Citrus Sinensis ID: 048566

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760
MGGIGKTTLVKKVARQAMEDKLFDMVVFSEVSQIPDIKRIQQEIAEKLGLELREEVESSRASRIFERLRNEKKILVVLDNIWKHLDLETVGIPFGEDHKGCKLLLTARDRKEAWRLFKMMVGDDVENRELKSTAIDVARACGGLPIALTTVAMALRSKSLHGWKVSLGELRTPSMDNFEGVSAETYSSIELSFNHLKDEQLKKIFLLCSQMETRILTLDLFKYSMGLGIFKRVNKMEDARDKLYALVHELRNSCLLIEDSNEQFSMHDVVRDVAISIGCRDQHGILVGNEDVWDWRNEDALRKCKAITLRYDSNRHFPEGLECPNLEFLCISLKDSSLEINIPGNFFIGMKKLRVLDFTRMQFSSFPSSIDLLVNLHTLCLDQSALGDIAIIGKLKNLEVLSFLMSDIMQLPEELGQLNKLRLLDLTNCFHLKVIAPNLISSLTRLEELYMGNCFIEWEVERANSKRSNASLDELMHLPRLTTLEIDVKNDSILPEGFLARKLERFKISIGNESFMPPKCVRQDWFQSQPHFSINSDRKSLRALKLKLDFMDICSMKLQGINNVECLWLDKLQGIGDVLFNLDTEGFSQLKLLWVQNNPDIFCIVDSREMVACDAFPLLESLILHNLINMERVCIDRLKVESFNQLKNIEAYNCDKLSNIFWLSTTKCLPRLERIAVVNCSKMKEIFAIGEEVDNAIEKIEFAQLRSLSLGNLPEVTSFCREVKTPSASPNRPVSQEESTTMYGSSEITLDTSTLLFNEK
cccccHHHHHHHHHHHHcccccccEEEEEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccEEEEEEccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccHHHHHHHcccccccHHHHHHHcccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccccccEEEEcHHHHHHHHHHHcccccEEEEcccccccccccccccEEEEEEEEccccccccccccccccEEEEEEccccccccccccccccccccEEEEEccccccccccccccccccccEEEccccccccccccccHHHHHHHcccccccccccHHHcccccccEEcccccccccccccccccccccccEEEcccccccHHHHHccccccccccccccccccccEEEEEEEccccccccHHHHcccccEEEccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccccccEEEEEcccccEEEccccccccccccccccEEEEcccccccEEEEccccccccccccEEEEEcccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccHHHHHHHHHccHHHHHHccEEEEEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccEEEEEEEccccHccHHHHcccccccccccEEEEEEccHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHccccccccccHHHEEcHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcHHccccccccEEEHHHHHHHHHHHHcccEEEEEEccccccccccccccccEEEEEEEcccccccccccccccccEEEEEcccccccccccHHHHHHccccEEEEEcccccccccccccccccccEEEEcccccccccccccccccEEEEEccccccccccHHcccccccEEEEcccccccccccHHcccccccEEEEEccccccccccccccccccccHHHHcccccccEEEEccccccccccccccccccEEEEEccccccccccccccccHHHHccccccccccccEEccccccccccccccccccccccEEEEccccccccccccccccccccccEEEcccccccEEcccccccccccccccccEEEEcccccHHcccccccccccccccEEEEEcccccHHHccccccccccccccEEEEcccccHHHcccccccccccccccccccccEEEEcccHHHHHHcccccccccccccEEEccccccccccccccccccEEEEccc
MGGIGKTTLVKKVARQAMEDKLFDMVVFsevsqipdIKRIQQEIAEKLGLELREEVESSRASRIFERLRNEKKILVVLDNIWKhldletvgipfgedhkGCKLLLTARDRKEAWRLFKMMVgddvenreLKSTAIDVARACGGLPIALTTVAMALRSKSLHgwkvslgelrtpsmdnfegvsaeTYSSIELSFNHLKDEQLKKIFLLCSQMETRILTLDLFKYSMGLGIFKRVNKMEDARDKLYALVHELRNSclliedsneqfsmHDVVRDVAISigcrdqhgilvgnedvwdwrNEDALRKCKAITLrydsnrhfpeglecpnleFLCISlkdssleinipgnffigMKKLRVLDFTrmqfssfpssIDLLVNLHTLcldqsalgdIAIIGKLKNLEVLSFLMSDIMQLPEELGQLnklrlldltncfhlkVIAPNLISSLTRLEELYMGNCFIEWEVERAnskrsnasldelmhlprlttleidvkndsilpegFLARKLERFKISignesfmppkcvrqdwfqsqphfsinsdRKSLRALKLKLDFMDICSmklqginnveCLWLDKLQGIGDVLFNLDTEGFSQLKLLWvqnnpdifcivdsremvacdaFPLLESLILHNLINMERVCIDRlkvesfnqlknieayncdklsnifwlsttkclprleriAVVNCSKMKEIFAIGEEVDNAIEKIEFAQLRslslgnlpevtsfcrevktpsaspnrpvsqeesttmygsseitldtstllfnek
mggigkttlVKKVARQAMEDKLFDMVVFSevsqipdikRIQQEIAEKLglelreevessrasriferlrneKKILVVLDNIWKHLDLEtvgipfgedhkGCKLLLTARDRKEAWRLFKMmvgddvenrELKSTAIDVARACGGLPIALTTVAMALRSKSLHGWKVSLGELRTPSMDNFEGVSAETYSSIELSFNHLKDEQLKKIFLLCSQMETRILTLDLFKYSMGLGIFKRVNKMEDARDKLYALVHELRNSCLLIEDSNEQFSMHDVVRDVAISIgcrdqhgilvgnedvwdwrNEDALRKCKAITLRYDSNRHFPEGLECPNLEFLCISLKDSSLEINIPGNFFIGMKKLRVLDFTRMQFSSFPSSIDLLVNLHTLCLDQSALGDIAIIGKLKNLEVLSFLMSDIMQLPEELGQLNKLRLLDLTNCFHLKVIAPNLISSLTRLEELYMGNCFIEWEVERANSKRsnasldelmhlprlttleidvkndsiLPEGFLARKLERFKISIGNESFMPPKCVRQDWFQSQphfsinsdrKSLRALKLKLDFMDICSMKLQGINNVECLWLDKLQGIGDVLFNLDTEGFSQLKLLWVQNNPDIFCIVDSREMVACDAFPLLESLILHNLINMERVCIDRLKVESFNQLKNieayncdklsnIFWLSTTKCLPRLERIAVVNCSKMKEIFAIGEEVDNAIEKIEFAQLRSLSLGNLPEVTSFCrevktpsaspnrpvsqeesttmygsseitldtstllfnek
MGGIGKTTLVKKVARQAMEDKLFDMVVFSEVSQIPDIKRIQQEIAEKLGLELREEVESSRASRIFERLRNEKKILVVLDNIWKHLDLETVGIPFGEDHKGCKLLLTARDRKEAWRLFKMMVGDDVENRELKSTAIDVARACGGLPIALTTVAMALRSKSLHGWKVSLGELRTPSMDNFEGVSAETYSSIELSFNHLKDEQLKKIFLLCSQMETRILTLDLFKYSMGLGIFKRVNKMEDARDKLYALVHELRNSCLLIEDSNEQFSMHDVVRDVAISIGCRDQHGILVGNEDVWDWRNEDALRKCKAITLRYDSNRHFPEGLECPNLEFLCISLKDSSLEINIPGNFFIGMKKLRVLDFTRMQFSSFPSSIDLLVNLHTLCLDQSALGDIAIIGKLKNLEVLSFLMSDIMQLPEELGQLNKLRLLDLTNCFHLKVIAPNLISSLTRLEELYMGNCFIEWEVERANSKRSNASLDELMHLPRLTTLEIDVKNDSILPEGFLARKLERFKISIGNESFMPPKCVRQDWFQSQPHFSINSDRKSLRALKLKLDFMDICSMKLQGINNVECLWLDKLQGIGDVLFNLDTEGFSQLKLLWVQNNPDIFCIVDSREMVACDAFPLLESLILHNLINMERVCIDRLKVESFNQLKNIEAYNCDKLSNIFWLSTTKCLPRLERIAVVNCSKMKEIFAIGEEVDNAIEKIEFAQLRSLSLGNLPEVTSFCREVKTPSASPNRPVSQEESTTMYGSSEITLDTSTLLFNEK
********LVKKVARQAMEDKLFDMVVFSEVSQIPDIKRIQQEIAEKLGLE***********RIFERLRNEKKILVVLDNIWKHLDLETVGIPFGEDHKGCKLLLTARDRKEAWRLFKMMVGDDVENRELKSTAIDVARACGGLPIALTTVAMALRSKSLHGWKVSLGELRTPSMDNFEGVSAETYSSIELSFNHLKDEQLKKIFLLCSQMETRILTLDLFKYSMGLGIFKRVNKMEDARDKLYALVHELRNSCLLIEDSNEQFSMHDVVRDVAISIGCRDQHGILVGNEDVWDWRNEDALRKCKAITLRYDSNRHFPEGLECPNLEFLCISLKDSSLEINIPGNFFIGMKKLRVLDFTRMQFSSFPSSIDLLVNLHTLCLDQSALGDIAIIGKLKNLEVLSFLMSDIMQLPEELGQLNKLRLLDLTNCFHLKVIAPNLISSLTRLEELYMGNCFIEWEVER**********DELMHLPRLTTLEIDVKNDSILPEGFLARKLERFKISIGNESFMPPKCVRQDWFQSQPHFSINSDRKSLRALKLKLDFMDICSMKLQGINNVECLWLDKLQGIGDVLFNLDTEGFSQLKLLWVQNNPDIFCIVDSREMVACDAFPLLESLILHNLINMERVCIDRLKVESFNQLKNIEAYNCDKLSNIFWLSTTKCLPRLERIAVVNCSKMKEIFAIGEEVDNAIEKIEFAQLRSLSLGNLPEVTSFC****************************************
MGGIGKTTLVKKVARQAMEDKLFDMVVFSEVSQIPDIKRIQQEIAEKL*******************LRNEKKILVVLDNIWKHLDLETVGIPFGEDHKGCKLLLTARDRKEAWRLFKMMVGDDVENRELKSTAIDVARACGGLPIALTTVAMALRSKSLHGWKVSLGELRTP******G**AETYSSIELSFNHLKDEQLKKIFLLCSQMETRILTLDLFKYSMGLGIFKRVNKMEDARDKLYALVHELRNSCLLIEDSNEQFSMHDVVRDVAISIGCRDQHGILVGNE********DALRKCKAITLRYDSNRHFPEGLECPNLEFLCISLKDSSLEINIPGNFFIGMKKLRVLDFTRMQFSSFPSSIDLLVNLHTLCLDQSALGDIAIIGKLKNLEVLSFLMSDIMQLPEELGQLNKLRLLDLTNCFHLKVIAPNLISSLTRLEELYMGNCFIEWEVERANSKRSNASLDELMHLPRLTTLEIDVKNDSILPEGFLARKLERFKISIGNESFMPPKCVRQDWFQSQPHFSINSDRKSLRALKLKLDFMDICSMKLQGINNVECLWLDKLQGIGDVLFNLDTEGFSQLKLLWVQNNPDIFCIVDSREMVACDAFPLLESLILHNLINMERVCIDRLKVESFNQLKNIEAYNCDKLSNIFWLSTTKCLPRLERIAVVNCSKMKEIFA***********IEFAQLRSLSLGNLPEVTSFCRE*************************ITLDTSTLLFNE*
MGGIGKTTLVKKVARQAMEDKLFDMVVFSEVSQIPDIKRIQQEIAEKLGLEL*********SRIFERLRNEKKILVVLDNIWKHLDLETVGIPFGEDHKGCKLLLTARDRKEAWRLFKMMVGDDVENRELKSTAIDVARACGGLPIALTTVAMALRSKSLHGWKVSLGELRTPSMDNFEGVSAETYSSIELSFNHLKDEQLKKIFLLCSQMETRILTLDLFKYSMGLGIFKRVNKMEDARDKLYALVHELRNSCLLIEDSNEQFSMHDVVRDVAISIGCRDQHGILVGNEDVWDWRNEDALRKCKAITLRYDSNRHFPEGLECPNLEFLCISLKDSSLEINIPGNFFIGMKKLRVLDFTRMQFSSFPSSIDLLVNLHTLCLDQSALGDIAIIGKLKNLEVLSFLMSDIMQLPEELGQLNKLRLLDLTNCFHLKVIAPNLISSLTRLEELYMGNCFIEWEVERANSKRSNASLDELMHLPRLTTLEIDVKNDSILPEGFLARKLERFKISIGNESFMPPKCVRQDWFQSQPHFSINSDRKSLRALKLKLDFMDICSMKLQGINNVECLWLDKLQGIGDVLFNLDTEGFSQLKLLWVQNNPDIFCIVDSREMVACDAFPLLESLILHNLINMERVCIDRLKVESFNQLKNIEAYNCDKLSNIFWLSTTKCLPRLERIAVVNCSKMKEIFAIGEEVDNAIEKIEFAQLRSLSLGNLPEVTSFCRE**********************SSEITLDTSTLLFNEK
**GIGKTTLVKKVARQAMEDKLFDMVVFSEVSQIPDIKRIQQEIAEKLGLELREEVESSRASRIFERLRNEKKILVVLDNIWKHLDLETVGIPFGEDHKGCKLLLTARDRKEAWRLFKMMVGDDVENRELKSTAIDVARACGGLPIALTTVAMALRSKSLHGWKVSLGELRTPSMDNFEGVSAETYSSIELSFNHLKDEQLKKIFLLCSQMETRILTLDLFKYSMGLGIFKRVNKMEDARDKLYALVHELRNSCLLIEDSNEQFSMHDVVRDVAISIGCRDQHGILVGNEDVWDWRNEDALRKCKAITLRYDSNRHFPEGLECPNLEFLCISLKDSSLEINIPGNFFIGMKKLRVLDFTRMQFSSFPSSIDLLVNLHTLCLDQSALGDIAIIGKLKNLEVLSFLMSDIMQLPEELGQLNKLRLLDLTNCFHLKVIAPNLISSLTRLEELYMGNCFIEWEVERANSKRSNASLDELMHLPRLTTLEIDVKNDSILPEGFLARKLERFKISIGNESFMPPKCVRQDWFQSQPHFSINSDRKSLRALKLKLDFMDICSMKLQGINNVECLWLDKLQGIGDVLFNLDTEGFSQLKLLWVQNNPDIFCIVDSREMVACDAFPLLESLILHNLINMERVCIDRLKVESFNQLKNIEAYNCDKLSNIFWLSTTKCLPRLERIAVVNCSKMKEIFAIGEEVDNAIEKIEFAQLRSLSLGNLPEVTSFCREVKTPSASPNRPVSQEESTTMYGSSEITLDTSTLLFNE*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGIGKTTLVKKVARQAMEDKLFDMVVFSEVSQIPDIKRIQQEIAEKLGLELREEVESSRASRIFERLRNEKKILVVLDNIWKHLDLETVGIPFGEDHKGCKLLLTARDRKEAWRLFKMMVGDDVENRELKSTAIDVARACGGLPIALTTVAMALRSKSLHGWKVSLGELRTPSMDNFEGVSAETYSSIELSFNHLKDEQLKKIFLLCSQMETRILTLDLFKYSMGLGIFKRVNKMEDARDKLYALVHELRNSCLLIEDSNEQFSMHDVVRDVAISIGCRDQHGILVGNEDVWDWRNEDALRKCKAITLRYDSNRHFPEGLECPNLEFLCISLKDSSLEINIPGNFFIGMKKLRVLDFTRMQFSSFPSSIDLLVNLHTLCLDQSALGDIAIIGKLKNLEVLSFLMSDIMQLPEELGQLNKLRLLDLTNCFHLKVIAPNLISSLTRLEELYMGNCFIEWEVERANSKRSNASLDELMHLPRLTTLEIDVKNDSILPEGFLARKLERFKISIGNESFMPPKCVRQDWFQSQPHFSINSDRKSLRALKLKLDFMDICSMKLQGINNVECLWLDKLQGIGDVLFNLDTEGFSQLKLLWVQNNPDIFCIVDSREMVACDAFPLLESLILHNLINMERVCIDRLKVESFNQLKNIEAYNCDKLSNIFWLSTTKCLPRLERIAVVNCSKMKEIFAIGEEVDNAIEKIEFAQLRSLSLGNLPEVTSFCREVKTPSASPNRPVSQEESTTMYGSSEITLDTSTLLFNEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query760 2.2.26 [Sep-21-2011]
Q9T048985 Disease resistance protei yes no 0.896 0.691 0.277 6e-63
O81825919 Probable disease resistan no no 0.910 0.752 0.273 2e-56
Q42484909 Disease resistance protei no no 0.817 0.683 0.257 4e-41
O64973889 Disease resistance protei no no 0.563 0.481 0.290 9e-37
Q940K0889 Probable disease resistan no no 0.518 0.443 0.3 4e-36
Q8RXS5888 Probable disease resistan no no 0.498 0.426 0.298 7e-35
O64789925 Probable disease resistan no no 0.531 0.436 0.292 2e-34
P60838894 Probable disease resistan no no 0.523 0.445 0.297 3e-34
O22727967 Probable disease resistan no no 0.518 0.407 0.295 1e-33
O64790762 Probable disease resistan no no 0.796 0.793 0.262 1e-33
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function desciption
 Score =  243 bits (619), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 215/775 (27%), Positives = 377/775 (48%), Gaps = 94/775 (12%)

Query: 1   MGGIGKTTLVKKVARQAMED---KLFDMVVFSEVSQIPDIKRIQQEIAEKLGLELR-EEV 56
           MGG+GKTTLV+ +  +  E+   + F +V+F  VS+  D + +Q++IAE+L ++ + EE 
Sbjct: 172 MGGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEES 231

Query: 57  ESSRASRIFERLRNEKKILVVLDNIWKHLDLETVGIPFGEDHKGCKLLLTARD------- 109
           E   A RI+  L  E+K L++LD++WK +DL+ +GIP  E++KG K++LT+R        
Sbjct: 232 EEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEENKGSKVILTSRFLEVCRSM 291

Query: 110 ------------RKEAWRLFKMMVGDDVENRELKSTAIDVARACGGLPIALTTVAMALRS 157
                        ++AW LF    GD V +  ++  A  V++ CGGLP+A+ TV  A+R 
Sbjct: 292 KTDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMRG 351

Query: 158 -KSLHGWKVSLGELRTPSMDNFEGVSAETYSSIELSFNHLKDEQLKKIFLLCSQM--ETR 214
            K++  W   L +L + S+   + +  + +  ++LS++ L+D+  K  FLLC+    +  
Sbjct: 352 KKNVKLWNHVLSKL-SKSVPWIKSIEEKIFQPLKLSYDFLEDKA-KFCFLLCALFPEDYS 409

Query: 215 ILTLDLFKYSMGLGIFKRVNKMEDARDKLYALVHELRNSCLLIE-DSNEQFSMHDVVRDV 273
           I   ++ +Y M  G  + +   ED+ ++    V  L++ CLL + D  +   MHDVVRD 
Sbjct: 410 IEVTEVVRYWMAEGFMEELGSQEDSMNEGITTVESLKDYCLLEDGDRRDTVKMHDVVRDF 469

Query: 274 AISIGCR---DQHGILVGNEDVWDWRNEDALRKCKAITLRYDSNRHFPEGLECPNLEFLC 330
           AI I      D H +++    + D R +      + ++L  +     P+ +E   ++   
Sbjct: 470 AIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVEEFCVKTSV 529

Query: 331 ISLKDSSLEINIPGNFFIGMKKLRVLDFTRMQFSSFPS-SIDLLVNLHTLCL-DQSALGD 388
           + L+ + L   +P  F      LR+L+ +  +  SFPS S+  L +LH+L L D   L  
Sbjct: 530 LLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCFKLVK 589

Query: 389 IAIIGKLKNLEVLSFLMSDIMQLPEELGQLNKLRLLDLTNCFHLKVIAPNLISSLTRLEE 448
           +  +  L  LE+L    + I++ P  L +L + R LDL+   HL+ I   ++S L+ LE 
Sbjct: 590 LPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLET 649

Query: 449 LYMGNCFIEWEVERANSKRSNASLDELMHLPRLTTLEIDVKNDSIL--PEGFLARKLERF 506
           L M +    W V+   +++  A+++E+  L RL  L I + +   L        ++L++F
Sbjct: 650 LDMTSSHYRWSVQ-GETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKRLKKF 708

Query: 507 KISIGNESFMPPKCVRQDWFQSQPHFSINSDRKSLRALKLKLDFMDICSMKLQGINNVEC 566
           ++ +G+   +  +                 D++ L    L +  + I  +    +     
Sbjct: 709 QLVVGSRYILRTR----------------HDKRRLTISHLNVSQVSIGWL----LAYTTS 748

Query: 567 LWLDKLQGIGDVLFNL--DTEGFSQLKLLWVQNNPDIFCIVDSR---EMVACDAFPLLES 621
           L L+  QGI  ++  L  D +GF  LK L ++N      I+++    EMV+ +      S
Sbjct: 749 LALNHCQGIEAMMKKLVSDNKGFKNLKSLTIEN-----VIINTNSWVEMVSTNTSK-QSS 802

Query: 622 LILHNLINMERVCIDRLKVESFNQLKN-----------IEAYNCDKLSNIFWLSTTKCLP 670
            IL  L N+E + + R+ +E+F++L+            IE   C KL  +        +P
Sbjct: 803 DILDLLPNLEELHLRRVDLETFSELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIP 862

Query: 671 RLERIAVVNCSKMKEIFAIGEEVDNAIEKIEFAQ-----LRSLSLGNLPEVTSFC 720
            LE I +  C  ++          N  E + + Q     LR L L NLP + S C
Sbjct: 863 NLEEIEISYCDSLQ----------NLHEALLYHQPFVPNLRVLKLRNLPNLVSIC 907
Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|O22727|DRL16_ARATH Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=3 SV=1 Back     alignment and function description
>sp|O64790|DRL17_ARATH Probable disease resistance protein At1g61300 OS=Arabidopsis thaliana GN=At1g61300 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query760
255563252 1603 Disease resistance protein RPS5, putativ 0.951 0.451 0.444 1e-164
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.913 0.606 0.448 1e-164
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.960 0.555 0.420 1e-155
296087872 1152 unnamed protein product [Vitis vinifera] 0.967 0.638 0.422 1e-154
359488027 1520 PREDICTED: disease resistance protein At 0.967 0.483 0.422 1e-154
224125154 949 cc-nbs-lrr resistance protein [Populus t 0.961 0.770 0.413 1e-152
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.902 0.511 0.435 1e-148
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.907 0.516 0.435 1e-145
147777048 1460 hypothetical protein VITISV_009359 [Viti 0.944 0.491 0.405 1e-145
359488288 1340 PREDICTED: LOW QUALITY PROTEIN: probable 0.934 0.529 0.401 1e-144
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  585 bits (1509), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 350/787 (44%), Positives = 490/787 (62%), Gaps = 64/787 (8%)

Query: 6   KTTLVKKVARQAMEDKLFDMVVFSEVSQIPDIKRIQQEIAEKLGLELREEVESSRASRIF 65
           KTTL K+V +Q +E+KLFD+VV + VS+ PDI++IQ  IA+ LGL+  EE E+ RA R+ 
Sbjct: 188 KTTLAKEVHQQVIEEKLFDIVVMATVSEKPDIRKIQGNIADVLGLKFDEETETGRAYRLR 247

Query: 66  ERLRNEKKILVVLDNIWKHLDLETVGIPFGEDHKGCKLLLTARDR--------------- 110
           +RL  EKKILV+LDNIW  L+LE VGIP G DHKGCK+LLT+R R               
Sbjct: 248 QRLMTEKKILVILDNIWAQLELEEVGIPCGVDHKGCKILLTSRSRDLLSCDMGVQKVFRL 307

Query: 111 -----KEAWRLFKMMVGDDVENRELKSTAIDVARACGGLPIALTTVAMALRSKSLHGWKV 165
                +EA  LF+MMVG DV+  E +S A +V + C GLP+ + T+A AL++K L+ WK 
Sbjct: 308 EVLQEEEALSLFEMMVG-DVKGGEFQSAASEVTKKCAGLPVLIVTIARALKNKDLYVWKD 366

Query: 166 SLGELRTPSMDNFEGVSAETYSSIELSFNHLKDEQLKKIFLLCSQM-ETRILTLDLFKYS 224
           ++ +L     DN E +  + YS++ELS+NHL   ++K +FLLC  + ++ I  LDL  YS
Sbjct: 367 AVKQLS--RCDN-EEIQEKVYSALELSYNHLIGAEVKSLFLLCGLLGKSDIAILDLLMYS 423

Query: 225 MGLGIFKRVNKMEDARDKLYALVHELRNSCLLIE-DSNEQFSMHDVVRDVAISIGCRDQH 283
            GLG+FK ++ + DAR++++ L+ +L+ +CLL++ D   +  +HDVVRDVAISI  R QH
Sbjct: 424 TGLGLFKGIDTLGDARNRVHKLISDLKAACLLLDSDIKGRVKIHDVVRDVAISIASRMQH 483

Query: 284 GILVGNEDVW-DWRNEDALRKCKAITLRYDSNRHFPEGLECPNLEFLCISLKDSSLEINI 342
              V N  +  +W N+D  + C  I+L Y+     PE LECP LE   +  +D SL+  +
Sbjct: 484 LFTVRNGALLKEWPNKDVCKSCTRISLPYNDIHGLPEVLECPELELFLLFTQDISLK--V 541

Query: 343 PGNFFIGMKKLRVLDFTRMQFSSFPSSIDLLVNLHTLCLDQSALGDIAIIGKLKNLEVLS 402
           P   F   K LRVL+FT M FSS P S+  L NL TLCLD  AL D+AIIG+L  L +LS
Sbjct: 542 PDLCFELTKNLRVLNFTGMHFSSLPPSLGFLKNLFTLCLDWCALRDVAIIGELTGLTILS 601

Query: 403 FLMSDIMQLPEELGQLNKLRLLDLTNCFHLKVIAPNLISSLTRLEELYMGNCFIEWEVER 462
           F  SDI++LP E+ QL KL+ LDL++C  LKVI   +IS LT+LEELYM N F  W+V+ 
Sbjct: 602 FKHSDIVELPREIRQLTKLKFLDLSHCLKLKVIPAKIISELTQLEELYMNNSFDLWDVQG 661

Query: 463 ANSKRSNASLDELMHLPRLTTLEIDVKNDSILPEGFLARKLERFKISIGNESFMPPKCVR 522
            N++R NASL EL  LP LTTLEI V +  ILP+    RKLERF+I IG+          
Sbjct: 662 INNQR-NASLAELECLPYLTTLEICVLDAKILPKDLFFRKLERFRIFIGDV--------- 711

Query: 523 QDWFQSQPHFSINSDRKSLRALKLKLDFMDICSMKLQG-----INNVECLWLDKLQGIGD 577
                    +S   D  + R LKLKL   +  S+ L+      +   E L+L +++GI  
Sbjct: 712 ---------WSGTGDYGTSRTLKLKL---NTSSIHLEHGLSILLEVTEDLYLAEVKGIKS 759

Query: 578 VLFNLDTEGFSQLKLLWVQNNPDIFCIVDSREMVACDAFPLLESLILHNLINMERVCIDR 637
           VL++LD++GF+QLK L VQN+P+I  I+D      C+AFP+LESL L NL+++E++C  +
Sbjct: 760 VLYDLDSQGFTQLKHLDVQNDPEIQYIIDPNRRSPCNAFPILESLYLDNLMSLEKICCGK 819

Query: 638 LKVESFNQLKNIEAYNCDKLSNIFWLSTTKCLPRLERIAVVNCSKMKEIFAIG-EEVDNA 696
           L   SF++L+++    CD+L N+F  S  +CL +L+++ VV+C+ ++EI A G E+ DN 
Sbjct: 820 LTTGSFSKLRSLTVVKCDRLKNLFSFSMMRCLLQLQQMKVVDCANLEEIVACGSEDTDND 879

Query: 697 IEKIEFAQLRSLSLGNLPEVTSFCREVKTPSASPNRPVSQEESTTMYGSSEIT----LDT 752
            E ++  QL SL+L  LP   SFC + K    SP     Q++ TT  G  EI     L  
Sbjct: 880 YEAVKLTQLCSLTLKRLPMFKSFCSKKKV---SPISLRVQKQLTTDTGLKEIAPKGELGD 936

Query: 753 STLLFNE 759
              LFNE
Sbjct: 937 PLPLFNE 943

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224125154|ref|XP_002319513.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857889|gb|EEE95436.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147777048|emb|CAN65562.1| hypothetical protein VITISV_009359 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query760
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.767 0.634 0.263 4.1e-57
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.773 0.596 0.249 1.5e-56
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.419 0.418 0.271 3.7e-38
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.45 0.380 0.270 4e-37
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.430 0.369 0.289 8e-36
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.461 0.392 0.269 1.1e-35
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.431 0.368 0.274 1.4e-33
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.444 0.381 0.253 5.6e-33
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.709 0.592 0.239 7.5e-33
TAIR|locus:2008510967 AT1G61190 "AT1G61190" [Arabido 0.422 0.331 0.265 1.7e-32
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 470 (170.5 bits), Expect = 4.1e-57, Sum P(2) = 4.1e-57
 Identities = 166/629 (26%), Positives = 288/629 (45%)

Query:   111 KEAWRLFKMMVGDDVENRELKSTAIDVARACGGLPIALTTVAMALRSK-SLHGWKVSLGE 169
             KEAW LF   VG+   +  +K  A DV+  C GLP+A+ T+   LR K  +  WK +L  
Sbjct:   275 KEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHTLNL 334

Query:   170 LR--TPSMDNFEGVSAETYSSIELSFNHLKDEQLKKIFLLCSQM--ETRILTLDLFKYSM 225
             L+   PS+D  E +    + +++LS++ L+D  +K  FL C+    +  I   +L  Y +
Sbjct:   335 LKRSAPSIDTEEKI----FGTLKLSYDFLQDN-MKSCFLFCALFPEDYSIKVSELIMYWV 389

Query:   226 GLGIFKRVNKMEDARDKLYALVHELRNSCLLIE-DSNEQFSMHDVVRDVAI-SIGCRDQ- 282
               G+    +  ED  ++   LV  L++SCLL + DS +   MHDVVRD AI  +  + + 
Sbjct:   390 AEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEG 449

Query:   283 -HGILVGNEDVWDWRNEDALRKCKAITLRYDSNRHFPEGLECPNLEFLCISLKDSSLEIN 341
              H +++    + ++  +  +   + ++L  +     P  +    +E L + L+ +S    
Sbjct:   450 FHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNV-IEGVETLVLLLQGNSHVKE 508

Query:   342 IPGNFFIGMKKLRVLDFTRMQFSSFPSSIDLLVNLHTLCLDQ-SALGDIAIIGKLKNLEV 400
             +P  F      LR+LD + ++  + P S   L +L +L L     L ++  +  L  L+ 
Sbjct:   509 VPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQF 568

Query:   401 LSFLMSDIMQLPEELGQLNKLRLLDLTNCFHLKVIAPNLISSLTRLEELYMGNCFIEWEV 460
             L    S I +LP  L  L+ LR + ++N + L+ I    I  L+ LE L M      W +
Sbjct:   569 LDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWGI 628

Query:   461 ERANSKRSNASLDELMHLPRLTTLEIDVKNDSILPEGF--LARKLERFKISIGNESFMPP 518
              +   +   A+LDE+  LP L  L I + +       F  L ++L +F+       F P 
Sbjct:   629 -KGEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFL-----FSPI 682

Query:   519 KCVRQDWFQSQPHFSINSDRKSLRALKLKLDFMDICSMKLQGINNVECLWLDKLQGIGDV 578
             + V      S P     +    L    + +    I    LQ + +++  + + L G+ + 
Sbjct:   683 RSV------SPP----GTGEGCLAISDVNVSNASI-GWLLQHVTSLDLNYCEGLNGMFEN 731

Query:   579 LFNLDTEGFSQLKLLWVQNNPDIFCIVDSREMVACDAFPLLESLILHNLINMERVC-IDR 637
             L       F  +K L +   P +         +  D FP LE L L N +N+E +  ++ 
Sbjct:   732 LVTKSKSSFVAMKALSIHYFPSLSLASGCESQL--DLFPNLEELSLDN-VNLESIGELNG 788

Query:   638 LKVESFNQLKNIEAYNCDKLSNIFW---LSTTKCLPRLERIAVVNCSKMKEIFAIGE-EV 693
                    +LK ++   C +L  +F    L+ T  LP L+ I VV+C +++E+F      V
Sbjct:   789 FLGMRLQKLKLLQVSGCRQLKRLFSDQILAGT--LPNLQEIKVVSCLRLEELFNFSSVPV 846

Query:   694 DNAIEKIEFAQLRSLSLGNLPEVTSFCRE 722
             D   E +   +L  + L  LP++ S C +
Sbjct:   847 DFCAESL-LPKLTVIKLKYLPQLRSLCND 874
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query760
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 9e-33
pfam13401124 pfam13401, AAA_22, AAA domain 9e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
smart00382148 smart00382, AAA, ATPases associated with a variety 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
pfam05729165 pfam05729, NACHT, NACHT domain 0.002
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  127 bits (322), Expect = 9e-33
 Identities = 70/237 (29%), Positives = 113/237 (47%), Gaps = 34/237 (14%)

Query: 1   MGGIGKTTLVKKVARQAMEDKLFDMVVFSEVSQIPDIKRIQQEIAEKLGLE---LREEVE 57
           MGG+GKTTL K++         FD V +  VS+     R+Q++I ++LGL+     E+ E
Sbjct: 27  MGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKTYTEFRLQKDILQELGLDDSDWVEKNE 86

Query: 58  SSRASRIFERLRNEKKILVVLDNIWKHLDLETVGIPFGEDHKGCKLLLTARDR------- 110
           S  A +I E L   K+ L+VLD++W+  D + +G+PF +   G ++++T R         
Sbjct: 87  SELAVKIKEALL-RKRFLLVLDDVWEKNDWDKIGVPFPDGENGSRVIVTTRSESVAGRMG 145

Query: 111 -------------KEAWRLFKMMVG--DDVENRELKSTAIDVARACGGLPIALTTVAMAL 155
                        +E+W LF   V   +     EL+  A ++   C GLP+AL  +   L
Sbjct: 146 GTSKPHEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLL 205

Query: 156 RSKS-LHGWKVSLGELRT--PSMDNFEGVSAETYSSIELSFNHLKDEQLKKIFLLCS 209
             KS +  W+  L +L       D    V     S + LS+++L    LK+ FL  +
Sbjct: 206 AFKSTVQEWEHVLEQLNNELAGRDGLNEV----LSILSLSYDNLPMH-LKRCFLYLA 257

Length = 285
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|218719 pfam05729, NACHT, NACHT domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 760
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.88
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.82
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.79
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.77
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.74
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.65
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.63
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.6
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.54
KOG0617264 consensus Ras suppressor protein (contains leucine 99.53
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.45
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.44
KOG0617264 consensus Ras suppressor protein (contains leucine 99.4
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.31
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.31
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.27
PRK04841903 transcriptional regulator MalT; Provisional 99.16
KOG4237498 consensus Extracellular matrix protein slit, conta 98.98
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 98.97
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.96
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.92
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.82
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.82
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.75
KOG4341483 consensus F-box protein containing LRR [General fu 98.74
KOG4237498 consensus Extracellular matrix protein slit, conta 98.73
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.71
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.69
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.54
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.53
KOG4341483 consensus F-box protein containing LRR [General fu 98.49
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.48
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.48
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.48
COG3903414 Predicted ATPase [General function prediction only 98.45
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.44
PF05729166 NACHT: NACHT domain 98.42
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.33
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.19
cd01128249 rho_factor Transcription termination factor rho is 98.18
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.18
PLN03150623 hypothetical protein; Provisional 98.18
PLN03150623 hypothetical protein; Provisional 98.14
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.13
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.13
PRK09376416 rho transcription termination factor Rho; Provisio 98.1
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.09
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.95
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.89
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.88
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.87
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.82
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.8
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.71
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.71
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.69
PF13173128 AAA_14: AAA domain 97.69
TIGR00767415 rho transcription termination factor Rho. Members 97.65
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.65
PRK15386 426 type III secretion protein GogB; Provisional 97.63
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 97.62
PRK06893229 DNA replication initiation factor; Validated 97.59
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.56
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.55
PRK15386426 type III secretion protein GogB; Provisional 97.54
PTZ001121164 origin recognition complex 1 protein; Provisional 97.53
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.46
PRK13342413 recombination factor protein RarA; Reviewed 97.43
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.35
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 97.29
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.28
COG2256436 MGS1 ATPase related to the helicase subunit of the 97.26
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.25
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.22
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.2
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 97.18
KOG2028554 consensus ATPase related to the helicase subunit o 97.08
PRK05564313 DNA polymerase III subunit delta'; Validated 97.04
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 96.95
PRK08727233 hypothetical protein; Validated 96.94
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.93
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.89
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.84
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 96.82
PRK14087450 dnaA chromosomal replication initiation protein; P 96.82
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 96.81
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 96.8
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 96.79
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 96.77
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 96.74
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.73
COG3899849 Predicted ATPase [General function prediction only 96.72
PRK04195482 replication factor C large subunit; Provisional 96.71
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.67
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.67
PF00004132 AAA: ATPase family associated with various cellula 96.6
PRK08116268 hypothetical protein; Validated 96.59
PRK11331459 5-methylcytosine-specific restriction enzyme subun 96.58
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 96.57
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 96.56
PRK12608380 transcription termination factor Rho; Provisional 96.56
smart00382148 AAA ATPases associated with a variety of cellular 96.47
PF14516331 AAA_35: AAA-like domain 96.46
PLN03025319 replication factor C subunit; Provisional 96.46
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 96.45
PRK08084235 DNA replication initiation factor; Provisional 96.4
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 96.37
PRK12402337 replication factor C small subunit 2; Reviewed 96.36
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.36
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.35
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 96.34
PRK14088440 dnaA chromosomal replication initiation protein; P 96.3
PRK14086617 dnaA chromosomal replication initiation protein; P 96.27
TIGR00362405 DnaA chromosomal replication initiator protein Dna 96.25
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.22
PRK05642234 DNA replication initiation factor; Validated 96.19
KOG2543438 consensus Origin recognition complex, subunit 5 [R 96.16
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 96.14
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 96.11
PRK07940394 DNA polymerase III subunit delta'; Validated 96.11
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 96.1
PRK06921266 hypothetical protein; Provisional 96.09
PHA02544316 44 clamp loader, small subunit; Provisional 96.08
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.0
PRK00149450 dnaA chromosomal replication initiation protein; R 95.98
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 95.97
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 95.95
PRK09087226 hypothetical protein; Validated 95.89
COG0593408 DnaA ATPase involved in DNA replication initiation 95.85
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 95.83
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 95.77
PRK08118167 topology modulation protein; Reviewed 95.74
PRK09112351 DNA polymerase III subunit delta'; Validated 95.73
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 95.7
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 95.7
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.7
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 95.69
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 95.68
PRK08181269 transposase; Validated 95.62
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.6
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 95.59
PRK10536262 hypothetical protein; Provisional 95.59
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 95.59
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 95.57
PRK05707328 DNA polymerase III subunit delta'; Validated 95.57
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.57
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.53
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 95.53
CHL00181287 cbbX CbbX; Provisional 95.53
PRK00440319 rfc replication factor C small subunit; Reviewed 95.5
TIGR02237209 recomb_radB DNA repair and recombination protein R 95.49
PRK07471365 DNA polymerase III subunit delta'; Validated 95.46
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 95.46
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 95.43
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 95.41
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 95.39
PRK13341725 recombination factor protein RarA/unknown domain f 95.38
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 95.3
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 95.25
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 95.21
PRK03992389 proteasome-activating nucleotidase; Provisional 95.19
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.18
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 95.06
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 95.02
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 95.0
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 94.96
PRK06526254 transposase; Provisional 94.94
PRK08903227 DnaA regulatory inactivator Hda; Validated 94.92
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 94.88
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.87
PRK08939306 primosomal protein DnaI; Reviewed 94.82
PRK04132846 replication factor C small subunit; Provisional 94.81
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 94.68
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 94.68
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 94.67
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 94.62
PTZ00202550 tuzin; Provisional 94.6
PRK07952244 DNA replication protein DnaC; Validated 94.6
TIGR02012321 tigrfam_recA protein RecA. This model describes or 94.53
PRK12377248 putative replication protein; Provisional 94.49
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 94.45
PRK06835329 DNA replication protein DnaC; Validated 94.43
PRK12422445 chromosomal replication initiation protein; Provis 94.43
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 94.39
cd00983325 recA RecA is a bacterial enzyme which has roles in 94.38
PRK09354349 recA recombinase A; Provisional 94.38
COG1484254 DnaC DNA replication protein [DNA replication, rec 94.33
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 94.3
PRK09361225 radB DNA repair and recombination protein RadB; Pr 94.26
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 94.17
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 94.12
PRK09183259 transposase/IS protein; Provisional 94.11
PRK07261171 topology modulation protein; Provisional 94.09
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.97
PHA00729226 NTP-binding motif containing protein 93.92
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 93.9
CHL00195489 ycf46 Ycf46; Provisional 93.82
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 93.8
PRK06620214 hypothetical protein; Validated 93.79
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.74
cd01393226 recA_like RecA is a bacterial enzyme which has rol 93.73
PRK08769319 DNA polymerase III subunit delta'; Validated 93.7
PF00154322 RecA: recA bacterial DNA recombination protein; In 93.68
CHL00176638 ftsH cell division protein; Validated 93.62
cd01394218 radB RadB. The archaeal protein radB shares simila 93.59
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 93.52
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 93.51
COG0470325 HolB ATPase involved in DNA replication [DNA repli 93.46
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 93.41
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 93.22
PLN03186342 DNA repair protein RAD51 homolog; Provisional 93.22
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 93.21
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 93.16
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 93.16
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 93.01
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 92.97
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 92.95
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 92.93
PRK06871325 DNA polymerase III subunit delta'; Validated 92.93
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 92.89
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 92.83
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 92.79
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 92.77
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 92.68
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 92.67
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 92.66
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 92.62
CHL00095821 clpC Clp protease ATP binding subunit 92.61
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 92.55
PRK05541176 adenylylsulfate kinase; Provisional 92.54
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.54
PRK04296190 thymidine kinase; Provisional 92.42
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 92.42
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 92.4
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 92.38
PRK04301317 radA DNA repair and recombination protein RadA; Va 92.18
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 92.11
PRK06090319 DNA polymerase III subunit delta'; Validated 91.97
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.93
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 91.89
COG4088261 Predicted nucleotide kinase [Nucleotide transport 91.86
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 91.84
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 91.8
PRK13849231 putative crown gall tumor protein VirC1; Provision 91.73
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 91.69
PRK09280463 F0F1 ATP synthase subunit beta; Validated 91.67
PRK08533230 flagellar accessory protein FlaH; Reviewed 91.62
COG1618179 Predicted nucleotide kinase [Nucleotide transport 91.59
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 91.59
TIGR02236310 recomb_radA DNA repair and recombination protein R 91.54
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 91.54
PRK07399314 DNA polymerase III subunit delta'; Validated 91.5
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 91.44
PRK04328249 hypothetical protein; Provisional 91.38
PTZ00035337 Rad51 protein; Provisional 91.36
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 91.31
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 91.3
PRK10865857 protein disaggregation chaperone; Provisional 91.25
KOG1514767 consensus Origin recognition complex, subunit 1, a 91.17
KOG1969877 consensus DNA replication checkpoint protein CHL12 91.13
TIGR01040466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 91.11
TIGR01041458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 91.02
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 90.84
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 90.81
cd03115173 SRP The signal recognition particle (SRP) mediates 90.8
cd01124187 KaiC KaiC is a circadian clock protein primarily f 90.61
PTZ00185574 ATPase alpha subunit; Provisional 90.6
PRK06067234 flagellar accessory protein FlaH; Validated 90.53
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 90.5
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.31
TIGR01039461 atpD ATP synthase, F1 beta subunit. The sequences 90.05
PRK07993334 DNA polymerase III subunit delta'; Validated 89.96
PRK09519790 recA DNA recombination protein RecA; Reviewed 89.9
PRK04196460 V-type ATP synthase subunit B; Provisional 89.81
PRK08058329 DNA polymerase III subunit delta'; Validated 89.69
KOG0736953 consensus Peroxisome assembly factor 2 containing 89.63
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 89.51
COG1192259 Soj ATPases involved in chromosome partitioning [C 89.49
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 89.49
CHL00095821 clpC Clp protease ATP binding subunit 89.45
PRK08927442 fliI flagellum-specific ATP synthase; Validated 89.45
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 89.42
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 89.37
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 89.29
TIGR03324497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a 89.23
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 89.18
PRK11823446 DNA repair protein RadA; Provisional 89.15
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 89.09
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 89.01
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 89.0
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 88.91
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 88.87
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 88.8
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 88.8
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 88.74
CHL00060494 atpB ATP synthase CF1 beta subunit 88.63
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 88.57
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 88.53
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.35
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 88.31
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 88.3
TIGR00959428 ffh signal recognition particle protein. This mode 88.26
PHA02518211 ParA-like protein; Provisional 88.24
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 88.22
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 88.11
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 88.06
PRK08972444 fliI flagellum-specific ATP synthase; Validated 88.05
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 87.93
PRK08149428 ATP synthase SpaL; Validated 87.92
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 87.92
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 87.84
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 87.8
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 87.79
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 87.77
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 87.7
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 87.68
PRK07276290 DNA polymerase III subunit delta'; Validated 87.56
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subun 87.51
PRK10867433 signal recognition particle protein; Provisional 87.4
PRK12678672 transcription termination factor Rho; Provisional 87.35
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 87.07
PF07726131 AAA_3: ATPase family associated with various cellu 87.04
COG2255332 RuvB Holliday junction resolvasome, helicase subun 87.03
PHA02244383 ATPase-like protein 86.93
PRK06936439 type III secretion system ATPase; Provisional 86.82
PRK06964342 DNA polymerase III subunit delta'; Validated 86.71
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 86.7
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 86.68
COG1157441 FliI Flagellar biosynthesis/type III secretory pat 86.67
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 86.53
PRK06002450 fliI flagellum-specific ATP synthase; Validated 86.52
TIGR00064272 ftsY signal recognition particle-docking protein F 86.49
COG0003322 ArsA Predicted ATPase involved in chromosome parti 86.42
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 86.38
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 86.27
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 86.21
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 86.17
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 86.1
PRK00771437 signal recognition particle protein Srp54; Provisi 86.05
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 86.03
PRK08233182 hypothetical protein; Provisional 86.0
TIGR00962501 atpA proton translocating ATP synthase, F1 alpha s 85.84
PRK14974336 cell division protein FtsY; Provisional 85.83
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 85.82
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 85.74
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 85.72
cd02040270 NifH NifH gene encodes component II (iron protein) 85.71
PRK06217183 hypothetical protein; Validated 85.66
PRK03839180 putative kinase; Provisional 85.64
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 85.62
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 85.59
smart0037026 LRR Leucine-rich repeats, outliers. 85.57
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.57
PRK00625173 shikimate kinase; Provisional 85.44
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 85.4
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 85.38
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 85.22
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 85.2
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 85.15
PRK10865857 protein disaggregation chaperone; Provisional 85.13
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 85.06
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 85.0
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 84.97
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 84.83
KOG0079198 consensus GTP-binding protein H-ray, small G prote 84.79
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 84.5
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 84.46
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 84.42
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 84.39
PRK15429686 formate hydrogenlyase transcriptional activator Fh 84.33
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 84.31
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 84.3
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 84.24
PTZ00088229 adenylate kinase 1; Provisional 84.22
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 83.89
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 83.6
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 83.56
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 83.48
PRK05922434 type III secretion system ATPase; Validated 83.45
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 83.44
PRK10037250 cell division protein; Provisional 83.36
TIGR01287275 nifH nitrogenase iron protein. This model describe 83.35
CHL00059485 atpA ATP synthase CF1 alpha subunit 83.33
PRK08472434 fliI flagellum-specific ATP synthase; Validated 83.25
KOG0731774 consensus AAA+-type ATPase containing the peptidas 83.21
PRK13768253 GTPase; Provisional 83.2
PRK05688451 fliI flagellum-specific ATP synthase; Validated 83.09
cd02036179 MinD Bacterial cell division requires the formatio 83.04
PRK09099441 type III secretion system ATPase; Provisional 82.92
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 82.77
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 82.67
PRK06762166 hypothetical protein; Provisional 82.64
PRK09302509 circadian clock protein KaiC; Reviewed 82.59
PRK13949169 shikimate kinase; Provisional 82.54
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 82.31
PRK07594433 type III secretion system ATPase SsaN; Validated 82.27
TIGR01281268 DPOR_bchL light-independent protochlorophyllide re 82.23
PF08303168 tRNA_lig_kinase: tRNA ligase kinase domain; InterP 82.2
KOG2228408 consensus Origin recognition complex, subunit 4 [R 82.19
TIGR03496411 FliI_clade1 flagellar protein export ATPase FliI. 81.94
PRK07196434 fliI flagellum-specific ATP synthase; Validated 81.9
PF06564243 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p 81.5
PRK13886241 conjugal transfer protein TraL; Provisional 81.47
PRK13231264 nitrogenase reductase-like protein; Reviewed 81.46
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 81.46
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 81.34
PRK11608326 pspF phage shock protein operon transcriptional ac 81.34
PRK02118436 V-type ATP synthase subunit B; Provisional 81.21
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. 81.18
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 81.17
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 81.17
PRK13185270 chlL protochlorophyllide reductase iron-sulfur ATP 80.96
PRK09302509 circadian clock protein KaiC; Reviewed 80.88
PRK08699325 DNA polymerase III subunit delta'; Validated 80.85
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 80.82
cd02032267 Bchl_like This family of proteins contains bchL an 80.82
PRK13343502 F0F1 ATP synthase subunit alpha; Provisional 80.64
PRK13230279 nitrogenase reductase-like protein; Reviewed 80.62
PRK13233275 nifH nitrogenase reductase; Reviewed 80.62
PRK05973237 replicative DNA helicase; Provisional 80.6
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 80.43
PRK09281502 F0F1 ATP synthase subunit alpha; Validated 80.42
PRK07132299 DNA polymerase III subunit delta'; Validated 80.4
PRK00131175 aroK shikimate kinase; Reviewed 80.16
PRK13947171 shikimate kinase; Provisional 80.13
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 80.12
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 80.1
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-73  Score=645.42  Aligned_cols=616  Identities=27%  Similarity=0.426  Sum_probs=438.6

Q ss_pred             CCCCcHHHHHHHHHHHHh-hhcCCCeEEEEEecCCCCHHHHHHHHHHHhCccccchh---hHHHHHHHHHHHHcCCcEEE
Q 048566            1 MGGIGKTTLVKKVARQAM-EDKLFDMVVFSEVSQIPDIKRIQQEIAEKLGLELREEV---ESSRASRIFERLRNEKKILV   76 (760)
Q Consensus         1 mgGiGKTtLA~~~~~~~~-~~~~F~~~~wv~~~~~~~~~~~~~~i~~~l~~~~~~~~---~~~~~~~~~~~l~~~~r~Ll   76 (760)
                      |||+||||||+.++|+.. ++++||.++||.||+.++...++++|++.++.....+.   ..+.+..+.+.|. +|||+|
T Consensus       187 MGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~-~krfll  265 (889)
T KOG4658|consen  187 MGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDEEWEDKEEDELASKLLNLLE-GKRFLL  265 (889)
T ss_pred             CCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhc-cCceEE
Confidence            999999999999999988 99999999999999999999999999999987544332   2466777888887 599999


Q ss_pred             EEECCCCccccccccccccCCCCCcEEEEeeCCH--------------------HHHHHHHHHHhCCC--cCChhhHHHH
Q 048566           77 VLDNIWKHLDLETVGIPFGEDHKGCKLLLTARDR--------------------KEAWRLFKMMVGDD--VENRELKSTA  134 (760)
Q Consensus        77 VlDdv~~~~~~~~l~~~~~~~~~gs~IlvTTR~~--------------------~~a~~Lf~~~a~~~--~~~~~~~~~~  134 (760)
                      ||||||+..+|+.+..++|...+||||++|||++                    +|||+||++.|+..  ...+.++++|
T Consensus       266 vLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~la  345 (889)
T KOG4658|consen  266 VLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELA  345 (889)
T ss_pred             EEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhccccccccccHHHHH
Confidence            9999999999999999999999999999999999                    99999999999553  2334589999


Q ss_pred             HHHHHHhCCcchHHHHHHHHHccC-ChHHHHHHHHHhcCCCCCCcCCchhHHHHHHHHhhhcCChhhHhHHHhhhccCcc
Q 048566          135 IDVARACGGLPIALTTVAMALRSK-SLHGWKVSLGELRTPSMDNFEGVSAETYSSIELSFNHLKDEQLKKIFLLCSQMET  213 (760)
Q Consensus       135 ~~i~~~c~glPLai~~~~~~l~~~-~~~~w~~~l~~l~~~~~~~~~~~~~~~~~~l~~sy~~L~~~~lk~cfl~~a~fp~  213 (760)
                      ++|+++|+|+|||++++|+.|+.+ +..+|+.+++.+.+....+.+++...++.++++|||.||++ +|.||+|||+||+
T Consensus       346 k~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~-lK~CFLycalFPE  424 (889)
T KOG4658|consen  346 KEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEE-LKSCFLYCALFPE  424 (889)
T ss_pred             HHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHH-HHHHHHhhccCCc
Confidence            999999999999999999999999 78899999999988766666777889999999999999965 9999999999999


Q ss_pred             cccHH--HHHHHHHhcCccccccchHHHHHHHHHHHHHHHhcccccccC----CCceeccHHHHHHHHHHhh-----ccc
Q 048566          214 RILTL--DLFKYSMGLGIFKRVNKMEDARDKLYALVHELRNSCLLIEDS----NEQFSMHDVVRDVAISIGC-----RDQ  282 (760)
Q Consensus       214 ~~~~~--~li~~w~a~g~i~~~~~~~~~~~~~~~~l~~L~~~sll~~~~----~~~~~mH~lv~~~~~~~~~-----~e~  282 (760)
                      |+.++  .++.+|+||||+.+....+.+++.+++++.+|++++|++...    ..+|+|||+||++|.++++     ++.
T Consensus       425 D~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~  504 (889)
T KOG4658|consen  425 DYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEEN  504 (889)
T ss_pred             ccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccc
Confidence            99987  999999999999987777789999999999999999999863    3689999999999999998     666


Q ss_pred             ccEEecCCccccccchhccccceEEEeecCCCCCCCCCCCCCCccEEEeeccCCcccccCCchhhcCCCCceEEEecCC-
Q 048566          283 HGILVGNEDVWDWRNEDALRKCKAITLRYDSNRHFPEGLECPNLEFLCISLKDSSLEINIPGNFFIGMKKLRVLDFTRM-  361 (760)
Q Consensus       283 ~~~~~~~~~~~~~~~~~~~~~~r~l~l~~~~~~~~~~~~~~~~Lr~L~l~~~~~~~~~~~~~~~~~~l~~Lr~L~l~~~-  361 (760)
                      .++ ..+.+....++...+...|++++.++....++...++++|++|.+..+...+ ..++..+|..++.||+|||++| 
T Consensus       505 ~iv-~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l-~~is~~ff~~m~~LrVLDLs~~~  582 (889)
T KOG4658|consen  505 QIV-SDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWL-LEISGEFFRSLPLLRVLDLSGNS  582 (889)
T ss_pred             eEE-ECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceEEEeecchhh-hhcCHHHHhhCcceEEEECCCCC
Confidence            333 2333444455556678899999998877889999999999999999543212 2478888999999999999975 


Q ss_pred             CCCCChhhhhhhccCCeeEecCCCCCC-ccccccccccceeecccCc-ccccchhhhcCCCCCEEeccccccccccCccc
Q 048566          362 QFSSFPSSIDLLVNLHTLCLDQSALGD-IAIIGKLKNLEVLSFLMSD-IMQLPEELGQLNKLRLLDLTNCFHLKVIAPNL  439 (760)
Q Consensus       362 ~~~~lp~~i~~l~~L~~L~l~~~~l~~-~~~~~~l~~L~~L~l~~~~-i~~lp~~~~~l~~L~~L~l~~~~~l~~~~~~~  439 (760)
                      .+.++|.+|++|.+||||+++++.+.. |.++++|+.|.+|++..+. +..+|.....|++|++|.+..           
T Consensus       583 ~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~-----------  651 (889)
T KOG4658|consen  583 SLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPR-----------  651 (889)
T ss_pred             ccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheeccccccccccccchhhhcccccEEEeec-----------
Confidence            456888888887777777777776655 5566666666666666553 223333333355555555433           


Q ss_pred             ccCCCCCCEEEccccccchhhhhccccccCCChhhhcCCCCCCEEEEEeccCCCCCcchhccccceeEEEecCCCCCCCc
Q 048566          440 ISSLTRLEELYMGNCFIEWEVERANSKRSNASLDELMHLPRLTTLEIDVKNDSILPEGFLARKLERFKISIGNESFMPPK  519 (760)
Q Consensus       440 i~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~l~~~  519 (760)
                                    ...         ..+.....++.++++|+.+.+................|.++..           
T Consensus       652 --------------s~~---------~~~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~~~~~L~~~~~-----------  697 (889)
T KOG4658|consen  652 --------------SAL---------SNDKLLLKELENLEHLENLSITISSVLLLEDLLGMTRLRSLLQ-----------  697 (889)
T ss_pred             --------------ccc---------ccchhhHHhhhcccchhhheeecchhHhHhhhhhhHHHHHHhH-----------
Confidence                          210         0122334555556666655554322200000011111111100           


Q ss_pred             cccccccCCCCcccccccccccceeeeccCccccccccccCccceeEEEeccccCccccccccCccccCCCcEEeeccCC
Q 048566          520 CVRQDWFQSQPHFSINSDRKSLRALKLKLDFMDICSMKLQGINNVECLWLDKLQGIGDVLFNLDTEGFSQLKLLWVQNNP  599 (760)
Q Consensus       520 ~~~~~~~~~~~~~~~~~~~~~l~~l~l~~~~~~l~~l~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~  599 (760)
                                                                    .+.+..   +...........+.+|+.|.|.+|.
T Consensus       698 ----------------------------------------------~l~~~~---~~~~~~~~~~~~l~~L~~L~i~~~~  728 (889)
T KOG4658|consen  698 ----------------------------------------------SLSIEG---CSKRTLISSLGSLGNLEELSILDCG  728 (889)
T ss_pred             ----------------------------------------------hhhhcc---cccceeecccccccCcceEEEEcCC
Confidence                                                          000000   1111111223457777777777776


Q ss_pred             CceeeecCCCCcccc-cccccchhhhcccccccccccccccccccCCccEEEEecCCCCCcccchhhhhccCCCcEEEEe
Q 048566          600 DIFCIVDSREMVACD-AFPLLESLILHNLINMERVCIDRLKVESFNQLKNIEAYNCDKLSNIFWLSTTKCLPRLERIAVV  678 (760)
Q Consensus       600 ~l~~i~~~~~~~~~~-~~p~L~~L~l~~~~~l~~~~~~~~~~~~~~~L~~L~l~~C~~L~~l~~~~~~~~l~~L~~L~l~  678 (760)
                      ..+............ .||++..+.+.+|..++...+    ....|+|+.|.+..|+.++++.+  ....+..++++.+.
T Consensus       729 ~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~----~~f~~~L~~l~l~~~~~~e~~i~--~~k~~~~l~~~i~~  802 (889)
T KOG4658|consen  729 ISEIVIEWEESLIVLLCFPNLSKVSILNCHMLRDLTW----LLFAPHLTSLSLVSCRLLEDIIP--KLKALLELKELILP  802 (889)
T ss_pred             CchhhcccccccchhhhHHHHHHHHhhccccccccch----hhccCcccEEEEecccccccCCC--HHHHhhhcccEEec
Confidence            543222111111122 277888888888887777654    23468889999988888887655  33444444432221


Q ss_pred             cCCcchhhh---ccccccccccccccccccCeeecCCCcccccccc
Q 048566          679 NCSKMKEIF---AIGEEVDNAIEKIEFAQLRSLSLGNLPEVTSFCR  721 (760)
Q Consensus       679 ~c~~L~~l~---~~~~~~~~~~~~~~l~~L~~L~l~~c~~L~~~~~  721 (760)
                       ++++....   ...+..+....-..++.|..+.+..||++.++|.
T Consensus       803 -f~~~~~l~~~~~l~~l~~i~~~~l~~~~l~~~~ve~~p~l~~~P~  847 (889)
T KOG4658|consen  803 -FNKLEGLRMLCSLGGLPQLYWLPLSFLKLEELIVEECPKLGKLPL  847 (889)
T ss_pred             -ccccccceeeecCCCCceeEecccCccchhheehhcCcccccCcc
Confidence             11222221   0011111111223345577788888888877643

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PRK04196 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK10037 cell division protein; Provisional Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK02118 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query760
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-35
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-12
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 1e-34
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 3e-25
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-10
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score =  143 bits (361), Expect = 3e-35
 Identities = 80/489 (16%), Positives = 159/489 (32%), Gaps = 131/489 (26%)

Query: 1   MGGIGKTTLVKKVARQAMEDKLFDMVVF----SEVSQIPDIKRIQQEIAEKL-------- 48
           + G GKT +   V          D  +F       +    +  + Q++  ++        
Sbjct: 158 VLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRS 217

Query: 49  ----GLELREEVESSRASRIFERLRNEKKILVVLDNIW--KHLDLETVGIPFGEDHKGCK 102
                ++LR     +   R+  + +  +  L+VL N+   K  +       F  +   CK
Sbjct: 218 DHSSNIKLRIHSIQAELRRLL-KSKPYENCLLVLLNVQNAKAWN------AF--NL-SCK 267

Query: 103 LLLTARDRKEAWRL----FKMMVGDDV-------ENRELKSTAIDV------ARACGGLP 145
           +LLT R ++    L       +  D         E + L    +D              P
Sbjct: 268 ILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNP 327

Query: 146 IALTTVAMALRSKSLHGWKVSLGELRTPSMDNFEGVSAETYSS-IELSFNHLKDEQLKKI 204
             L+ +A ++R      W            DN++ V+ +  ++ IE S N L+  + +K+
Sbjct: 328 RRLSIIAESIRDGLAT-W------------DNWKHVNCDKLTTIIESSLNVLEPAEYRKM 374

Query: 205 FLLCSQMETRILTLDLFKYSMGLGIFKRVNKMEDARDKLYALVHELRNSCLLIEDSNE-Q 263
           F   S     +        ++ L +        D       +V++L    L+ +   E  
Sbjct: 375 FDRLS-----VFPPSAHIPTILLSLIWFDVIKSDVMV----VVNKLHKYSLVEKQPKEST 425

Query: 264 FSMHDVVRDVAISIGCRDQHGILVGNEDVWDWRNEDALRKCKAITLRYDSNRHF-PEGLE 322
            S+  +  ++ + +                   NE AL +   +   Y+  + F  + L 
Sbjct: 426 ISIPSIYLELKVKL------------------ENEYALHR-SIVD-HYNIPKTFDSDDLI 465

Query: 323 CPNLE--FLCISLKDSSLEINIPGNFFIG--MKKLRVLDFTRMQFSSFPSSIDLLVNLH- 377
            P L+  F                   IG  +K +   +    + + F     + ++   
Sbjct: 466 PPYLDQYFY----------------SHIGHHLKNIEHPE----RMTLFR---MVFLDFRF 502

Query: 378 ---TLCLDQSALGDIA-IIGKLKNLEVLSFLMSDIMQLPEELGQLNKLRLLDLTNCFHLK 433
               +  D +A      I+  L+ L+     + D     E L       +  + + F L 
Sbjct: 503 LEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERL-------VNAILD-F-LP 553

Query: 434 VIAPNLISS 442
            I  NLI S
Sbjct: 554 KIEENLICS 562
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query760
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.97
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.92
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.92
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.9
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.9
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.9
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.9
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.9
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.89
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.89
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.89
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.88
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.88
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.88
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.88
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.88
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.87
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.87
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.87
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.87
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.87
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.86
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.85
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.85
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.85
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.85
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.83
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.82
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.81
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.81
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.79
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.79
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.78
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.77
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.76
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.76
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.76
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.73
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.72
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.72
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.71
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.71
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.71
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.7
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.7
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.7
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.7
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.69
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.69
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.68
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.68
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.67
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.66
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.64
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.64
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.63
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.63
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.63
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.63
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.62
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.62
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.6
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.6
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.6
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.59
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.59
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.58
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.58
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.58
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.58
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.58
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.57
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.56
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.55
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.55
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.54
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.51
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.5
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.5
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.5
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.49
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.48
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.46
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.45
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.44
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.43
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.43
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.43
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.42
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.4
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.39
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.36
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.35
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.35
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.35
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.33
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.33
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.32
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.32
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.31
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.31
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.3
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.3
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.29
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.27
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.26
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.25
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.23
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.22
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.21
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.19
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.18
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.14
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.12
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.03
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.02
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.99
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.96
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.95
2fna_A357 Conserved hypothetical protein; structural genomic 98.84
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.81
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.78
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 98.68
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.63
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.61
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.55
2v1u_A387 Cell division control protein 6 homolog; DNA repli 98.52
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.51
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 98.44
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.38
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.38
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 98.36
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.36
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.33
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.24
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.21
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.17
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.15
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.1
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.08
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.88
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.88
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 97.84
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.83
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.67
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 97.66
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.61
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.53
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.53
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.35
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.35
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.35
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 97.0
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 96.76
2chq_A319 Replication factor C small subunit; DNA-binding pr 96.67
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.67
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 96.62
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.61
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.5
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.49
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.38
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.34
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.3
3bos_A242 Putative DNA replication factor; P-loop containing 96.27
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 96.25
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 96.2
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.15
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.99
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 95.97
3pvs_A447 Replication-associated recombination protein A; ma 95.94
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 95.69
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 95.66
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 95.59
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.41
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 95.35
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 95.33
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 95.21
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.18
3io5_A333 Recombination and repair protein; storage dimer, i 95.06
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 95.03
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 94.94
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 94.76
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 94.66
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 94.63
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 94.57
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.49
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 94.45
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.44
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 94.27
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 94.21
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 94.18
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 94.08
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 94.03
2z43_A324 DNA repair and recombination protein RADA; archaea 94.02
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 93.94
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 93.9
2qgz_A308 Helicase loader, putative primosome component; str 93.9
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.85
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 93.8
1xp8_A366 RECA protein, recombinase A; recombination, radior 93.38
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 93.02
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 93.01
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.98
1u94_A356 RECA protein, recombinase A; homologous recombinat 92.96
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 92.75
2gno_A305 DNA polymerase III, gamma subunit-related protein; 92.47
2cvh_A220 DNA repair and recombination protein RADB; filamen 92.41
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 92.4
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 92.27
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 92.27
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 92.19
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 91.89
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 91.39
3co5_A143 Putative two-component system transcriptional RES 91.3
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 91.16
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 90.44
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 90.41
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 90.38
3ice_A422 Transcription termination factor RHO; transcriptio 90.36
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 90.35
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 90.12
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 89.94
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 89.74
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 89.4
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 89.34
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 88.37
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 88.24
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 88.09
3cwq_A209 Para family chromosome partitioning protein; alpha 87.84
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 87.73
4a74_A231 DNA repair and recombination protein RADA; hydrola 87.73
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 87.67
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 87.24
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 86.68
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 86.39
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 85.87
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 85.68
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 85.49
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 85.43
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 85.42
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 85.13
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 84.81
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 84.69
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 84.47
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 84.28
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 84.26
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 83.89
1ojl_A304 Transcriptional regulatory protein ZRAR; response 83.82
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 83.73
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 83.55
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 83.16
3l0o_A427 Transcription termination factor RHO; helicase, RH 83.08
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 82.82
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 82.74
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 82.56
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 82.4
2xxa_A433 Signal recognition particle protein; protein trans 82.32
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 82.29
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 81.32
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 81.13
2ck3_A510 ATP synthase subunit alpha\, mitochondrial; hydrol 81.1
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 80.96
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 80.86
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 80.69
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 80.65
2qe7_A502 ATP synthase subunit alpha; blockage of ATP hydrol 80.62
1vma_A306 Cell division protein FTSY; TM0570, structural gen 80.58
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 80.43
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 80.13
3oaa_A513 ATP synthase subunit alpha; rossmann fold, hydrola 80.13
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 80.05
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=100.00  E-value=1.8e-41  Score=378.88  Aligned_cols=264  Identities=13%  Similarity=0.101  Sum_probs=200.6

Q ss_pred             CCCCcHHHHHHHHHH--HHhhhcCCCeEEEEEecCCC--CHHHHHHHHHHHhCcccc--------chhhHHHHHHHHHHH
Q 048566            1 MGGIGKTTLVKKVAR--QAMEDKLFDMVVFSEVSQIP--DIKRIQQEIAEKLGLELR--------EEVESSRASRIFERL   68 (760)
Q Consensus         1 mgGiGKTtLA~~~~~--~~~~~~~F~~~~wv~~~~~~--~~~~~~~~i~~~l~~~~~--------~~~~~~~~~~~~~~l   68 (760)
                      ||||||||||+++|+  +.+++.+|++++||++++.+  +...+++.|+++++....        ..+.......+.+.+
T Consensus       160 ~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~vs~~~~~~~~~~~~~il~~l~~~~~~~~~~~~~~~~~~~l~~~l~~~L  239 (549)
T 2a5y_B          160 RAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNAL  239 (549)
T ss_dssp             STTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHhhhHHHhccCCcEEEEEECCCCCCCHHHHHHHHHHHHhcCcccccccccccccHHHHHHHHHHHH
Confidence            899999999999999  56778899999999999885  889999999999986521        112233467788888


Q ss_pred             HcCCcEEEEEECCCCccccccccccccCCCCCcEEEEeeCCH--------------------HHHHHHHHHHhCCCcCCh
Q 048566           69 RNEKKILVVLDNIWKHLDLETVGIPFGEDHKGCKLLLTARDR--------------------KEAWRLFKMMVGDDVENR  128 (760)
Q Consensus        69 ~~~~r~LlVlDdv~~~~~~~~l~~~~~~~~~gs~IlvTTR~~--------------------~~a~~Lf~~~a~~~~~~~  128 (760)
                      ...|||||||||||+.+++ .    ++ ..+||+||||||++                    ++||+||.++|+....++
T Consensus       240 ~~~kr~LlVLDdv~~~~~~-~----~~-~~~gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~~~~  313 (549)
T 2a5y_B          240 IDRPNTLFVFDDVVQEETI-R----WA-QELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGE  313 (549)
T ss_dssp             TTSTTEEEEEEEECCHHHH-H----HH-HHTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC--C
T ss_pred             cCCCcEEEEEECCCCchhh-c----cc-ccCCCEEEEEcCCHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCCCch
Confidence            7423999999999998765 1    11 12799999999996                    899999999986544447


Q ss_pred             hhHHHHHHHHHHhCCcchHHHHHHHHHccCChHHHHHHHHH-hcCCCCCCcCCchhHHHHHHHHhhhcCChhhHhHHHh-
Q 048566          129 ELKSTAIDVARACGGLPIALTTVAMALRSKSLHGWKVSLGE-LRTPSMDNFEGVSAETYSSIELSFNHLKDEQLKKIFL-  206 (760)
Q Consensus       129 ~~~~~~~~i~~~c~glPLai~~~~~~l~~~~~~~w~~~l~~-l~~~~~~~~~~~~~~~~~~l~~sy~~L~~~~lk~cfl-  206 (760)
                      ++++++++|+++|+|+||||+++|+.++.+.. +|...+.. +....       ...+.+++.+||++||.+ +|.||+ 
T Consensus       314 ~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~~w-~~~~~l~~~l~~~~-------~~~i~~~l~~Sy~~L~~~-lk~~f~~  384 (549)
T 2a5y_B          314 KEEDVLNKTIELSSGNPATLMMFFKSCEPKTF-EKMAQLNNKLESRG-------LVGVECITPYSYKSLAMA-LQRCVEV  384 (549)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSH-HHHHHHHHHHHHHC-------SSTTCCCSSSSSSSHHHH-HHHHHHT
T ss_pred             hHHHHHHHHHHHhCCChHHHHHHHHHhccchH-HHHHHhHHHhhccc-------HHHHHHHHhcccccccHH-HHHHHhc
Confidence            78889999999999999999999999987642 23233322 21111       233666888999999888 799999 


Q ss_pred             ----------hhccCcccccHHHHHHHHHhc--CccccccchHHHHHHHHHHHHHHHhccccccc---CCCceeccHHHH
Q 048566          207 ----------LCSQMETRILTLDLFKYSMGL--GIFKRVNKMEDARDKLYALVHELRNSCLLIED---SNEQFSMHDVVR  271 (760)
Q Consensus       207 ----------~~a~fp~~~~~~~li~~w~a~--g~i~~~~~~~~~~~~~~~~l~~L~~~sll~~~---~~~~~~mH~lv~  271 (760)
                                |||+||+++.+.  ++.|+|+  ||+.........++.+. ++++|+++||++..   ....|+|||+||
T Consensus       385 Ls~~er~l~~~ls~fp~~~~i~--i~~w~a~~~G~i~~~~~~~~~~~~~~-~l~~L~~rsLl~~~~~~~~~~~~mHdlv~  461 (549)
T 2a5y_B          385 LSDEDRSALAFAVVMPPGVDIP--VKLWSCVIPVDICSNEEEQLDDEVAD-RLKRLSKRGALLSGKRMPVLTFKIDHIIH  461 (549)
T ss_dssp             SCHHHHHHTTGGGSSCTTCCEE--HHHHHHHSCC-------CCCTHHHHH-HHHHTTTBSSCSEEECSSSCEEECCHHHH
T ss_pred             cchhhhhHhhheeeeCCCCeee--eeeeeeeccceeccCCCCCCHHHHHH-HHHHHHHcCCeeEecCCCceEEEeChHHH
Confidence                      999999998887  8999999  99975431122334444 89999999999876   235799999999


Q ss_pred             HHHHHHhhccc
Q 048566          272 DVAISIGCRDQ  282 (760)
Q Consensus       272 ~~~~~~~~~e~  282 (760)
                      +||++++.+++
T Consensus       462 ~~a~~~~~~~~  472 (549)
T 2a5y_B          462 MFLKHVVDAQT  472 (549)
T ss_dssp             HHHHTTSCTHH
T ss_pred             HHHHHHHHHHH
Confidence            99998887654
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 760
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 2e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 86.8 bits (214), Expect = 2e-19
 Identities = 25/238 (10%), Positives = 61/238 (25%), Gaps = 48/238 (20%)

Query: 1   MGGIGKTTLVKKVARQA--MEDKLFDMVVFSEVSQIPDIKRIQQEIAEKLGLELREEVES 58
             G GK+ +  +   ++  +    +D +V+ + S               L L+  +++ +
Sbjct: 52  RAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLN 111

Query: 59  -----------SRASRIFERLRNEKKILVVLDNIWKHLDLETVGIPFGEDHKGCKLLLTA 107
                       +       +      L V D++ +   +              + L+T 
Sbjct: 112 FPSVEHVTSVVLKRMICNALID-RPNTLFVFDDVVQEETIRW------AQELRLRCLVTT 164

Query: 108 RDR--------------------KEAWRLFKMMVGDDVENRELKSTAIDVARACGGLPIA 147
           RD                      E +   +          + +           G P  
Sbjct: 165 RDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPAT 224

Query: 148 LTTVAMALRSKSLHGWKVSLGELRTPSMDNFEGVSAETYSSIELSFNHLKDEQLKKIF 205
           L     +   K+         +L +  +   E +          S+  L    L++  
Sbjct: 225 LMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECI-------TPYSYKSL-AMALQRCV 274
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query760
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.98
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.81
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.77
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.63
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.62
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.61
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.58
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.57
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.55
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.55
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.51
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.5
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.5
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.5
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.48
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.44
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.43
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.42
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.38
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.37
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.35
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.35
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.3
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.28
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.23
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.18
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.13
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.09
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.07
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.07
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.73
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.7
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.51
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.01
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.0
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.58
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.46
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.44
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.98
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.97
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.94
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.94
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 96.92
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.92
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.65
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.64
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.63
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.54
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.49
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.48
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.33
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.99
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.86
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.61
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.43
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.35
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.31
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.15
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.04
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 94.94
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 94.93
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.88
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 94.59
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.49
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 94.29
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.15
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 93.83
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 93.45
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 93.11
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 92.35
d1okkd2207 GTPase domain of the signal recognition particle r 91.9
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 91.83
d1xpua3289 Transcription termination factor Rho, ATPase domai 91.49
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 90.47
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 90.18
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 90.18
d1ls1a2207 GTPase domain of the signal sequence recognition p 89.53
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 89.49
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 89.41
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 89.38
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 89.28
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 89.1
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 88.96
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 88.69
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 88.6
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 87.8
d1vmaa2213 GTPase domain of the signal recognition particle r 87.74
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 87.68
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 87.3
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 87.17
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 86.97
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 86.93
d2qy9a2211 GTPase domain of the signal recognition particle r 86.86
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 86.83
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 86.48
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 86.14
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 85.48
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 85.39
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 85.2
d1j8yf2211 GTPase domain of the signal sequence recognition p 84.98
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 84.93
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 84.81
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 84.24
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 83.55
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 82.84
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 81.99
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 81.55
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 81.1
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 81.09
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 81.08
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 80.85
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 80.78
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 80.1
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 80.03
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.98  E-value=1.2e-33  Score=283.00  Aligned_cols=193  Identities=12%  Similarity=0.069  Sum_probs=151.2

Q ss_pred             CCCCcHHHHHHHHHHHHh--hhcCCCeEEEEEecCCCCHHHHHHHHHHHh---Ccccc-------ch-hhHHHHHHHHHH
Q 048566            1 MGGIGKTTLVKKVARQAM--EDKLFDMVVFSEVSQIPDIKRIQQEIAEKL---GLELR-------EE-VESSRASRIFER   67 (760)
Q Consensus         1 mgGiGKTtLA~~~~~~~~--~~~~F~~~~wv~~~~~~~~~~~~~~i~~~l---~~~~~-------~~-~~~~~~~~~~~~   67 (760)
                      |||+||||||+++|++..  .+.+|++++||++++.++...+...+...+   +....       .. ........+...
T Consensus        52 mgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  131 (277)
T d2a5yb3          52 RAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNAL  131 (277)
T ss_dssp             STTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHHHHHHHHHHHhcchhhcCCccchhhhhHHHHHHHHHHH
Confidence            899999999999999854  567899999999999988777766654433   22211       11 111122234444


Q ss_pred             HHcCCcEEEEEECCCCccccccccccccCCCCCcEEEEeeCCH--------------------HHHHHHHHHHhCCCcCC
Q 048566           68 LRNEKKILVVLDNIWKHLDLETVGIPFGEDHKGCKLLLTARDR--------------------KEAWRLFKMMVGDDVEN  127 (760)
Q Consensus        68 l~~~~r~LlVlDdv~~~~~~~~l~~~~~~~~~gs~IlvTTR~~--------------------~~a~~Lf~~~a~~~~~~  127 (760)
                      +. ++|+|+||||||+.++|+.+..      .|||||||||++                    +||++||+++++....+
T Consensus       132 L~-~kr~LlVLDDv~~~~~~~~~~~------~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~  204 (277)
T d2a5yb3         132 ID-RPNTLFVFDDVVQEETIRWAQE------LRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVG  204 (277)
T ss_dssp             TT-STTEEEEEEEECCHHHHHHHHH------TTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC--
T ss_pred             hc-cCCeeEecchhhHHhhhhhhcc------cCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCccCc
Confidence            44 6999999999999988876532      489999999988                    99999999998665556


Q ss_pred             hhhHHHHHHHHHHhCCcchHHHHHHHHHccCChHHHHHHHHHhcCCCCCCcCCchhHHHHHHHHhhhcCChhhHhHHHhh
Q 048566          128 RELKSTAIDVARACGGLPIALTTVAMALRSKSLHGWKVSLGELRTPSMDNFEGVSAETYSSIELSFNHLKDEQLKKIFLL  207 (760)
Q Consensus       128 ~~~~~~~~~i~~~c~glPLai~~~~~~l~~~~~~~w~~~l~~l~~~~~~~~~~~~~~~~~~l~~sy~~L~~~~lk~cfl~  207 (760)
                      +..++++++|+++|+|+||||+++|+.|+.++.++|.+..+.|....       ...+.+++.+||++||.+ +|.||.+
T Consensus       205 ~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~-------~~~v~~il~~sY~~L~~~-lk~c~~~  276 (277)
T d2a5yb3         205 EKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRG-------LVGVECITPYSYKSLAMA-LQRCVEV  276 (277)
T ss_dssp             CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHC-------SSTTCCCSSSSSSSHHHH-HHHHHHT
T ss_pred             hhhHHHHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHHHHHHhcCc-------HHHHHHHHHHHHhcccHH-HHHHHHh
Confidence            66788999999999999999999999999999999999888885432       234667889999999999 8999976


Q ss_pred             h
Q 048566          208 C  208 (760)
Q Consensus       208 ~  208 (760)
                      +
T Consensus       277 l  277 (277)
T d2a5yb3         277 L  277 (277)
T ss_dssp             S
T ss_pred             C
Confidence            3
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure