gaps = 5/121 (4%)
Query: 1 MPRLSSLTVGSCNKLKALPDYLLQTTA-----LQELSICSCDLLEELPILEDRRTTDIPR 55
+P L + + +K + L ++ L+EL+I D L++ I E + +P
Sbjct: 507 LPVLEKMGIWHMRGVKYIGSEFLGASSTVFPKLKELTISRLDELKQWAIKEKEERSIMPC 566
Query: 56 LTSLWISDCPNLKVLPDYLLQTTTLQELTIHRCPLLENRYREGKGEDWHKISHIPHIKWS 115
L L CP L+ LPD++LQ TTLQ+L I P+L+ RY++ GEDWHKISHIP +K+S
Sbjct: 567 LNYLSTIGCPKLEELPDHVLQRTTLQKLDIRSSPILKQRYQKDIGEDWHKISHIPEVKYS 626
Query: 116 I 116
+
Sbjct: 627 L 627
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|46576968|sp|Q7XBQ9.1|RGA2_SOLBU RecName: Full=Disease resistance protein RGA2; AltName: Full=Blight resistance protein RPI; AltName: Full=RGA2-blb gi|32693281|gb|AAP86601.1| putative disease resistant protein RGA2 [Solanum bulbocastanum] gi|39636705|gb|AAR29069.1| blight resistance protein RPI [Solanum bulbocastanum] | Back alignment and taxonomy information |
|---|
| >gi|207693269|gb|ACI25289.1| late blight resistance protein Rpi-pta1 [Solanum stoloniferum] | Back alignment and taxonomy information |
|---|
| >gi|207693267|gb|ACI25288.1| late blight resistance protein Rpi-sto1 [Solanum stoloniferum] | Back alignment and taxonomy information |
|---|
| >gi|224115778|ref|XP_002317122.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222860187|gb|EEE97734.1| nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147772835|emb|CAN71670.1| hypothetical protein VITISV_006248 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|413924744|gb|AFW64676.1| hypothetical protein ZEAMMB73_765808 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|147815461|emb|CAN66085.1| hypothetical protein VITISV_018645 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|212721874|ref|NP_001131477.1| uncharacterized protein LOC100192812 [Zea mays] gi|194691634|gb|ACF79901.1| unknown [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|224134406|ref|XP_002321815.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222868811|gb|EEF05942.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 133 | ||||||
| TAIR|locus:504956182 | 1049 | AT1G58848 [Arabidopsis thalian | 0.781 | 0.099 | 0.342 | 5.3e-07 | |
| TAIR|locus:2826978 | 1049 | AT1G59218 [Arabidopsis thalian | 0.781 | 0.099 | 0.342 | 5.3e-07 | |
| TAIR|locus:2174944 | 815 | AT5G66910 [Arabidopsis thalian | 0.481 | 0.078 | 0.397 | 3.2e-05 | |
| TAIR|locus:2119196 | 816 | ADR1-L1 "ADR1-like 1" [Arabido | 0.496 | 0.080 | 0.385 | 4.2e-05 | |
| TAIR|locus:2171479 | 623 | ADR1-L3 "ADR1-like 3" [Arabido | 0.496 | 0.105 | 0.328 | 0.00013 | |
| TAIR|locus:2175433 | 811 | ADR1-L2 "ADR1-like 2" [Arabido | 0.488 | 0.080 | 0.347 | 0.00018 | |
| TAIR|locus:2155801 | 1046 | AT5G58120 [Arabidopsis thalian | 0.473 | 0.060 | 0.367 | 0.00019 | |
| TAIR|locus:504956184 | 1017 | AT1G58807 "AT1G58807" [Arabido | 0.601 | 0.078 | 0.356 | 0.0003 | |
| TAIR|locus:2827038 | 1017 | AT1G59124 "AT1G59124" [Arabido | 0.601 | 0.078 | 0.356 | 0.0003 | |
| TAIR|locus:504956186 | 1138 | AT1G58602 [Arabidopsis thalian | 0.593 | 0.069 | 0.356 | 0.00072 |
| TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 128 (50.1 bits), Expect = 5.3e-07, P = 5.3e-07
Identities = 39/114 (34%), Positives = 59/114 (51%)
Query: 1 MPRLSSLTVGSCNKLKALPDYLLQTTALQELSICSCDLLEELPILEDRRTTDIPRLTSLW 60
MP+L +L + C KLK LP+ Q LQ L + + EE I+ED +P L +L
Sbjct: 945 MPQLHTLEIRRCPKLKKLPNGFPQ---LQNLELNELEEWEEW-IVEDG---SMPLLHTLR 997
Query: 61 ISDCPNLKVLPDYXXXXXXXXXXXIHRCPLLENRYREGKGEDWHKISHIPHIKW 114
I +CP LK LPD + + + R +G GED++K+ HIP +++
Sbjct: 998 IWNCPKLKQLPDGLRFIYSLKNLTVPK--RWKKRLSKG-GEDYYKVQHIPSVEF 1048
|
|
| TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2174944 AT5G66910 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2119196 ADR1-L1 "ADR1-like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171479 ADR1-L3 "ADR1-like 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175433 ADR1-L2 "ADR1-like 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155801 AT5G58120 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.0109003001 | nbs-lrr resistance protein (1235 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 133 | |||
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 0.001 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 0.004 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Score = 37.5 bits (87), Expect = 0.001
Identities = 34/111 (30%), Positives = 46/111 (41%), Gaps = 22/111 (19%)
Query: 4 LSSLTVGSCNKLKALPD--------YLLQTTA-----------LQELSIC---SCDLLEE 41
L L + C++LK+ PD L +T L EL +C S L E
Sbjct: 706 LYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWER 765
Query: 42 LPILEDRRTTDIPRLTSLWISDCPNLKVLPDYLLQTTTLQELTIHRCPLLE 92
+ L T P LT L++SD P+L LP + L+ L I C LE
Sbjct: 766 VQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLE 816
|
