Citrus Sinensis ID: 048518

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MVLKGPEKVSLLLGNDGTKMLLKRTEDLRLYSLTGVQNVVHELDDGEGFPRLQHLHVTGCSEILHIVGSVRRVRCEVFPLLESLDLINLTNLETICYSQLREDQSFSNLRIIYVYSCPKLKYLFSFSMAKNLLGLQKVEVVNCNKLKMMIGPDMEKPTTTQGFTEINAEDDQVTFPRLEELELVSLTNIKKLWPDQFQGMYCCQNLTKVTVTRCCPLKYMFSYSMANSLGQLRHLEIINCWSMEGIVNTTGLGGRDEFK
cEEEcccccccccccccHHHHcccccEEEEEEcccccccccccccccccccccEEEEEEccccEEEccccccccccccccccEEEccccccccEEcccccccccccccccEEEEEcccccccccccccccccccccEEEEEEcccccEEccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccccccccccccccccc
ccccccccccHccccHHHHHHHHHHHHHHHHHcccccHccccccccccccccEEEEEcccHHHHHHccccccccccHcHcHcEEEEcccHcHHHHHcccccccccccccEEEEEcccHHHHHcccHHHHHHHHHHcEEEEccHHHHHEEEcccccccccccccEEEcccccEEEcccccEEEEcccccHHHHcccccccccEcccccEEEEEccccHHHcccHHHHHHHHHHcEEEEccHHHHHHHHcccccccccccc
MVLKGPEKVSLLLGNDGTKMLLKRTEDLRLYSLTGVQnvvhelddgegfprlqhlhvtgCSEILHIVGSVRrvrcevfpllesldlinltnlETICYSQLREDQSFSNLRIIYVYSCPKLKYLFSFSMAKNLLGLQKVEVVNCNKlkmmigpdmekptttqgfteinaeddqvtfprleeLELVSLTNikklwpdqfqgmyccqnltkvtvtrccplkyMFSYSMANSLGQLRHLEIINCWSmegivnttglggrdefk
mvlkgpekvslllgndgTKMLLKRTEDLRLYSLTGVQNVVHELDDGEGFPRLQHLHVTGCSEILHIVGSVRRVRCEVFPLlesldlinltNLETICYSQlredqsfsnLRIIYVYSCPKLKYLFSFSMAKNLLGLQKVEVVNCNKLKMmigpdmekpttTQGFTEINAEDDQVTFPRLEELELVSLTNIKKLWPDQFQGMYCCQNLTKVTVTRCCPLKYMFSYSMANSLGQLRHLEIINCWSMEGIvnttglggrdefk
MVLKGPEKVSLLLGNDGTKMLLKRTEDLRLYSLTGVQNVVHELDDGEGFPRLQHLHVTGCSEILHIVGSVRRVRCEVFPLLESLDLINLTNLETICYSQLREDQSFSNLRIIYVYSCPKLKYLFSFSMAKNLLGLQKVEVVNCNKLKMMIGPDMEKPTTTQGFTEINAEDDQVTFPRLEELELVSLTNIKKLWPDQFQGMYCCQNLTKVTVTRCCPLKYMFSYSMANSLGQLRHLEIINCWSMEGIVNTTGLGGRDEFK
**********LLLGNDGTKMLLKRTEDLRLYSLTGVQNVVHELDDGEGFPRLQHLHVTGCSEILHIVGSVRRVRCEVFPLLESLDLINLTNLETICYSQLREDQSFSNLRIIYVYSCPKLKYLFSFSMAKNLLGLQKVEVVNCNKLKMMIGP*********GFTEINAEDDQVTFPRLEELELVSLTNIKKLWPDQFQGMYCCQNLTKVTVTRCCPLKYMFSYSMANSLGQLRHLEIINCWSMEGIVNTTGL*******
MV*****KVSLLLGNDGTKMLLKRTEDLRLYSLTGVQNVVHELDDGEGFPRLQHLHVTGCSEILHIVGSVRRVRCEVFPLLESLDLINLTNLETICYSQLREDQSFSNLRIIYVYSCPKLKYLFSFSMAKNLLGLQKVEVVNCNKLKMMIGP*******************QVTFPRLEELELVSLTNIKKLWPDQFQGMYCCQNLTKVTVTRCCPLKYMFSYSMANSLGQLRHLEIINCWSMEGIVN***********
MVLKGPEKVSLLLGNDGTKMLLKRTEDLRLYSLTGVQNVVHELDDGEGFPRLQHLHVTGCSEILHIVGSVRRVRCEVFPLLESLDLINLTNLETICYSQLREDQSFSNLRIIYVYSCPKLKYLFSFSMAKNLLGLQKVEVVNCNKLKMMIGPDMEKPTTTQGFTEINAEDDQVTFPRLEELELVSLTNIKKLWPDQFQGMYCCQNLTKVTVTRCCPLKYMFSYSMANSLGQLRHLEIINCWSMEGIVNTTGLGGRDEFK
MVLKGPEKVSLLLGNDGTKMLLKRTEDLRLYSLTGVQNVVHELDDGEGFPRLQHLHVTGCSEILHIVGSVRRVRCEVFPLLESLDLINLTNLETICYSQLREDQSFSNLRIIYVYSCPKLKYLFSFSMAKNLLGLQKVEVVNCNKLKMMIGPDMEKPTTTQGFTEINAEDDQVTFPRLEELELVSLTNIKKLWPDQFQGMYCCQNLTKVTVTRCCPLKYMFSYSMANSLGQLRHLEIINCWSMEGIVNTT*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLKGPEKVSLLLGNDGTKMLLKRTEDLRLYSLTGVQNVVHELDDGEGFPRLQHLHVTGCSEILHIVGSVRRVRCEVFPLLESLDLINLTNLETICYSQLREDQSFSNLRIIYVYSCPKLKYLFSFSMAKNLLGLQKVEVVNCNKLKMMIGPDMEKPTTTQGFTEINAEDDQVTFPRLEELELVSLTNIKKLWPDQFQGMYCCQNLTKVTVTRCCPLKYMFSYSMANSLGQLRHLEIINCWSMEGIVNTTGLGGRDEFK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query259
224110992 2359 cc-nbs-lrr resistance protein [Populus t 0.903 0.099 0.359 3e-36
357439641 1261 Cc-nbs resistance protein, partial [Medi 0.872 0.179 0.378 1e-33
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.907 0.178 0.337 3e-33
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.888 0.171 0.354 4e-33
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.899 0.203 0.352 5e-32
358344903 2248 Cc-nbs-lrr resistance protein [Medicago 0.868 0.100 0.358 1e-30
358344919 1995 NBS/LRR resistance protein-like protein 0.814 0.105 0.418 2e-30
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.888 0.172 0.347 2e-30
357456329 1280 Cc-nbs resistance protein [Medicago trun 0.880 0.178 0.334 5e-30
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.907 0.095 0.360 4e-29
>gi|224110992|ref|XP_002332999.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834484|gb|EEE72961.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  158 bits (399), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 106/295 (35%), Positives = 155/295 (52%), Gaps = 61/295 (20%)

Query: 15   NDGTKMLLKRTEDLRLYSLTGVQNVVHELDDGEGFPRLQHLHVTGCSEILHIVGSVRRVR 74
            N G +MLL RTEDL L+ + GV N++ ELD  EGFP L+HL +    EI +I+ ++  V 
Sbjct: 723  NYGIRMLLNRTEDLYLFEIEGV-NIIQELD-REGFPHLKHLQLRNSFEIQYIISTMEMVS 780

Query: 75   CEVFPLLESLDLINLTNLETICYSQLREDQSFSNLRIIYVYSCPKLKYLFSFSMAKNLLG 134
               FP+LESL L +L++L+ IC+  LR  +SF+ LRII V  C KL  LFSF +A+ L  
Sbjct: 781  SNAFPILESLILYDLSSLKKICHGALRV-ESFAKLRIIAVEHCNKLTNLFSFFVARGLSQ 839

Query: 135  LQKVEVVNCNKLKMMIGPDME--------------------------------------- 155
            LQK+++  C K++ ++  + +                                       
Sbjct: 840  LQKIKIAFCMKMEEVVAEESDELGDQNEVVDVIQFTQLYSLSLQYLPHLMNFYSKVKPSS 899

Query: 156  ------KPTTTQGFT-EINAED----------DQVTFPRLEELELVSLTNIKKLWPDQFQ 198
                  KP+ T+  + EI +ED          +++ FP LE+L L ++ NI KLW DQ  
Sbjct: 900  LSRTQPKPSITEARSEEIISEDELRTPTQLFNEKILFPNLEDLNLYAI-NIDKLWNDQHP 958

Query: 199  GMYCC-QNLTKVTVTRCCPLKYMFSYSMANSLGQLRHLEIINCWSMEGIVNTTGL 252
             +    QNL ++ V +C  LKY+F  S+ N L QL+HL I NC S+E I+   GL
Sbjct: 959  SISVSIQNLQRLVVNQCGSLKYLFPSSLVNILVQLKHLSITNCMSVEEIIAIGGL 1013

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357439641|ref|XP_003590098.1| Cc-nbs resistance protein, partial [Medicago truncatula] gi|355479146|gb|AES60349.1| Cc-nbs resistance protein, partial [Medicago truncatula] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|358344903|ref|XP_003636525.1| Cc-nbs-lrr resistance protein [Medicago truncatula] gi|355502460|gb|AES83663.1| Cc-nbs-lrr resistance protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|358344919|ref|XP_003636533.1| NBS/LRR resistance protein-like protein [Medicago truncatula] gi|355502468|gb|AES83671.1| NBS/LRR resistance protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357456329|ref|XP_003598445.1| Cc-nbs resistance protein [Medicago truncatula] gi|355487493|gb|AES68696.1| Cc-nbs resistance protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

No hits with e-value below 0.001 by BLAST

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 259
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.55
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.49
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.22
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.17
KOG4341483 consensus F-box protein containing LRR [General fu 98.9
KOG4341483 consensus F-box protein containing LRR [General fu 98.88
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.48
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.43
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.4
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.36
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.34
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.31
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.27
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.26
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.25
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.22
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.21
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.19
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.16
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.11
PRK15386 426 type III secretion protein GogB; Provisional 98.06
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.0
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.97
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.81
PRK15386 426 type III secretion protein GogB; Provisional 97.8
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.8
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.76
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.74
KOG1947 482 consensus Leucine rich repeat proteins, some prote 97.53
KOG0472565 consensus Leucine-rich repeat protein [Function un 97.51
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.49
KOG0472 565 consensus Leucine-rich repeat protein [Function un 97.47
KOG0617264 consensus Ras suppressor protein (contains leucine 97.4
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.38
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.34
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.31
KOG0617264 consensus Ras suppressor protein (contains leucine 97.15
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 96.9
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 96.64
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.36
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.23
PLN03150623 hypothetical protein; Provisional 96.23
PLN03150623 hypothetical protein; Provisional 96.2
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 95.96
KOG1259490 consensus Nischarin, modulator of integrin alpha5 95.87
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.79
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.57
KOG4237498 consensus Extracellular matrix protein slit, conta 95.33
KOG1259490 consensus Nischarin, modulator of integrin alpha5 94.53
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 94.36
KOG2982 418 consensus Uncharacterized conserved protein [Funct 93.92
KOG2123 388 consensus Uncharacterized conserved protein [Funct 93.5
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 93.17
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.1
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 93.09
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.88
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 92.82
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 91.57
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 91.19
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 90.73
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 90.59
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 90.27
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 89.88
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 88.14
KOG2123 388 consensus Uncharacterized conserved protein [Funct 87.73
KOG2982 418 consensus Uncharacterized conserved protein [Funct 86.33
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 85.73
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 82.51
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 81.61
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=99.55  E-value=3.4e-14  Score=138.64  Aligned_cols=44  Identities=16%  Similarity=0.258  Sum_probs=33.3

Q ss_pred             ccCCCccEEEEecCCCCCccCChhHHhhcCCccEEEEecccccccc
Q 048518          201 YCCQNLTKVTVTRCCPLKYMFSYSMANSLGQLRHLEIINCWSMEGI  246 (259)
Q Consensus       201 ~~~~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L~l~~c~~l~~~  246 (259)
                      ..+++|+.|++.+|++++.++.  ....++.|+.+++++|+.+.++
T Consensus       866 ~~l~~L~~L~L~~C~~L~~l~~--~~~~L~~L~~L~l~~C~~L~~~  909 (1153)
T PLN03210        866 EKFSNLSFLDMNGCNNLQRVSL--NISKLKHLETVDFSDCGALTEA  909 (1153)
T ss_pred             hcCCCCCEEECCCCCCcCccCc--ccccccCCCeeecCCCcccccc
Confidence            4567888888888888888766  3456778888888888877654

syringae 6; Provisional
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query259
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
 Score = 44.9 bits (106), Expect = 2e-05
 Identities = 38/222 (17%), Positives = 74/222 (33%), Gaps = 40/222 (18%)

Query: 47  EGFPRLQHLHVTGCSEI----LHIVGSVRRVRCEVFPLLESLDLI--------------- 87
           + F   + L ++ C       L  + +     C     L+ LDL                
Sbjct: 127 KSFKNFKVLVLSSCEGFSTDGLAAIAA----TC---RNLKELDLRESDVDDVSGHWLSHF 179

Query: 88  --NLTNLETICYSQLREDQSFSNLRIIYVYSCPKLKYLFSFSMAKNLLGLQKVEVVNCNK 145
               T+L ++  S L  + SFS L  + V  CP LK L   + A  L  L  + +    +
Sbjct: 180 PDTYTSLVSLNISCLASEVSFSALERL-VTRCPNLKSL-KLNRAVPLEKLATL-LQRAPQ 236

Query: 146 LKMMIGPDMEKPTTTQGFTEINAEDDQVTFPRLEELELVSLTNIKKLWPDQFQGMY-CCQ 204
           L+ +             ++ ++              EL  L+      P     +Y  C 
Sbjct: 237 LEELGTGGYTAEVRPDVYSGLSV-----ALSGC--KELRCLSGFWDAVPAYLPAVYSVCS 289

Query: 205 NLTKVTVTRCCPLKYMFSYSMANSLGQLRHLEIINCWSMEGI 246
            LT + ++    ++      +     +L+ L +++     G+
Sbjct: 290 RLTTLNLS-YATVQSYDLVKLLCQCPKLQRLWVLDYIEDAGL 330
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query259
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.6
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.57
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.44
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.43
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.43
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.43
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.42
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.42
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.41
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.39
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.39
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.35
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.34
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.33
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.33
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.33
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.31
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.31
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.3
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.3
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.3
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.29
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.28
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.28
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.26
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.24
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.23
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.23
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.22
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.22
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.22
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.2
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.2
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.2
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.2
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.19
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.18
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.18
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.18
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.18
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.18
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.17
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.14
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.13
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.11
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.1
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.1
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.08
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.99
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.98
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.98
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.97
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.96
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.93
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.91
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.88
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.87
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.86
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.83
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.83
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.81
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.81
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.79
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.78
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.77
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.77
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.77
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.76
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.74
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.72
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.72
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.71
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.69
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.69
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.67
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.66
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.66
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.64
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.63
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.61
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.6
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.59
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.55
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.53
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.48
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.47
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.38
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.32
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.32
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.32
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.31
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.24
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.22
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.1
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.01
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.97
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.95
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.9
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.89
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.85
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.84
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.78
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.66
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.6
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 97.6
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.58
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.55
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.46
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.88
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 95.19
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.08
4gt6_A394 Cell surface protein; leucine rich repeats, putati 94.54
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 93.91
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 93.28
4gt6_A394 Cell surface protein; leucine rich repeats, putati 92.35
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 92.2
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 90.6
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.60  E-value=1.1e-14  Score=122.77  Aligned_cols=185  Identities=18%  Similarity=0.234  Sum_probs=92.8

Q ss_pred             HhccceeeeccccccceeccccCCCCCCCCccEEEEecCcCcceecccccccccCCCCcccEeeccccccccccccc---
Q 048518           22 LKRTEDLRLYSLTGVQNVVHELDDGEGFPRLQHLHVTGCSEILHIVGSVRRVRCEVFPLLESLDLINLTNLETICYS---   98 (259)
Q Consensus        22 ~~~L~~L~l~~~~~~~~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~---   98 (259)
                      +++|++|++.++. +..++..   +..+++|+.|+++++. +..+ +.    ....+++|+.|++++|..+..+...   
T Consensus       103 l~~L~~L~L~~n~-l~~lp~~---~~~l~~L~~L~Ls~n~-l~~l-p~----~l~~l~~L~~L~L~~n~~~~~~p~~~~~  172 (328)
T 4fcg_A          103 LSHLQHMTIDAAG-LMELPDT---MQQFAGLETLTLARNP-LRAL-PA----SIASLNRLRELSIRACPELTELPEPLAS  172 (328)
T ss_dssp             GTTCSEEEEESSC-CCCCCSC---GGGGTTCSEEEEESCC-CCCC-CG----GGGGCTTCCEEEEEEETTCCCCCSCSEE
T ss_pred             CCCCCEEECCCCC-ccchhHH---HhccCCCCEEECCCCc-cccC-cH----HHhcCcCCCEEECCCCCCccccChhHhh
Confidence            5566666665553 3333222   3456666666666653 2233 21    2334566666666666544433110   


Q ss_pred             -ccc-CcccCCCccEEEEecCCCceEecchhhhhhcCCCcEEEEEeccCcceecccCCCCCcccCCccccccCCCccccC
Q 048518           99 -QLR-EDQSFSNLRIIYVYSCPKLKYLFSFSMAKNLLGLQKVEVVNCNKLKMMIGPDMEKPTTTQGFTEINAEDDQVTFP  176 (259)
Q Consensus        99 -~~~-~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~l~~~~~~~~~~~~~~~l~  176 (259)
                       ..+ .+..+++|+.|+++++ .++.+ |.. +.++++|+.|++++|.-. .++.                   .+..++
T Consensus       173 ~~~~~~~~~l~~L~~L~L~~n-~l~~l-p~~-l~~l~~L~~L~L~~N~l~-~l~~-------------------~l~~l~  229 (328)
T 4fcg_A          173 TDASGEHQGLVNLQSLRLEWT-GIRSL-PAS-IANLQNLKSLKIRNSPLS-ALGP-------------------AIHHLP  229 (328)
T ss_dssp             EC-CCCEEESTTCCEEEEEEE-CCCCC-CGG-GGGCTTCCEEEEESSCCC-CCCG-------------------GGGGCT
T ss_pred             ccchhhhccCCCCCEEECcCC-CcCcc-hHh-hcCCCCCCEEEccCCCCC-cCch-------------------hhccCC
Confidence             000 0123666777777665 34433 333 345667777777665322 2222                   233455


Q ss_pred             CcCEEeeCCCccccccCcCCCcccccCCCccEEEEecCCCCCccCChhHHhhcCCccEEEEeccccccc
Q 048518          177 RLEELELVSLTNIKKLWPDQFQGMYCCQNLTKVTVTRCCPLKYMFSYSMANSLGQLRHLEIINCWSMEG  245 (259)
Q Consensus       177 ~L~~L~l~~c~~l~~l~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L~l~~c~~l~~  245 (259)
                      +|+.|++++|...+.++..    +..+++|+.|++++|..+..+|.  ....+++|++|++++|+.++.
T Consensus       230 ~L~~L~Ls~n~~~~~~p~~----~~~l~~L~~L~L~~n~~~~~~p~--~~~~l~~L~~L~L~~n~~~~~  292 (328)
T 4fcg_A          230 KLEELDLRGCTALRNYPPI----FGGRAPLKRLILKDCSNLLTLPL--DIHRLTQLEKLDLRGCVNLSR  292 (328)
T ss_dssp             TCCEEECTTCTTCCBCCCC----TTCCCCCCEEECTTCTTCCBCCT--TGGGCTTCCEEECTTCTTCCC
T ss_pred             CCCEEECcCCcchhhhHHH----hcCCCCCCEEECCCCCchhhcch--hhhcCCCCCEEeCCCCCchhh
Confidence            6666666665444333221    23455666666666655555554  244556666666666555443
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query259
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.52
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.31
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.31
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.25
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.23
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.12
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.09
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.06
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.03
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.02
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.0
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.97
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.95
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.95
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.74
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.65
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.6
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.6
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.57
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.4
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.35
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.3
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.06
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.01
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.87
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.77
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 97.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.21
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.09
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.36
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.02
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 92.78
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 91.98
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 91.42
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 90.95
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 88.97
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 88.88
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.56  E-value=7.9e-16  Score=125.28  Aligned_cols=90  Identities=14%  Similarity=0.125  Sum_probs=39.3

Q ss_pred             CCCCCccEEEEecCcCcceecccccccccCCCCcccEeeccccccccccccccccCcccCCCccEEEEecCCCceEecch
Q 048518           47 EGFPRLQHLHVTGCSEILHIVGSVRRVRCEVFPLLESLDLINLTNLETICYSQLREDQSFSNLRIIYVYSCPKLKYLFSF  126 (259)
Q Consensus        47 ~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~  126 (259)
                      .++++|++|.+.+|. +...   . ......+++|++|++++|..+.+.....+  ...+++|++|++++|..+++....
T Consensus        68 ~~c~~L~~L~L~~~~-l~~~---~-~~~l~~~~~L~~L~Ls~c~~itd~~l~~l--~~~~~~L~~L~ls~c~~~~~~~~~  140 (284)
T d2astb2          68 SQCSKLQNLSLEGLR-LSDP---I-VNTLAKNSNLVRLNLSGCSGFSEFALQTL--LSSCSRLDELNLSWCFDFTEKHVQ  140 (284)
T ss_dssp             TTBCCCSEEECTTCB-CCHH---H-HHHHTTCTTCSEEECTTCBSCCHHHHHHH--HHHCTTCCEEECCCCTTCCHHHHH
T ss_pred             HhCCCcccccccccC-CCcH---H-HHHHhcCCCCcCccccccccccccccchh--hHHHHhccccccccccccccccch
Confidence            355566666665553 2110   0 00122345566666665555543221111  134555666666555554432111


Q ss_pred             -hhhhhcCCCcEEEEEec
Q 048518          127 -SMAKNLLGLQKVEVVNC  143 (259)
Q Consensus       127 -~~~~~l~~L~~L~l~~c  143 (259)
                       .+...+++|+.|++.+|
T Consensus       141 ~~~~~~~~~L~~L~l~~~  158 (284)
T d2astb2         141 VAVAHVSETITQLNLSGY  158 (284)
T ss_dssp             HHHHHSCTTCCEEECCSC
T ss_pred             hhhcccccccchhhhccc
Confidence             12222345555555554
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure