Citrus Sinensis ID: 048458

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380------
MSKSLPAKFMLETLLKLPVKTLTRFKCVSKQWHSVISNPTFVALHAKLSESTNKCYLVQYKEGNYSENNFSLCNSNLVQFDEVKFPINSTQIVSSCSGLVCLLLNTFHSCHFPMFVWNPSTRKYKKIPSHKSFDWEKEQYRSSATASFIWEKEMKGSFATFAITGFGYDHRTSDFKILLIVHAREVASEQFRREFSDIQVYSLKNNCWRRIQPNVPCIPCLSSNSTVHLNGAVHWMAIRKESDGTNKDIIVSFDFGDETFRYRKLPDCLYNTDHIHRERSIGILEKSIALFVSCHTEDNTAGLGICSVYVMKENIEVEHWINLFTVDLRAQFAWQYLGFGANDEVMLRNDDGELVLYDHKTQEVVQCESSNWVANAVIYTESLVSP
ccccccHHHHHHHHccccHHHHHHHHccHHcHHHHHccHHHHHHHHHHccccccEEEEEEEcccccccccccccccccccccccccccccEEEEccccEEEccccccccccccEEEEccccccEEEccccccccccHHHccccccccHHHHHccccccccEEEEEEEEEcccccEEEEEEEEEcccccccccccccEEEEEEcccccEEEccccccccccccccccEEEccEEEEEEEEcccccccccEEEEEEccccEEEEEccccccccccccccEEEEEEEccEEEEEEEcccccccccccEEEEEEEEEccccccEEEEEEEEcccccccEEEEEEEccEEEEEEcccEEEEEEccccEEEEEEccccEEEEEEEEcccccc
ccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccEEEEEcccccEEEEcccccccccccccccccccccEEEEEcccEEEEEEEcccccccccEEEEccccccEEEccccccccccccccccccccccccccccccccEEEEEEEEccccccccEEEEEEEEccccccccccccccEEEEEEcccccEEEEEccccccccccccccEEEEEEEEEEEEEccccccccEEEEEEEccccccEEcccccccccccccccEEEEEEEccEEEEEEEEccccccccccEEEEEEEEcccccEEEEEEEEEcccccccccEEEEEEccEEEEEEcccEEEEEcccccEEEEEEccccccEEEEEEcccccc
MSKSLPAKFMLETLLKLPVKTLTRFKCVSkqwhsvisnpTFVALHAKLSESTNKCYLVqykegnysennFSLCNsnlvqfdevkfpinstqivsSCSGLVCLLLNtfhschfpmfvwnpstrkykkipshksfdwekeqyrssatASFIWEkemkgsfatfaitgfgydhrtsDFKILLIVHAREVASEQFRREFSDIQVYSLKNNcwrriqpnvpcipclssnstvhlNGAVHWMAIRkesdgtnkdiivsfdfgdetfryrklpdclyntdhihreRSIGILEKSIALFVSchtedntaglgICSVYVMKENIEVEHWINLFTVDLRAQFAWQYlgfgandevmlrnddgelvlydhktqevvqcessnwVANAVIYTESLVSP
mskslpakfMLETLLKLPVKTLTRFKCVSKQWHSVISNPTFVALHAKLSESTNKCYLVQYKEGNYSENNFSLCNSNLVQFDEVKFPINSTQIVSSCSGLVCLLLNTFHSCHFPMFVWNPSTRKYKKIPShksfdwekeqyRSSATASFIWEKEMKGSFATFAITGFGYDHRTSDFKILLIVHAREVASEQFRREFSDIQVYSLKNNCWRRIQPNVPCIPCLSSNSTVHLNGAVHWMAIrkesdgtnkDIIVSFDFGDETFRYRKLPDCLYNTDHIHRERSIGILEKSIALFVSCHTEDNTAGLGICSVYVMKENIEVEHWINLFTVDLRAQFAWQYLGFGANDEVMLRNDDGELVLYDHKTqevvqcessnwvANAVIYTESLVSP
MSKSLPAKFMLETLLKLPVKTLTRFKCVSKQWHSVISNPTFVALHAKLSESTNKCYLVQYKEGNYSENNFSLCNSNLVQFDEVKFPINSTQIvsscsglvclllNTFHSCHFPMFVWNPSTRKYKKIPSHKSFDWEKEQYRSSATASFIWEKEMKGSFATFAITGFGYDHRTSDFKILLIVHAREVASEQFRREFSDIQVYSLKNNCWRRIQPNVPCIPCLSSNSTVHLNGAVHWMAIRKESDGTNKDIIVSFDFGDETFRYRKLPDCLYNTDHIHRERSIGILEKSIALFVSCHTEDNTAGLGICSVYVMKENIEVEHWINLFTVDLRAQFAWQYLGFGANDEVMLRNDDGELVLYDHKTQEVVQCESSNWVANAVIYTESLVSP
*******KFMLETLLKLPVKTLTRFKCVSKQWHSVISNPTFVALHAKLSESTNKCYLVQYKEGNYSENNFSLCNSNLVQFDEVKFPINSTQIVSSCSGLVCLLLNTFHSCHFPMFVWNPSTRKYKKIPSHKSFDWEKEQYRSSATASFIWEKEMKGSFATFAITGFGYDHRTSDFKILLIVHAREVASEQFRREFSDIQVYSLKNNCWRRIQPNVPCIPCLSSNSTVHLNGAVHWMAIRKESDGTNKDIIVSFDFGDETFRYRKLPDCLYNTDHIHRERSIGILEKSIALFVSCHTEDNTAGLGICSVYVMKENIEVEHWINLFTVDLRAQFAWQYLGFGANDEVMLRNDDGELVLYDHKTQEVVQCESSNWVANAVIYTE*****
*SKSLPAKFMLETLLKLPVKTLTRFKCVSKQWHSVISNPTFVALHAKLSESTNKCYLVQYKEGNYSENNFSLCNSNLVQFDEVKFPINSTQIVSSCSGLVCLLLNTFHSCHFPMFVWNPSTRKYKKIPSHKSFDWEKEQYRSSATASFIWEKEMKGSFATFAITGFGYDHRTSDFKILLIVHAREVASEQFRREFSDIQVYSLKNNCWRRIQPNVPCIPCLSSNSTVHLNGAVHWMAIRKESDGTNKDIIVSFDFGDETFRYRKLPDCLYNTDHIHRERSIGILEKSIALFVSCHTEDNTAGLGICSVYVMKENIEVEHWINLFTVDLRAQFAWQYLGFGANDEVMLRNDDGELVLYDHKTQEVVQCESSNWVANAVIYTESLVSP
MSKSLPAKFMLETLLKLPVKTLTRFKCVSKQWHSVISNPTFVALHAKLSESTNKCYLVQYKEGNYSENNFSLCNSNLVQFDEVKFPINSTQIVSSCSGLVCLLLNTFHSCHFPMFVWNPSTRKYKKIPSHKSFDWEKEQYRSSATASFIWEKEMKGSFATFAITGFGYDHRTSDFKILLIVHAREVASEQFRREFSDIQVYSLKNNCWRRIQPNVPCIPCLSSNSTVHLNGAVHWMAIRKESDGTNKDIIVSFDFGDETFRYRKLPDCLYNTDHIHRERSIGILEKSIALFVSCHTEDNTAGLGICSVYVMKENIEVEHWINLFTVDLRAQFAWQYLGFGANDEVMLRNDDGELVLYDHKTQEVVQCESSNWVANAVIYTESLVSP
**KSLPAKFMLETLLKLPVKTLTRFKCVSKQWHSVISNPTFVALHAKLSESTNKCYLVQYKEGNYSENNFSLCNSNLVQFDEVKFPINSTQIVSSCSGLVCLLLNTFHSCHFPMFVWNPSTRKYKKIPSHKSFDWEKEQYRSSATASFIWEKEMKGSFATFAITGFGYDHRTSDFKILLIVHAREVASEQFRREFSDIQVYSLKNNCWRRIQPNVPCIPCLSSNSTVHLNGAVHWMAIRKESDGTNKDIIVSFDFGDETFRYRKLPDCLYNTDHIHRERSIGILEKSIALFVSCHTEDNTAGLGICSVYVMKENIEVEHWINLFTVDLRAQFAWQYLGFGANDEVMLRNDDGELVLYDHKTQEVVQCESSNWVANAVIYTESLVS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKSLPAKFMLETLLKLPVKTLTRFKCVSKQWHSVISNPTFVALHAKLSESTNKCYLVQYKEGNYSENNFSLCNSNLVQFDEVKFPINSTQIVSSCSGLVCLLLNTFHSCHFPMFVWNPSTRKYKKIPSHKSFDWEKEQYRSSATASFIWEKEMKGSFATFAITGFGYDHRTSDFKILLIVHAREVASEQFRREFSDIQVYSLKNNCWRRIQPNVPCIPCLSSNSTVHLNGAVHWMAIRKESDGTNKDIIVSFDFGDETFRYRKLPDCLYNTDHIHRERSIGILEKSIALFVSCHTEDNTAGLGICSVYVMKENIEVEHWINLFTVDLRAQFAWQYLGFGANDEVMLRNDDGELVLYDHKTQEVVQCESSNWVANAVIYTESLVSP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query386 2.2.26 [Sep-21-2011]
Q8GXC7427 F-box/kelch-repeat protei yes no 0.841 0.761 0.271 1e-25
Q9SU30413 F-box protein CPR30 OS=Ar no no 0.746 0.697 0.232 1e-15
Q9LIR8364 F-box/kelch-repeat protei no no 0.860 0.912 0.251 2e-14
Q9LU24360 Putative F-box protein At no no 0.559 0.6 0.246 3e-14
Q9SSQ2423 F-box protein At1g52490 O no no 0.709 0.647 0.229 2e-12
Q9FVV8392 Putative F-box protein At no no 0.606 0.596 0.266 3e-12
Q9SAF4435 Putative F-box/kelch-repe no no 0.880 0.781 0.241 1e-11
Q9LX89445 F-box protein At5g10340 O no no 0.875 0.759 0.243 2e-11
Q9SUY0402 F-box protein At4g22390 O no no 0.841 0.808 0.222 2e-11
Q7X7A9312 F-box protein At1g11270 O no no 0.572 0.708 0.266 3e-11
>sp|Q8GXC7|FBK50_ARATH F-box/kelch-repeat protein At3g06240 OS=Arabidopsis thaliana GN=At3g06240 PE=2 SV=1 Back     alignment and function desciption
 Score =  117 bits (294), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 120/442 (27%), Positives = 184/442 (41%), Gaps = 117/442 (26%)

