Score = 123 (48.4 bits), Expect = 5.9e-07, P = 5.9e-07
Identities = 30/100 (30%), Positives = 44/100 (44%)
Query: 1 LGFFVFNPAYMLSSLSETVTVKSLVTLWFIPVNXXXXXXXXXXXXXXXXXXTRTPPHLYS 60
L F +F P + + L E++T+ ++V WFIPVN R PP
Sbjct: 55 LVFALFLPCLIFTELGESITLDNIVQWWFIPVNVLLSAVVGSLIGYLVVLICRPPPEFNR 114
Query: 61 LVVSCCSSGNY-LFLLVIAPAVCEMSNSPFGDSSACSSDG 99
+ + GN LL I +VC +PFG + C+S G
Sbjct: 115 FTIVMTAFGNTGNLLLAIVSSVCHTKTNPFGPN--CNSRG 152
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.323 0.134 0.416 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 109 91 0.00091 102 3 11 22 0.43 29
29 0.39 31
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 6
No. of states in DFA: 549 (58 KB)
Total size of DFA: 109 KB (2073 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 8.77u 0.13s 8.90t Elapsed: 00:00:00
Total cpu time: 8.77u 0.13s 8.90t Elapsed: 00:00:00
Start: Sat May 11 05:00:00 2013 End: Sat May 11 05:00:00 2013
>PF03547 Mem_trans: Membrane transport protein; InterPro: IPR004776 This entry represents a mostly uncharacterised family of membrane transport proteins found in eukaryotes, bacteria and archaea
Most characterised members of this family are the PIN components of auxin efflux systems from plants. These carriers are saturable, auxin-specific, and localized to the basal ends of auxin transport-competent cells [, ]. Plants typically posses several of these proteins, each displaying a unique tissue-specific expression pattern. They are expressed in almost all plant tissues including vascular tissues and roots, and influence many processes including the establishment of embryonic polarity, plant growth, apical hook formation in seedlings and the photo- and gravitrophic responses. These plant proteins are typically 600-700 amino acyl residues long and exhibit 8-12 transmembrane segments.; GO: 0055085 transmembrane transport, 0016021 integral to membrane
>COG0679 Predicted permeases [General function prediction only]
The first protein of the ACR3 family functionally characterized was the ACR3 protein of Saccharomyces cerevisiae. It is present in the yeast plasma membrane and pumps arsenite out of the cell in response to the pmf. Similar proteins are found in bacteria, often as part of a four gene operon with an regulatory protein ArsR, a protein of unknown function ArsH, and an arsenate reductase that converts arsenate to arsenite to facilitate transport.
Functionally characterized members of the BASS family catalyze Na+:bile acid symport. These systems have been identified in intestinal, liver and kidney tissues of animals. These symporters exhibit broad specificity, taking up a variety of non bile organic compounds as well as taurocholate and other bile salts. Functionally uncharacterised homologues are found in plants, yeast, archaea and bacteria.
>COG0385 Predicted Na+-dependent transporter [General function prediction only]