syringae 6; Provisional. Length = 1153 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.09 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.99 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.88 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.85 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.72 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 98.63 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.56 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.46 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.41 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.38 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 98.34 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 98.33 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.24 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.21 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.18 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.08 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.04 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.9 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 97.88 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.88 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 97.8 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.72 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.61 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 97.58 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 97.56 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.42 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.34 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.31 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.23 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.21 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.11 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.06 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 96.98 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 96.9 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.82 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 96.76 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 96.69 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 96.63 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.57 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 96.56 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.45 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 96.23 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 96.23 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 96.23 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 96.11 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 95.97 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 95.88 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 95.82 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 95.22 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 94.87 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 94.83 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 94.82 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 94.69 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 94.63 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 94.43 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 94.37 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 94.25 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 93.22 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 92.24 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 91.49 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 90.42 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 89.97 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 89.87 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 89.87 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 89.86 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 89.12 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 88.84 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 85.72 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 83.97 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 83.19 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 83.17 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 80.63 |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
Probab=99.09 E-value=2.8e-10 Score=94.82 Aligned_cols=87 Identities=29% Similarity=0.479 Sum_probs=64.3
Q ss_pred CCccEEeecCCCCCccCCccCCCCCCccEEEeccCCCCccccccccccCCCCCCccEEeecCCCCCCc------------
Q 048450 2 PRLSSLTVGSCNKLKALPDYLLQTTALQELSICSCDLLEELPILEDRRTTDIPRLTSLWISDCPNLKV------------ 69 (133)
Q Consensus 2 ~~L~~L~l~~~~~l~~lp~~~~~l~~L~~L~l~~c~~l~~lp~~~~~~~~~l~~L~~L~l~~c~~l~~------------ 69 (133)
++|+.|++++|+.+..+|..++++++|+.|++.+|..++.+|. .+ .+++|+.|++++|..++.
T Consensus 778 ~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~----~~-~L~sL~~L~Ls~c~~L~~~p~~~~nL~~L~ 852 (1153)
T PLN03210 778 PSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPT----GI-NLESLESLDLSGCSRLRTFPDISTNISDLN 852 (1153)
T ss_pred ccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCC----CC-CccccCEEECCCCCccccccccccccCEeE
Confidence 4678888888888888888888888888888888888888886 44 577777777777765544
Q ss_pred --------cCcCCCCCCCccEEEEecCchhHH
Q 048450 70 --------LPDYLLQTTTLQELTIHRCPLLEN 93 (133)
Q Consensus 70 --------lp~~~~~l~~L~~L~i~~c~~l~~ 93 (133)
+|.++..+++|+.|++.+|+.+..
T Consensus 853 Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~ 884 (1153)
T PLN03210 853 LSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQR 884 (1153)
T ss_pred CCCCCCccChHHHhcCCCCCEEECCCCCCcCc
Confidence 344455566777777777776663
|
syringae 6; Provisional |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 133 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-08 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 6e-08 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-06 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-05 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 9e-05 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-04 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-04 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 7e-04 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
Score = 50.3 bits (121), Expect = 2e-08
Identities = 25/92 (27%), Positives = 37/92 (40%), Gaps = 5/92 (5%)
Query: 1 MPRLSSLTVGSCNKLKALPDYLLQTTALQELSICSCDLLEELPILEDRRTTDIPRLTSLW 60
+ L SL + + L AL + L+EL + C L P L L
Sbjct: 205 LQNLKSLKI-RNSPLSALGPAIHHLPKLEELDLRGCTALRNYP----PIFGGRAPLKRLI 259
Query: 61 ISDCPNLKVLPDYLLQTTTLQELTIHRCPLLE 92
+ DC NL LP + + T L++L + C L
Sbjct: 260 LKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLS 291
|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.37 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.35 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.18 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.16 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.15 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.11 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.08 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.06 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.05 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.04 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.04 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.03 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.03 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.01 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.01 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.01 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.01 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.01 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.99 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.98 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.98 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.98 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.97 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.95 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.94 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.94 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.94 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.94 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.94 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.94 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.93 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.92 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.92 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.92 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.92 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.92 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.92 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.91 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.91 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.9 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.89 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.89 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.89 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.88 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.88 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.88 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.88 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.88 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.88 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.87 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.86 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.86 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.86 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.86 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.85 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.85 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.85 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.84 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.84 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.84 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.83 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.83 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.82 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.82 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.82 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.81 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.81 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.81 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.8 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.79 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.79 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.79 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.79 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.78 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.77 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.77 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.77 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.76 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.75 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.75 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.74 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.74 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.74 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.73 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.73 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.71 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.7 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.7 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.7 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.69 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.69 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.68 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.68 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.67 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.67 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.67 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.66 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.65 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.65 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.64 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.62 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.61 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.61 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.6 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.6 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.6 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.6 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.59 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.59 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.58 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.58 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.56 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.56 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.54 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.54 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.53 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.51 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.45 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.45 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.44 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.44 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.35 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.24 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.22 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.21 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.17 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.15 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.12 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.1 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.07 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.03 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 97.97 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 97.87 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 97.84 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.83 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.68 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 97.6 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 97.6 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 97.5 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.48 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.37 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.35 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.19 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.18 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 96.9 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 96.89 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.75 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 96.47 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 96.35 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.17 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 95.98 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 95.97 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 95.11 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 94.65 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 94.11 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 94.04 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 93.77 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 92.86 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 92.24 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 91.09 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 89.63 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 85.79 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
Probab=99.37 E-value=1.6e-12 Score=93.53 Aligned_cols=81 Identities=23% Similarity=0.413 Sum_probs=41.7
Q ss_pred CccEEeecCCCCCccCCccCCCCCCccEEEeccCCCCccccccccccCCCCCCccEEeecCCCCCCccCcCCCCCCCccE
Q 048450 3 RLSSLTVGSCNKLKALPDYLLQTTALQELSICSCDLLEELPILEDRRTTDIPRLTSLWISDCPNLKVLPDYLLQTTTLQE 82 (133)
Q Consensus 3 ~L~~L~l~~~~~l~~lp~~~~~l~~L~~L~l~~c~~l~~lp~~~~~~~~~l~~L~~L~l~~c~~l~~lp~~~~~l~~L~~ 82 (133)
+|++|+++++ .+..+|..++.+++|+.|+++++. +..+|. .++.+++|++|++++|...+.+|..+..+++|+.
T Consensus 184 ~L~~L~L~~n-~l~~lp~~l~~l~~L~~L~L~~N~-l~~l~~----~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~ 257 (328)
T 4fcg_A 184 NLQSLRLEWT-GIRSLPASIANLQNLKSLKIRNSP-LSALGP----AIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKR 257 (328)
T ss_dssp TCCEEEEEEE-CCCCCCGGGGGCTTCCEEEEESSC-CCCCCG----GGGGCTTCCEEECTTCTTCCBCCCCTTCCCCCCE
T ss_pred CCCEEECcCC-CcCcchHhhcCCCCCCEEEccCCC-CCcCch----hhccCCCCCEEECcCCcchhhhHHHhcCCCCCCE
Confidence 4444444443 333444444455555555555533 444444 4555555555555555555555555555555555
Q ss_pred EEEecCc
Q 048450 83 LTIHRCP 89 (133)
Q Consensus 83 L~i~~c~ 89 (133)
|++++|.
T Consensus 258 L~L~~n~ 264 (328)
T 4fcg_A 258 LILKDCS 264 (328)
T ss_dssp EECTTCT
T ss_pred EECCCCC
Confidence 5555554
|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.03 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.99 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.97 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.9 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.87 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.82 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.81 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.8 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.79 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.78 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.77 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.75 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.72 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.66 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.64 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.64 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.57 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.52 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.51 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.51 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.46 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.46 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.42 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.42 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.35 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.23 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.19 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.04 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.03 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.0 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.98 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.91 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.11 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 96.62 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 96.06 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 95.36 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 94.24 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 92.68 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 92.03 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 92.03 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 85.89 |
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.03 E-value=3.4e-10 Score=69.36 Aligned_cols=76 Identities=24% Similarity=0.192 Sum_probs=53.5
Q ss_pred cEEeecCCCCCccCCccCCCCCCccEEEeccCCCCccccccccccCCCCCCccEEeecCCCCCCccCcCCCCCCCccEEE
Q 048450 5 SSLTVGSCNKLKALPDYLLQTTALQELSICSCDLLEELPILEDRRTTDIPRLTSLWISDCPNLKVLPDYLLQTTTLQELT 84 (133)
Q Consensus 5 ~~L~l~~~~~l~~lp~~~~~l~~L~~L~l~~c~~l~~lp~~~~~~~~~l~~L~~L~l~~c~~l~~lp~~~~~l~~L~~L~ 84 (133)
|+|+++++ .+..++ .++.+++|++|+++++ .++.+|. .++.+++|+.|++++ +.++.+| ++..+++|++++
T Consensus 1 R~L~Ls~n-~l~~l~-~l~~l~~L~~L~ls~N-~l~~lp~----~~~~l~~L~~L~l~~-N~i~~l~-~~~~l~~L~~L~ 71 (124)
T d1dcea3 1 RVLHLAHK-DLTVLC-HLEQLLLVTHLDLSHN-RLRALPP----ALAALRCLEVLQASD-NALENVD-GVANLPRLQELL 71 (124)
T ss_dssp SEEECTTS-CCSSCC-CGGGGTTCCEEECCSS-CCCCCCG----GGGGCTTCCEEECCS-SCCCCCG-GGTTCSSCCEEE
T ss_pred CEEEcCCC-CCCCCc-ccccCCCCCEEECCCC-ccCcchh----hhhhhhccccccccc-ccccccC-ccccccccCeEE
Confidence 46777774 666666 4677777888888774 4777776 677777788888877 4566776 366777788888
Q ss_pred EecCc
Q 048450 85 IHRCP 89 (133)
Q Consensus 85 i~~c~ 89 (133)
++++.
T Consensus 72 l~~N~ 76 (124)
T d1dcea3 72 LCNNR 76 (124)
T ss_dssp CCSSC
T ss_pred CCCCc
Confidence 77654
|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|