Query: 5   LPAKFMLETLLKLPVKTLTRFKCVSKQWHSVISNPTFV--------------ALHAKLSE 50
           LP + + E LL+LP K++ RF+CVSK + ++ S+P F               +LH KL  
Sbjct: 36  LPPEIITEILLRLPAKSIGRFRCVSKLFCTLSSDPGFAKIHLDLILRNESVRSLHRKLIV 95

Query: 51  STNKCYLVQYK------------EGNY---------SENNFSLCNSNLVQFDEVKFPINS 89
           S++  Y + +             E NY         SE   +    +L     V   +N+
Sbjct: 96  SSHNLYSLDFNSIGDGIRDLAAVEHNYPLKDDPSIFSEMIRNYVGDHLYDDRRVMLKLNA 155

Query: 90  -------TQIVSSCSGLVCLLLNTFHSCHFPMFVWNPSTRKYKKIPSH---KSFDWEKEQ 139
                   +IV S +GLVC+           +F++NP+T   K++P +   KS ++E++ 
Sbjct: 156 KSYRRNWVEIVGSSNGLVCI-----SPGEGAVFLYNPTTGDSKRLPENFRPKSVEYERDN 210

Query: 140 YRSSATASFIWEKEMKGSFATFAITGFGYDHRTSDFKILLIVHAREVASEQFRREFSDIQ 199
                                F   GFG+D  T D+K++ +V   E        +  D  
Sbjct: 211 ---------------------FQTYGFGFDGLTDDYKLVKLVATSE--------DILDAS 241

Query: 200 VYSLKNNCWRRIQPNVPCIPCLSSN-----STVHLNGAVHWMAIRKESDGTNKDIIVSFD 254
           VYSLK + WRRI     C      N     S VH NGA+HW+         N+ ++V+FD
Sbjct: 242 VYSLKADSWRRI-----CNLNYEHNDGSYTSGVHFNGAIHWVFTESRH---NQRVVVAFD 293

Query: 255 FGDETFRYRKLPDCLYNTDHIHRERSIGILEKSIALFVSCHTEDNTAGLGICSVYVMKEN 314
              E FR   +PD   +  H      +G L   + +  SC+   +        ++VM E 
Sbjct: 294 IQTEEFREMPVPDEAEDCSHRFSNFVVGSLNGRLCVVNSCYDVHD-------DIWVMSEY 346

Query: 315 IEVEHW----INLFTVDLRAQFAWQYLGFGANDEVMLRNDDGELVLYDHKTQEVVQCE-- 368
            E + W    INL    ++       L    NDE +L   DG+LVLY+ +T         
Sbjct: 347 GEAKSWSRIRINLLYRSMKP------LCSTKNDEEVLLELDGDLVLYNFETNASSNLGIC 400

Query: 369 ----SSNWVANAVIYTESLVSP 386
               S  + AN   Y ESL+SP
Sbjct: 401 GVKLSDGFEANT--YVESLISP 420

Arabidopsis thaliana (taxid: 3702)
>sp|Q9SU30|CPR30_ARATH F-box protein CPR30 OS=Arabidopsis thaliana GN=CPR30 PE=1 SV=2 Back     alignment and function description
>sp|Q9LIR8|FBK67_ARATH F-box/kelch-repeat protein At3g23880 OS=Arabidopsis thaliana GN=At3g23880 PE=2 SV=1 Back     alignment and function description
>sp|Q9LU24|FB145_ARATH Putative F-box protein At3g16210 OS=Arabidopsis thaliana GN=At3g16210 PE=4 SV=1 Back     alignment and function description
>sp|Q9SSQ2|FB55_ARATH F-box protein At1g52490 OS=Arabidopsis thaliana GN=At1g52490 PE=4 SV=1 Back     alignment and function description
>sp|Q9FVV8|FB87_ARATH Putative F-box protein At1g71320 OS=Arabidopsis thaliana GN=At1g71320 PE=4 SV=1 Back     alignment and function description
>sp|Q9SAF4|FBK3_ARATH Putative F-box/kelch-repeat protein At1g13200 OS=Arabidopsis thaliana GN=At1g13200 PE=4 SV=1 Back     alignment and function description
>sp|Q9LX89|FB255_ARATH F-box protein At5g10340 OS=Arabidopsis thaliana GN=At5g10340 PE=2 SV=1 Back     alignment and function description
>sp|Q9SUY0|FB244_ARATH F-box protein At4g22390 OS=Arabidopsis thaliana GN=At4g22390 PE=2 SV=3 Back     alignment and function description
>sp|Q7X7A9|FB4_ARATH F-box protein At1g11270 OS=Arabidopsis thaliana GN=At1g11270 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query386
255554010406 ubiquitin-protein ligase, putative [Rici 0.865 0.822 0.298 5e-31
147785389485 hypothetical protein VITISV_041940 [Viti 0.880 0.701 0.270 1e-29
224129168374 predicted protein [Populus trichocarpa] 0.878 0.906 0.285 3e-29
297739282423 unnamed protein product [Vitis vinifera] 0.880 0.803 0.268 5e-29
255569742371 conserved hypothetical protein [Ricinus 0.844 0.878 0.279 6e-29
296090345423 unnamed protein product [Vitis vinifera] 0.901 0.822 0.258 5e-28
224114972381 predicted protein [Populus trichocarpa] 0.826 0.837 0.281 3e-27
356532341392 PREDICTED: F-box protein CPR30-like [Gly 0.904 0.890 0.274 6e-27
449444947391 PREDICTED: F-box protein CPR30-like [Cuc 0.844 0.833 0.281 6e-27
225433770360 PREDICTED: F-box/kelch-repeat protein At 0.844 0.905 0.270 2e-26
>gi|255554010|ref|XP_002518045.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223542641|gb|EEF44178.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  141 bits (356), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 120/402 (29%), Positives = 186/402 (46%), Gaps = 68/402 (16%)

Query: 4   SLPAKFMLETLLKLPVKTLTRFKCVSKQWHSVISNPTFVALHAKLSE-----STNKCYLV 58
           +LP   ++E L ++PVK L RFKCVSK W+S+IS+P F  L  K ++     S N+  L 
Sbjct: 52  TLPEDLIVEILSRVPVKPLLRFKCVSKSWNSIISDPRFAKLQLKRAKENSNISCNRLLLS 111

Query: 59  QYKEGNYSENNFSLCNSNL------VQFDEV--KFPINSTQIVSSCSGLVCLLLNTFHSC 110
            +   +     F  C+ +L      V F  +    P    +I+ SC GLVCLL +     
Sbjct: 112 TWSPRSLDFEAF--CDDDLSNTITNVSFPAIVKGPPTFYVRILGSCDGLVCLLDD----- 164

Query: 111 HFPMFVWNPSTRKYKKIPSHKSFDWEKEQYRSSATASFIWEKEMKGSFATFAITGFGYDH 170
           +  MF+WNP+TR+YK++P                        + KG+     + G GY+ 
Sbjct: 165 YGTMFLWNPTTRQYKELP------------------------KPKGAVYRMFLHGIGYNF 200

Query: 171 RTSDFKILLIVHAREVASEQFRREFSDIQVYSLKNNCWRRIQPNVPCIPCLSSNSTVHLN 230
            T D+ ++      +  +E+     + +++Y+LKNN WR+I+ +V   P  S  S +  N
Sbjct: 201 STDDYGVVFASRFTDDGNEE-----TTVELYTLKNNTWRKIE-DVDSTPEPSGRSGIFWN 254

Query: 231 GAVHWMAIRKESDGTNKDIIVSFDFGDETFR-YRKLPDCLYNTDHIHRERSIGILEKSIA 289
           G ++W+ + K SD     IIVSFD  ++ F+    LP    + D    + ++G+   S+ 
Sbjct: 255 GGLYWLKV-KGSDCEKVYIIVSFDMVEKKFKEVLSLP---RHFDPSRYKANLGMSGNSLC 310

Query: 290 LFVSCHTEDNTAGLGIC-SVYVMKENIEVEHWINLFTV--DLRAQFAWQYLGFGANDEVM 346
           +F  C         G C   +V+  N     W  LF+   D    F    L    N EV+
Sbjct: 311 VFCECK--------GSCFETFVLNINGTETFWTKLFSFPHDRFPGFDNAVLCTTKNGEVV 362

Query: 347 LRNDDGELVLYDHKTQEVVQCESSNW--VANAVIYTESLVSP 386
           L  D  +L LY+ K       E +N   V    +Y ESLVSP
Sbjct: 363 LECDGWKLYLYNPKEGTFRNFEMNNGGDVCELELYIESLVSP 404

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147785389|emb|CAN68677.1| hypothetical protein VITISV_041940 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224129168|ref|XP_002328907.1| predicted protein [Populus trichocarpa] gi|222839337|gb|EEE77674.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297739282|emb|CBI28933.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255569742|ref|XP_002525835.1| conserved hypothetical protein [Ricinus communis] gi|223534840|gb|EEF36529.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|296090345|emb|CBI40164.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224114972|ref|XP_002316906.1| predicted protein [Populus trichocarpa] gi|222859971|gb|EEE97518.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356532341|ref|XP_003534732.1| PREDICTED: F-box protein CPR30-like [Glycine max] Back     alignment and taxonomy information
>gi|449444947|ref|XP_004140235.1| PREDICTED: F-box protein CPR30-like [Cucumis sativus] gi|449511918|ref|XP_004164088.1| PREDICTED: F-box protein CPR30-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225433770|ref|XP_002268486.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query386
TAIR|locus:2082410427 AT3G06240 "AT3G06240" [Arabido 0.525 0.475 0.309 1.1e-22
TAIR|locus:2135615413 CPR1 "AT4G12560" [Arabidopsis 0.546 0.510 0.240 6.5e-11
TAIR|locus:2094947360 AT3G16210 "AT3G16210" [Arabido 0.318 0.341 0.248 5.2e-10
TAIR|locus:2075790370 AT3G10430 "AT3G10430" [Arabido 0.225 0.235 0.278 3.7e-09
TAIR|locus:2114673397 AT3G49450 "AT3G49450" [Arabido 0.339 0.329 0.285 6.6e-09
TAIR|locus:2089408374 AT3G16590 "AT3G16590" [Arabido 0.487 0.502 0.251 7e-09
TAIR|locus:2015756400 AT1G30920 "AT1G30920" [Arabido 0.445 0.43 0.242 9.5e-09
TAIR|locus:2160334420 AT5G07610 "AT5G07610" [Arabido 0.318 0.292 0.277 1.2e-08
TAIR|locus:2127465402 AT4G22390 "AT4G22390" [Arabido 0.533 0.512 0.227 1.8e-08
TAIR|locus:2027397363 AT1G11620 "AT1G11620" [Arabido 0.417 0.443 0.274 7.7e-08
TAIR|locus:2082410 AT3G06240 "AT3G06240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 206 (77.6 bits), Expect = 1.1e-22, Sum P(3) = 1.1e-22
 Identities = 72/233 (30%), Positives = 107/233 (45%)

Query:   161 FAITGFGYDHRTSDFKILLIVHAREVASEQFRREFSDIQVYSLKNNCWRRI-QPNVPCIP 219
             F   GFG+D  T D+K++ +V   E        +  D  VYSLK + WRRI   N     
Sbjct:   211 FQTYGFGFDGLTDDYKLVKLVATSE--------DILDASVYSLKADSWRRICNLNYEHND 262

Query:   220 CLSSNSTVHLNGAVHWMAIRKESDGTNKDIIVSFDFGDETFRYRKLPDCLYNTDHIHRER 279
               S  S VH NGA+HW+         N+ ++V+FD   E FR   +PD   +  H     
Sbjct:   263 G-SYTSGVHFNGAIHWVFTESRH---NQRVVVAFDIQTEEFREMPVPDEAEDCSHRFSNF 318

Query:   280 SIGILEKSIALFVSCHTEDNTAGLGICSVYVMKENIEVEHWINLFTVDLRAQFAWQYLGF 339
              +G L   + +  SC+   +        ++VM E  E + W  +  ++L  + + + L  
Sbjct:   319 VVGSLNGRLCVVNSCYDVHD-------DIWVMSEYGEAKSWSRI-RINLLYR-SMKPLCS 369

Query:   340 GANDEVMLRNDDGELVLYDHKTQEVVQ---CE---SSNWVANAVIYTESLVSP 386
               NDE +L   DG+LVLY+ +T        C    S  + AN   Y ESL+SP
Sbjct:   370 TKNDEEVLLELDGDLVLYNFETNASSNLGICGVKLSDGFEANT--YVESLISP 420
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2135615 CPR1 "AT4G12560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094947 AT3G16210 "AT3G16210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075790 AT3G10430 "AT3G10430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2114673 AT3G49450 "AT3G49450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089408 AT3G16590 "AT3G16590" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015756 AT1G30920 "AT1G30920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160334 AT5G07610 "AT5G07610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127465 AT4G22390 "AT4G22390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027397 AT1G11620 "AT1G11620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query386
TIGR01640230 TIGR01640, F_box_assoc_1, F-box protein interactio 1e-20
pfam0064648 pfam00646, F-box, F-box domain 0.002
>gnl|CDD|233502 TIGR01640, F_box_assoc_1, F-box protein interaction domain Back     alignment and domain information 
 Score = 89.3 bits (222), Expect = 1e-20
 Identities = 57/235 (24%), Positives = 89/235 (37%), Gaps = 47/235 (20%)

Query: 93  VSSCSGLVCLLLNTFHSCHFPMFVWNPSTRKYKKIPSHKSFDWEKEQYRSSATASFIWEK 152
           V  C GL+C            + VWNPST + + +P+ KS                    
Sbjct: 1   VVPCDGLICFSYGK------RLVVWNPSTGQSRWLPTPKS-------------------- 34

Query: 153 EMKGSFATFAITGFGYDHRTSDFKILLIVHAREVASEQFRREFSDIQVYSLKNNCWRRIQ 212
             + S         GYD     +K+L              R  S+ QVY+L +N WR I+
Sbjct: 35  --RRSNKESDTYFLGYDPIEKQYKVLCFSDRSG------NRNQSEHQVYTLGSNSWRTIE 86

Query: 213 PNVPCIPCLSSNSTVHLNGAVHWMAIRKESDGTNKDIIVSFDFGDETFRYRKLPDCLYNT 272
            + P  P  S    V +NG ++++A            IVSFD   E F+   +P    N+
Sbjct: 87  CSPPHHPLKSRG--VCINGVLYYLAYTL--KTNPDYFIVSFDVSSERFKEF-IPLPCGNS 141

Query: 273 DHIHRERSIGILEKSIALFVSCHTEDNTAGLGICSVYVMKENIEVEHWINLFTVD 327
           D      S+   +  +A+       +N        ++V+ +  + E W  LFTV 
Sbjct: 142 DS-VDYLSLINYKGKLAVLKQKKDTNNF------DLWVLNDAGKQE-WSKLFTVP 188

This model describes a large family of plant domains, with several hundred members in Arabidopsis thaliana. Most examples are found C-terminal to an F-box (pfam00646), a 60 amino acid motif involved in ubiquitination of target proteins to mark them for degradation. Two-hybid experiments support the idea that most members are interchangeable F-box subunits of SCF E3 complexes. Some members have two copies of this domain. Length = 230
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 386
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 100.0
PF07734164 FBA_1: F-box associated; InterPro: IPR006527 This 99.68
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 99.57
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 99.56
PHA02713557 hypothetical protein; Provisional 99.16
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.13
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.06
PHA03098534 kelch-like protein; Provisional 99.04
PHA02713557 hypothetical protein; Provisional 98.99
PLN02153341 epithiospecifier protein 98.91
PHA02790480 Kelch-like protein; Provisional 98.89
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 98.81
PLN02193470 nitrile-specifier protein 98.81
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 98.79
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.74
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 98.67
PHA03098534 kelch-like protein; Provisional 98.63
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.59
PLN02153341 epithiospecifier protein 98.56
PHA02790480 Kelch-like protein; Provisional 98.54
PLN02193470 nitrile-specifier protein 98.51
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.48
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 98.19
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 98.17
TIGR03548 323 mutarot_permut cyclically-permuted mutatrotase fam 98.12
KOG0281499 consensus Beta-TrCP (transducin repeats containing 97.55
KOG4693392 consensus Uncharacterized conserved protein, conta 97.45
KOG1230 521 consensus Protein containing repeated kelch motifs 97.39
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 97.19
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.04
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 96.75
PF1396450 Kelch_6: Kelch motif 95.89
KOG4693 392 consensus Uncharacterized conserved protein, conta 95.85
KOG1230 521 consensus Protein containing repeated kelch motifs 95.62
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 95.45
KOG2997366 consensus F-box protein FBX9 [General function pre 95.34
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 94.19
PF07762131 DUF1618: Protein of unknown function (DUF1618); In 94.06
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 93.95
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 93.82
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 93.79
COG3055381 Uncharacterized protein conserved in bacteria [Fun 92.57
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 91.85
PRK11138 394 outer membrane biogenesis protein BamB; Provisiona 91.73
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 91.59
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 90.92
PF1396450 Kelch_6: Kelch motif 90.89
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 90.81
smart00284255 OLF Olfactomedin-like domains. 90.56
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 90.18
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 89.38
PF07893 342 DUF1668: Protein of unknown function (DUF1668); In 89.05
KOG2055 514 consensus WD40 repeat protein [General function pr 88.95
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 88.54
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 88.27
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 88.2
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 87.95
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 86.74
smart0061247 Kelch Kelch domain. 86.31
COG1520 370 FOG: WD40-like repeat [Function unknown] 85.27
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 84.77
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 84.39
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 83.48
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 82.12
KOG0294 362 consensus WD40 repeat-containing protein [Function 81.71
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 81.37
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 80.38
PLN02772 398 guanylate kinase 80.23
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 80.13
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 80.12
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information 
Probab=100.00  E-value=3.5e-33  Score=251.41  Aligned_cols=222  Identities=27%  Similarity=0.422  Sum_probs=165.8

Q ss_pred             EeeecccEEEeecCCCCccccEEEEccccccceecCCCCCCchhhhhhccccccccchhhhccCcceeeeEeeeeeecCC
Q 048458           93 VSSCSGLVCLLLNTFHSCHFPMFVWNPSTRKYKKIPSHKSFDWEKEQYRSSATASFIWEKEMKGSFATFAITGFGYDHRT  172 (386)
Q Consensus        93 ~~s~~GLl~~~~~~~~~~~~~~~V~NP~T~~~~~LP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~d~~~  172 (386)
                      ++|||||||+. . ...    ++||||+||+++.||+++...               ...      ....+ +||||+.+
T Consensus         1 ~~sCnGLlc~~-~-~~~----~~V~NP~T~~~~~LP~~~~~~---------------~~~------~~~~~-~~G~d~~~   52 (230)
T TIGR01640         1 VVPCDGLICFS-Y-GKR----LVVWNPSTGQSRWLPTPKSRR---------------SNK------ESDTY-FLGYDPIE   52 (230)
T ss_pred             CcccceEEEEe-c-CCc----EEEECCCCCCEEecCCCCCcc---------------ccc------ccceE-EEeecccC
Confidence            47999999988 3 355    999999999999999876531               000      11235 99999999


Q ss_pred             CCeEEEEEEEeeeccccccccccceEEEEEcCCCceeecCCCCCCccccCCCceEEECCeEEEEEEeecCCCCCceEEEE
Q 048458          173 SDFKILLIVHAREVASEQFRREFSDIQVYSLKNNCWRRIQPNVPCIPCLSSNSTVHLNGAVHWMAIRKESDGTNKDIIVS  252 (386)
Q Consensus       173 ~~ykvv~~~~~~~~~~~~~~~~~~~~~vyss~~~~W~~~~~~~p~~~~~~~~~~v~~~G~lywl~~~~~~~~~~~~~il~  252 (386)
                      ++||||++..... .     .....++||++++++||.+. ..+...... ..+|++||.+||++.. +.+ .....|++
T Consensus        53 ~~YKVv~~~~~~~-~-----~~~~~~~Vys~~~~~Wr~~~-~~~~~~~~~-~~~v~~~G~lyw~~~~-~~~-~~~~~Ivs  122 (230)
T TIGR01640        53 KQYKVLCFSDRSG-N-----RNQSEHQVYTLGSNSWRTIE-CSPPHHPLK-SRGVCINGVLYYLAYT-LKT-NPDYFIVS  122 (230)
T ss_pred             CcEEEEEEEeecC-C-----CCCccEEEEEeCCCCccccc-cCCCCcccc-CCeEEECCEEEEEEEE-CCC-CCcEEEEE
Confidence            9999999976421 1     23568999999999999998 333222222 2399999999999976 432 11138999


Q ss_pred             EECCCceee-eecCCCCCCCCCCccceeEEEEeCCeEEEEEeeCCCCCCCCCCEEEEEEEeecCCCcceEEEEEeecCCC
Q 048458          253 FDFGDETFR-YRKLPDCLYNTDHIHRERSIGILEKSIALFVSCHTEDNTAGLGICSVYVMKENIEVEHWINLFTVDLRAQ  331 (386)
Q Consensus       253 fD~~~~~~~-~i~~P~~~~~~~~~~~~~~L~~~~G~L~lv~~~~~~~~~~~~~~i~iW~l~~~~~~~~W~~~~~i~~~~~  331 (386)
                      ||+++|+|+ .+++|......   .....|++++|+|+++......      .+++||+|++++. ++|+++++|+....
T Consensus       123 FDl~~E~f~~~i~~P~~~~~~---~~~~~L~~~~G~L~~v~~~~~~------~~~~IWvl~d~~~-~~W~k~~~i~~~~~  192 (230)
T TIGR01640       123 FDVSSERFKEFIPLPCGNSDS---VDYLSLINYKGKLAVLKQKKDT------NNFDLWVLNDAGK-QEWSKLFTVPIPPL  192 (230)
T ss_pred             EEcccceEeeeeecCcccccc---ccceEEEEECCEEEEEEecCCC------CcEEEEEECCCCC-CceeEEEEEcCcch
Confidence            999999999 58999765321   2357899999999999886531      4699999998765 45999999986331


Q ss_pred             ---ce-eEEEEEecCCeEEEEecC--Ce-EEEEECCCC
Q 048458          332 ---FA-WQYLGFGANDEVMLRNDD--GE-LVLYDHKTQ  362 (386)
Q Consensus       332 ---~~-~~~~~~~~~g~i~l~~~~--~~-l~~ydl~~~  362 (386)
                         .. ..++++.++|+|++....  .. ++.||++++
T Consensus       193 ~~~~~~~~~~~~~~~g~I~~~~~~~~~~~~~~y~~~~~  230 (230)
T TIGR01640       193 PDLVDDNFLSGFTDKGEIVLCCEDENPFYIFYYNVGEN  230 (230)
T ss_pred             hhhhhheeEeEEeeCCEEEEEeCCCCceEEEEEeccCC
Confidence               11 268888888999987764  44 999999885

This model describes a large family of plant domains, with several hundred members in Arabidopsis thaliana. Most examples are found C-terminal to an F-box (pfam00646), a 60 amino acid motif involved in ubiquitination of target proteins to mark them for degradation. Two-hybid experiments support the idea that most members are interchangeable F-box subunits of SCF E3 complexes. Some members have two copies of this domain.
>PF07734 FBA_1: F-box associated; InterPro: IPR006527 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PF07762 DUF1618: Protein of unknown function (DUF1618); InterPro: IPR011676 The proteins of this entry are mainly hypothetical proteins expressed by Oryza sativa Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query386
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.3
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.3
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.29
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.24
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.24
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.19
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.13
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.11
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.09
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.08
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.06
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.01
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 98.98
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.92
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.88
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.8
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 98.77
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 98.73
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.7
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.5
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.43
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 98.14
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.76
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 97.64
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.13
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 96.47
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 95.62
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.37
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 95.11
3jrp_A 379 Fusion protein of protein transport protein SEC13 94.89
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 94.4
4e54_B435 DNA damage-binding protein 2; beta barrel, double 94.27
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 94.23
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 94.1
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 93.8
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 93.31
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 93.24
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 93.08
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 92.99
3jro_A 753 Fusion protein of protein transport protein SEC13 92.75
4e54_B435 DNA damage-binding protein 2; beta barrel, double 92.56
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 92.41
3jrp_A379 Fusion protein of protein transport protein SEC13 92.11
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 92.06
3v9f_A 781 Two-component system sensor histidine kinase/RESP 91.76
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 91.38
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 91.16
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 91.02
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 90.69
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 90.57
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 90.27
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 90.02
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 89.86
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 89.62
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 89.09
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 89.0
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 88.92
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 88.84
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 88.45
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 87.61
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 87.48
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 87.2
4g56_B357 MGC81050 protein; protein arginine methyltransfera 86.94
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 86.93
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 85.84
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 85.6
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 85.53
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 85.27
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 85.08
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 85.07
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 85.06
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 85.02
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 84.78
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 84.75
4g56_B357 MGC81050 protein; protein arginine methyltransfera 84.34
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 83.86
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 83.54
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 83.37
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 83.24
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 82.87
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 82.75
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 82.61
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 82.31
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 81.94
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 81.93
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 81.73
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 81.1
3v9f_A 781 Two-component system sensor histidine kinase/RESP 81.0
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 80.44
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 80.32
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
Probab=99.30  E-value=5.2e-10  Score=103.82  Aligned_cols=200  Identities=9%  Similarity=0.055  Sum_probs=131.1

Q ss_pred             EEEEccccccceecCCCCCCchhhhhhccccccccchhhhccCcceeeeEeeeeeecCCCCeEEEEEEEeeecccccccc
Q 048458          114 MFVWNPSTRKYKKIPSHKSFDWEKEQYRSSATASFIWEKEMKGSFATFAITGFGYDHRTSDFKILLIVHAREVASEQFRR  193 (386)
Q Consensus       114 ~~V~NP~T~~~~~LP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~d~~~~~ykvv~~~~~~~~~~~~~~~  193 (386)
                      ++++||.|++|..+|+++..+                .        ....+.+     .+  +++.+.......+   ..
T Consensus        69 ~~~~d~~~~~W~~~~~~p~~r----------------~--------~~~~~~~-----~~--~lyv~GG~~~~~~---~~  114 (315)
T 4asc_A           69 FLQFDHLDSEWLGMPPLPSPR----------------C--------LFGLGEA-----LN--SIYVVGGREIKDG---ER  114 (315)
T ss_dssp             EEEEETTTTEEEECCCBSSCE----------------E--------SCEEEEE-----TT--EEEEECCEESSTT---CC
T ss_pred             eEEecCCCCeEEECCCCCcch----------------h--------ceeEEEE-----CC--EEEEEeCCcCCCC---Cc
Confidence            789999999999999887664                1        1111011     11  4444433211011   13


Q ss_pred             ccceEEEEEcCCCceeecCCCCCCccccCCCceEEECCeEEEEEEeecCCCCCceEEEEEECCCceeeee-cCCCCCCCC
Q 048458          194 EFSDIQVYSLKNNCWRRIQPNVPCIPCLSSNSTVHLNGAVHWMAIRKESDGTNKDIIVSFDFGDETFRYR-KLPDCLYNT  272 (386)
Q Consensus       194 ~~~~~~vyss~~~~W~~~~~~~p~~~~~~~~~~v~~~G~lywl~~~~~~~~~~~~~il~fD~~~~~~~~i-~~P~~~~~~  272 (386)
                      ....+++|+..+++|+.++ .+|..  ...+..+.++|.+|.+++. ..+......+.+||+.+++|+.+ ++|...   
T Consensus       115 ~~~~~~~~d~~~~~W~~~~-~~p~~--r~~~~~~~~~~~iyv~GG~-~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r---  187 (315)
T 4asc_A          115 CLDSVMCYDRLSFKWGESD-PLPYV--VYGHTVLSHMDLVYVIGGK-GSDRKCLNKMCVYDPKKFEWKELAPMQTAR---  187 (315)
T ss_dssp             BCCCEEEEETTTTEEEECC-CCSSC--CBSCEEEEETTEEEEECCB-CTTSCBCCCEEEEETTTTEEEECCCCSSCC---
T ss_pred             ccceEEEECCCCCcEeECC-CCCCc--ccceeEEEECCEEEEEeCC-CCCCcccceEEEEeCCCCeEEECCCCCCch---
Confidence            4567999999999999998 56554  4556688899999999876 33333346799999999999998 455432   


Q ss_pred             CCccceeEEEEeCCeEEEEEeeCCCCCCCCCCEEEEEEEeecCCCcceEEEEEeecCCCceeEEEEEecCCeEEEEec--
Q 048458          273 DHIHRERSIGILEKSIALFVSCHTEDNTAGLGICSVYVMKENIEVEHWINLFTVDLRAQFAWQYLGFGANDEVMLRND--  350 (386)
Q Consensus       273 ~~~~~~~~L~~~~G~L~lv~~~~~~~~~~~~~~i~iW~l~~~~~~~~W~~~~~i~~~~~~~~~~~~~~~~g~i~l~~~--  350 (386)
                          .....+..+|+|+++++....     ...-++|+++-  ...+|+.+..++.....  ..+++. ++.|++...  
T Consensus       188 ----~~~~~~~~~~~iyv~GG~~~~-----~~~~~~~~yd~--~~~~W~~~~~~p~~r~~--~~~~~~-~~~l~v~GG~~  253 (315)
T 4asc_A          188 ----SLFGATVHDGRIIVAAGVTDT-----GLTSSAEVYSI--TDNKWAPFEAFPQERSS--LSLVSL-VGTLYAIGGFA  253 (315)
T ss_dssp             ----BSCEEEEETTEEEEEEEECSS-----SEEEEEEEEET--TTTEEEEECCCSSCCBS--CEEEEE-TTEEEEEEEEE
T ss_pred             ----hceEEEEECCEEEEEeccCCC-----CccceEEEEEC--CCCeEEECCCCCCcccc--eeEEEE-CCEEEEECCcc
Confidence                334567789999999987651     13446788874  24689987654432211  122222 456666422  


Q ss_pred             -------------CCeEEEEECCCCeEEEee
Q 048458          351 -------------DGELVLYDHKTQEVVQCE  368 (386)
Q Consensus       351 -------------~~~l~~ydl~~~~~~~v~  368 (386)
                                   ...+..||+++++|+.+.
T Consensus       254 ~~~~~~~~~~~~~~~~v~~yd~~~~~W~~~~  284 (315)
T 4asc_A          254 TLETESGELVPTELNDIWRYNEEEKKWEGVL  284 (315)
T ss_dssp             EEECTTSCEEEEEEEEEEEEETTTTEEEEEE
T ss_pred             ccCcCCccccccccCcEEEecCCCChhhhhc
Confidence                         124899999999999983
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 386
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 4e-05
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 38.1 bits (89), Expect = 4e-05
 Identities = 10/38 (26%), Positives = 19/38 (50%)

Query: 4  SLPAKFMLETLLKLPVKTLTRFKCVSKQWHSVISNPTF 41
          SLP + +L     L +  L +   V K+W+ + S+ + 
Sbjct: 3  SLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESL 40

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query386
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.12
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 98.62
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 98.53
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.49
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.34
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 98.31
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.0
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 97.99
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 94.76
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 90.17
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 85.62
d2ghsa1 295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 83.03
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.12  E-value=4.2e-12  Score=78.48  Aligned_cols=40  Identities=25%  Similarity=0.421  Sum_probs=37.5

Q ss_pred             CCCCcHHHHHHHHccCCccccceeeeccccccccccChhh
Q 048458            2 SKSLPAKFMLETLLKLPVKTLTRFKCVSKQWHSVISNPTF   41 (386)
Q Consensus         2 ~~~LP~dll~~IL~rLP~~sl~r~~~VcK~W~~liss~~F   41 (386)
                      ++.||+|++.+||++||+++|.|++.|||+|+.+++++.+
T Consensus         1 f~~LP~eil~~If~~L~~~dl~~~~~Vcr~w~~l~~~~~l   40 (41)
T d1fs1a1           1 WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESL   40 (41)
T ss_dssp             CCSSCHHHHHHHHTTSCGGGHHHHHTTCHHHHHHHTCGGG
T ss_pred             CCcCCHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhCCccc
Confidence            4789999999999999999999999999999999998764
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure