Citrus Sinensis ID: 048618


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
NSLTKLILRGNQLTGRLPTEIGSFKELEYLDLSANRFNNSVPKSLGSLLKLHYLSLSNNQFVQELPKELEKLVQLSELDLSHNFLGGELLSQICNMESLEKLNLSHNNLSGSIPNCFEGMHGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKELCGGVKGMQPCKVFSSHKQNSGAKWFAIVFPVLGAVFVSMALIAIFILRKR
ccccEEEcccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccHHHHccccccEEEccccccccccHHHHHccccccccccccccccccccHHHHccccccEEEccccccccccccccccccccHHHHccccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHcc
ccEEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEEcccccccccccccccccHHHHHHccccccccccccccccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcc
NSLTKLILRgnqltgrlpteigsfkeleyldlsanrfnnsvpkSLGSLLKLHYLSLSNNQFVQELPKELEKLVQLseldlshnflggELLSQICNMESLEKLNLshnnlsgsipncfegmhglsvidisdnqlqgpvpnstafrnapvealegnkelcggvkgmqpckvfsshkqnsgakWFAIVFPVLGAVFVSMALIAIFILRKR
nsltklilrgnqltgrlpteiGSFKELEYLDLSANRFNNSVPKSLGSLLKLHYLSLSNNQFVQELPKELEKLVQLSELDLSHNFLGGELLSQICNMESLEKLNLSHNNLSGSIPNCFEGMHGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKELCGGVKGMQPCKVFSSHKQNSGAKWFAIVFPVLGAVFVSMALIAIFILRKR
NSLTKLILRGNQLTGRLPTEIGSFKELEYLDLSANRFNNSVPKslgsllklhylslsNNQFVQELPKELEKLVQLSELDLSHNFLGGELLSQICNMESLEKLNLSHNNLSGSIPNCFEGMHGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKELCGGVKGMQPCKVFSSHKQNSGAKWFAIVFPVLGAVFVSMALIAIFILRKR
*****LILRGNQLTGRLPTEIGSFKELEYLDLSANRFNNSVPKSLGSLLKLHYLSLSNNQFVQELPKELEKLVQLSELDLSHNFLGGELLSQICNMESLEKLNLSHNNLSGSIPNCFEGMHGLSVIDISDN******************ALEGNKELCGGVKGMQPCKVFSSHKQNSGAKWFAIVFPVLGAVFVSMALIAIFIL***
NSLTKLILRGNQLTGRLPTEIGSFKELEYLDLSANRFNNSVPKSLGSLLKLHYLSLSNNQFVQELPKELEKLVQLSELDLSHNFLGGELLSQICNMESLEKLNLSHNNLSGSIPNCFEGMHGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKELCGGV*********************AIVFPVLGAVFVSMALIAIFILRKR
NSLTKLILRGNQLTGRLPTEIGSFKELEYLDLSANRFNNSVPKSLGSLLKLHYLSLSNNQFVQELPKELEKLVQLSELDLSHNFLGGELLSQICNMESLEKLNLSHNNLSGSIPNCFEGMHGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKELCGGVKGMQPCKVFSSHKQNSGAKWFAIVFPVLGAVFVSMALIAIFILRKR
NSLTKLILRGNQLTGRLPTEIGSFKELEYLDLSANRFNNSVPKSLGSLLKLHYLSLSNNQFVQELPKELEKLVQLSELDLSHNFLGGELLSQICNMESLEKLNLSHNNLSGSIPNCFEGMHGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKELCGGVKGMQPCKVFSSHKQNSGAKWFAIVFPVLGAVFVSMALIAIFILRKR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NSLTKLILRGNQLTGRLPTEIGSFKELEYLDLSANRFNNSVPKSLGSLLKLHYLSLSNNQFVQELPKELEKLVQLSELDLSHNFLGGELLSQICNMESLEKLNLSHNNLSGSIPNCFEGMHGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKELCGGVKGMQPCKVFSSHKQNSGAKWFAIVFPVLGAVFVSMALIAIFILRKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query207 2.2.26 [Sep-21-2011]
Q8VZG8 1045 Probable LRR receptor-lik yes no 1.0 0.198 0.471 3e-49
Q9LP24 1120 Probable leucine-rich rep no no 0.975 0.180 0.457 2e-43
O82318 960 Probably inactive leucine no no 0.961 0.207 0.355 1e-22
Q9FL28 1173 LRR receptor-like serine/ no no 0.864 0.152 0.335 3e-22
O49545 1003 Leucine-rich repeat recep no no 0.792 0.163 0.379 5e-22
C0LGQ9 1037 Probable LRR receptor-lik no no 0.521 0.104 0.421 1e-21
Q9LYN8 1192 Leucine-rich repeat recep no no 0.951 0.165 0.333 2e-21
Q9M2Z1 1002 Leucine-rich repeat recep no no 0.980 0.202 0.336 3e-21
Q9M0G7 1013 Leucine-rich repeat recep no no 0.956 0.195 0.310 3e-21
Q9SHI2 1101 Leucine-rich repeat recep no no 0.995 0.187 0.311 4e-21
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function desciption
 Score =  194 bits (494), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 146/212 (68%), Gaps = 5/212 (2%)

Query: 1   NSLTKLILRGNQLTGRLPTEIGSFKELEYLDLSANRFNNSVPKSLGSLLKLHYLSLSNNQ 60
           N ++KL L GN+L+G++P+ I     LEYLDLS+NRF++ +P +L +L +L+Y++LS N 
Sbjct: 526 NRISKLQLNGNRLSGKIPSGIRLLTNLEYLDLSSNRFSSEIPPTLNNLPRLYYMNLSRND 585

Query: 61  FVQELPKELEKLVQLSELDLSHNFLGGELLSQICNMESLEKLNLSHNNLSGSIPNCFEGM 120
             Q +P+ L KL QL  LDLS+N L GE+ SQ  ++++LE+L+LSHNNLSG IP  F+ M
Sbjct: 586 LDQTIPEGLTKLSQLQMLDLSYNQLDGEISSQFRSLQNLERLDLSHNNLSGQIPPSFKDM 645

Query: 121 HGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKELCGGV---KGMQPCKVFSSHKQNS 177
             L+ +D+S N LQGP+P++ AFRNAP +A EGNK+LCG V   +G++PC + SS K + 
Sbjct: 646 LALTHVDVSHNNLQGPIPDNAAFRNAPPDAFEGNKDLCGSVNTTQGLKPCSITSSKKSHK 705

Query: 178 GAKW-FAIVFPVLGAVFVSMALIAIFI-LRKR 207
                  I+ P++GA+ +      IFI  RKR
Sbjct: 706 DRNLIIYILVPIIGAIIILSVCAGIFICFRKR 737





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ9|Y4294_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 Back     alignment and function description
>sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
225456161 1037 PREDICTED: probable LRR receptor-like se 0.995 0.198 0.557 3e-56
359491512 1078 PREDICTED: probable LRR receptor-like se 0.995 0.191 0.566 4e-56
225456159 1038 PREDICTED: probable LRR receptor-like se 0.995 0.198 0.552 6e-56
147772402 996 hypothetical protein VITISV_022117 [Viti 0.995 0.206 0.557 3e-55
255545702 1008 receptor protein kinase, putative [Ricin 0.990 0.203 0.540 7e-52
147767326 1032 hypothetical protein VITISV_008862 [Viti 0.985 0.197 0.546 9e-48
359491509 1032 PREDICTED: probable LRR receptor-like se 0.985 0.197 0.546 1e-47
7267528 1027 receptor protein kinase-like protein [Ar 1.0 0.201 0.471 1e-47
186511602 1045 Leucine-rich repeat-containing protein [ 1.0 0.198 0.471 1e-47
186511604 1009 Leucine-rich repeat-containing protein [ 1.0 0.205 0.471 2e-47
>gi|225456161|ref|XP_002278590.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 117/210 (55%), Positives = 147/210 (70%), Gaps = 4/210 (1%)

Query: 2   SLTKLILRGNQLTGRLPTEIGSFKELEYLDLSANRFNNSVPKSLGSLLKLHYLSLSNNQF 61
           SL  LIL  NQL+G +P E+GS   LEYLDLSANR N S+P+ LG  L LHYL+LSNN+ 
Sbjct: 522 SLLGLILNDNQLSGSIPPELGSLSHLEYLDLSANRLNGSIPEHLGDCLDLHYLNLSNNKL 581

Query: 62  VQELPKELEKLVQLSELDLSHNFLGGELLSQICNMESLEKLNLSHNNLSGSIPNCFEGMH 121
              +P ++ KL  LS+LDLSHN L G + +QI  +ESLE L+LSHNNL G IP  FE M 
Sbjct: 582 SHGIPVQMGKLSHLSQLDLSHNLLTGGIPAQIQGLESLEMLDLSHNNLCGFIPKAFEDMP 641

Query: 122 GLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKELCGGVKGMQPCKV-FSSHKQ---NS 177
            LS +DIS NQLQGP+P+S AFRNA +E L+GNK+LCG VKG+QPCK  F   +Q    S
Sbjct: 642 ALSYVDISYNQLQGPIPHSNAFRNATIEVLKGNKDLCGNVKGLQPCKYGFGVDQQPVKKS 701

Query: 178 GAKWFAIVFPVLGAVFVSMALIAIFILRKR 207
               F I+FP+LGA+ +  A I IF++ +R
Sbjct: 702 HKVVFIIIFPLLGALVLLSAFIGIFLIAER 731




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359491512|ref|XP_002278614.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456159|ref|XP_002278561.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147772402|emb|CAN73988.1| hypothetical protein VITISV_022117 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255545702|ref|XP_002513911.1| receptor protein kinase, putative [Ricinus communis] gi|223546997|gb|EEF48494.1| receptor protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147767326|emb|CAN68996.1| hypothetical protein VITISV_008862 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491509|ref|XP_002278522.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|7267528|emb|CAB78010.1| receptor protein kinase-like protein [Arabidopsis thaliana] gi|7321074|emb|CAB82121.1| receptor protein kinase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|186511602|ref|NP_849538.2| Leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|281185491|sp|Q8VZG8.3|Y4885_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein kinase At4g08850; Flags: Precursor gi|18086327|gb|AAL57627.1| AT4g08850/T32A17_160 [Arabidopsis thaliana] gi|224589610|gb|ACN59338.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|332657282|gb|AEE82682.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|186511604|ref|NP_192625.4| Leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|222423559|dbj|BAH19749.1| AT4G08850 [Arabidopsis thaliana] gi|332657283|gb|AEE82683.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 1.0 0.198 0.443 4.5e-42
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.975 0.180 0.419 3.5e-37
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.927 0.163 0.311 7.1e-22
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.961 0.177 0.344 3.7e-21
TAIR|locus:2169965 1003 BAM1 "BARELY ANY MERISTEM 1" [ 0.985 0.203 0.327 6.6e-21
TAIR|locus:2054421 890 AT2G41820 [Arabidopsis thalian 0.990 0.230 0.319 7e-21
TAIR|locus:2161825 1090 AT5G56040 [Arabidopsis thalian 0.951 0.180 0.330 7.5e-21
TAIR|locus:2097310 1002 BAM2 "BARELY ANY MERISTEM 2" [ 0.971 0.200 0.323 8.4e-21
TAIR|locus:2033379 685 AT1G66830 [Arabidopsis thalian 0.980 0.296 0.336 9.1e-21
TAIR|locus:2037313 1000 RLP13 "AT1G74170" [Arabidopsis 0.618 0.128 0.342 8.6e-13
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 456 (165.6 bits), Expect = 4.5e-42, P = 4.5e-42
 Identities = 94/212 (44%), Positives = 134/212 (63%)

Query:     1 NSLTKLILRGNQLTGRLPTEIGSFKELEYLDLSANRFNNSVPKXXXXXXXXXXXXXXNNQ 60
             N ++KL L GN+L+G++P+ I     LEYLDLS+NRF++ +P                N 
Sbjct:   526 NRISKLQLNGNRLSGKIPSGIRLLTNLEYLDLSSNRFSSEIPPTLNNLPRLYYMNLSRND 585

Query:    61 FVQELPKELEKLVQLSELDLSHNFLGGELLSQICNMESLEKLNLSHNNLSGSIPNCFEGM 120
               Q +P+ L KL QL  LDLS+N L GE+ SQ  ++++LE+L+LSHNNLSG IP  F+ M
Sbjct:   586 LDQTIPEGLTKLSQLQMLDLSYNQLDGEISSQFRSLQNLERLDLSHNNLSGQIPPSFKDM 645

Query:   121 HGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKELCGGV---KGMQPCKVFSSHKQNS 177
               L+ +D+S N LQGP+P++ AFRNAP +A EGNK+LCG V   +G++PC + SS K + 
Sbjct:   646 LALTHVDVSHNNLQGPIPDNAAFRNAPPDAFEGNKDLCGSVNTTQGLKPCSITSSKKSHK 705

Query:   178 GAKWFA-IVFPVLGAVFVSMALIAIFI-LRKR 207
                    I+ P++GA+ +      IFI  RKR
Sbjct:   706 DRNLIIYILVPIIGAIIILSVCAGIFICFRKR 737


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0016020 "membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0006857 "oligopeptide transport" evidence=RCA
GO:0006995 "cellular response to nitrogen starvation" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0031347 "regulation of defense response" evidence=RCA
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169965 BAM1 "BARELY ANY MERISTEM 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054421 AT2G41820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097310 BAM2 "BARELY ANY MERISTEM 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033379 AT1G66830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
AT4G08850
kinase; kinase; FUNCTIONS IN- kinase activity; INVOLVED IN- protein amino acid phosphorylation; LOCATED IN- plasma membrane, membrane; EXPRESSED IN- 23 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- Protein kinase, ATP binding site (InterPro-IPR017441), Protein kinase, core (InterPro-IPR000719), Leucine-rich repeat, N-terminal (InterPro-IPR013210), Tyrosine protein kinase, active site (InterPro-IPR008266), Leucine-rich repeat (InterPro-IPR001611), Serine/threonine protein kinase-related (InterPro-IPR017442), Protein kinase-like (InterPro-IPR011009); B [...] (1045 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
Rps2
RPS2 (RESISTANT TO P. SYRINGAE 2); protein binding; Encodes a plasma membrane protein with leuc [...] (909 aa)
     0.878
AT2G31880
leucine-rich repeat transmembrane protein kinase, putative; Encodes a putative leucine rich rep [...] (641 aa)
      0.754
AT5G48380
leucine-rich repeat family protein / protein kinase family protein; leucine-rich repeat family [...] (620 aa)
      0.704
EDA39
EDA39 (embryo sac development arrest 39); calmodulin binding; embryo sac development arrest 39 [...] (526 aa)
       0.696
RPP13L4
disease resistance protein (CC-NBS-LRR class), putative; disease resistance protein (CC-NBS-LRR [...] (852 aa)
       0.645
AT2G39210
nodulin family protein; nodulin family protein; FUNCTIONS IN- molecular_function unknown; INVOL [...] (601 aa)
       0.641
PEN3
PEN3 (PENETRATION 3); ATPase, coupled to transmembrane movement of substances / cadmium ion tra [...] (1469 aa)
       0.631
DL3220C
zinc finger (C3HC4-type RING finger) family protein / ankyrin repeat family protein; zinc finge [...] (376 aa)
       0.625
AT1G19380
unknown protein; unknown protein; INVOLVED IN- biological_process unknown; EXPRESSED IN- 24 pla [...] (147 aa)
      0.614
AT4G38550
unknown protein; LOCATED IN- chloroplast; EXPRESSED IN- 21 plant structures; EXPRESSED DURING- [...] (612 aa)
       0.605

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-33
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-22
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-20
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-18
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-18
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  125 bits (315), Expect = 3e-33
 Identities = 84/211 (39%), Positives = 114/211 (54%), Gaps = 12/211 (5%)

Query: 2   SLTKLILRGNQLTGRLPTEIGSFKELEYLDLSANRFNNSVPKSLGSLLKLHYLSLSNNQF 61
           SL  L L  N+  G LP   GS K LE LDLS N+F+ +VP+ LGSL +L  L LS N+ 
Sbjct: 453 SLQMLSLARNKFFGGLPDSFGS-KRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKL 511

Query: 62  VQELPKELEKLVQLSELDLSHNFLGGELLSQICNMESLEKLNLSHNNLSGSIPNCFEGMH 121
             E+P EL    +L  LDLSHN L G++ +    M  L +L+LS N LSG IP     + 
Sbjct: 512 SGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVE 571

Query: 122 GLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKELCGGVK--GMQPCKVFSSHKQNSGA 179
            L  ++IS N L G +P++ AF      A+ GN +LCGG    G+ PCK           
Sbjct: 572 SLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGDTTSGLPPCKRVRKTPS---- 627

Query: 180 KWFAIVFPVLGAVFVSMALIA---IFILRKR 207
            W+  +   LGA F+ +AL+A   +FI  + 
Sbjct: 628 -WWFYITCTLGA-FLVLALVAFGFVFIRGRN 656


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 207
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.92
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.82
PLN03150623 hypothetical protein; Provisional 99.72
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.71
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
KOG4237498 consensus Extracellular matrix protein slit, conta 99.63
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.51
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.5
PLN03150623 hypothetical protein; Provisional 99.48
KOG4237498 consensus Extracellular matrix protein slit, conta 99.46
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.46
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.39
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.37
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.35
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.32
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.29
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.28
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.28
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.27
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.23
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.22
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.19
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.17
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.12
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.12
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.1
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.03
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.03
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.03
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.98
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.89
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.88
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.78
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.76
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.68
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.61
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.57
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.54
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.53
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.53
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.47
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.45
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.45
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.45
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.42
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.37
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.3
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.26
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.16
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.06
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.96
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.96
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.95
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.78
PRK15386 426 type III secretion protein GogB; Provisional 97.76
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.74
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.73
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.71
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.63
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.51
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.49
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.39
PRK15386 426 type III secretion protein GogB; Provisional 96.89
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.65
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.55
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 96.11
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.06
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.04
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 94.96
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 94.89
KOG1947 482 consensus Leucine rich repeat proteins, some prote 94.88
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.73
smart0037026 LRR Leucine-rich repeats, outliers. 94.22
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.22
KOG4308 478 consensus LRR-containing protein [Function unknown 94.12
TIGR01478295 STEVOR variant surface antigen, stevor family. Thi 94.08
PTZ00370296 STEVOR; Provisional 94.02
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.0
smart0037026 LRR Leucine-rich repeats, outliers. 94.0
PF14991118 MLANA: Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 93.91
KOG1947482 consensus Leucine rich repeat proteins, some prote 93.87
KOG0473 326 consensus Leucine-rich repeat protein [Function un 93.33
KOG0473 326 consensus Leucine-rich repeat protein [Function un 92.91
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 92.83
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 92.7
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 92.29
PF15102146 TMEM154: TMEM154 protein family 91.82
KOG4308 478 consensus LRR-containing protein [Function unknown 91.41
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 91.23
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.75
PF02009299 Rifin_STEVOR: Rifin/stevor family; InterPro: IPR00 88.92
PF12191129 stn_TNFRSF12A: Tumour necrosis factor receptor stn 88.11
PF0103464 Syndecan: Syndecan domain; InterPro: IPR001050 The 87.45
PHA03265402 envelope glycoprotein D; Provisional 86.59
PF01299306 Lamp: Lysosome-associated membrane glycoprotein (L 86.4
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 86.06
PF08374 221 Protocadherin: Protocadherin; InterPro: IPR013585 86.03
PF0562449 LSR: Lipolysis stimulated receptor (LSR); InterPro 85.67
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 84.78
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 84.34
KOG4341483 consensus F-box protein containing LRR [General fu 83.47
PF06365202 CD34_antigen: CD34/Podocalyxin family; InterPro: I 83.16
PF12191129 stn_TNFRSF12A: Tumour necrosis factor receptor stn 81.37
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.92  E-value=3e-24  Score=188.42  Aligned_cols=160  Identities=43%  Similarity=0.669  Sum_probs=137.9

Q ss_pred             CccEEECCCCCCcccCCcccCCCCCCCEeeCcCCCCCCCcchhhcCCCCCCeeeccCCcCCCccchhhhCCCCCCEEecC
Q 048618            2 SLTKLILRGNQLTGRLPTEIGSFKELEYLDLSANRFNNSVPKSLGSLLKLHYLSLSNNQFVQELPKELEKLVQLSELDLS   81 (207)
Q Consensus         2 ~L~~L~l~~n~i~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~   81 (207)
                      +|+.|++++|.+.+..|..+ ...+|+.|++++|++.+..|..+.++++|+.|++++|.+.+..|+.+..+++|+.|+++
T Consensus       453 ~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls  531 (968)
T PLN00113        453 SLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLS  531 (968)
T ss_pred             CCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECC
Confidence            45666666666665555543 35677888888888888888888899999999999999998999999999999999999


Q ss_pred             CCCCCCchhHHhhcCCCCCEEeCCCCcCCCCccccccCCCCCCEEECCCCcCcccCCCCcccCCCCcccccCCCCCCCCC
Q 048618           82 HNFLGGELLSQICNMESLEKLNLSHNNLSGSIPNCFEGMHGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKELCGGV  161 (207)
Q Consensus        82 ~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~l~l~~n~~~~~~~~~~~~~~~~~~~~~~n~~~c~~~  161 (207)
                      +|.+++..|..+..+++|+.|++++|.+++..|..+..+++|+.+++++|++.+.+|....+..+....+.+|+.+|+..
T Consensus       532 ~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        532 HNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             CCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            99999999999999999999999999999999999999999999999999999999988877778888889999999865


Q ss_pred             C
Q 048618          162 K  162 (207)
Q Consensus       162 ~  162 (207)
                      +
T Consensus       612 ~  612 (968)
T PLN00113        612 T  612 (968)
T ss_pred             c
Confidence            3



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>TIGR01478 STEVOR variant surface antigen, stevor family Back     alignment and domain information
>PTZ00370 STEVOR; Provisional Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF14991 MLANA: Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 2GUO_C 3MRQ_P 2GTW_C 3L6F_C 3MRP_P Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF15102 TMEM154: TMEM154 protein family Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02009 Rifin_STEVOR: Rifin/stevor family; InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world Back     alignment and domain information
>PF12191 stn_TNFRSF12A: Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain; InterPro: IPR022316 The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins Back     alignment and domain information
>PF01034 Syndecan: Syndecan domain; InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ] Back     alignment and domain information
>PHA03265 envelope glycoprotein D; Provisional Back     alignment and domain information
>PF01299 Lamp: Lysosome-associated membrane glycoprotein (Lamp); InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>PF08374 Protocadherin: Protocadherin; InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains Back     alignment and domain information
>PF05624 LSR: Lipolysis stimulated receptor (LSR); InterPro: IPR008664 This domain consists of mammalian LISCH7 protein homologues Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF06365 CD34_antigen: CD34/Podocalyxin family; InterPro: IPR013836 This family consists of several mammalian CD34 antigen proteins Back     alignment and domain information
>PF12191 stn_TNFRSF12A: Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain; InterPro: IPR022316 The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-11
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-10
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-11
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-10
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-06
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 65.9 bits (159), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 42/138 (30%), Positives = 69/138 (50%) Query: 1 NSLTKLILRGNQLTGRLPTEIGSFKELEYLDLSANRFNNSVPKXXXXXXXXXXXXXXNNQ 60 N+L +L L+ N TG++P + + EL L LS N + ++P N Sbjct: 391 NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNM 450 Query: 61 FVQELPKELEKLVQLSELDLSHNFLGGELLSQICNMESLEKLNLSHNNLSGSIPNCFEGM 120 E+P+EL + L L L N L GE+ S + N +L ++LS+N L+G IP + Sbjct: 451 LEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRL 510 Query: 121 HGLSVIDISDNQLQGPVP 138 L+++ +S+N G +P Sbjct: 511 ENLAILKLSNNSFSGNIP 528
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-46
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-35
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-18
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-44
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-36
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-36
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-35
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-33
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-33
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-33
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-31
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-29
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-28
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-27
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-31
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-22
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-27
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-24
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-20
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-25
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-25
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-24
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-24
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-24
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-24
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-22
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-24
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-24
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-24
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-22
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-19
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-24
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-23
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-23
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-22
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-22
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-20
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 8e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-08
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 4e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-22
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-19
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-19
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-18
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-17
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-15
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-18
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-17
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-18
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-10
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-16
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-13
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-10
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-17
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-14
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-17
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-16
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-15
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-17
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-14
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-12
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 9e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-12
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-08
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 4e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-08
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-11
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-08
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-07
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-08
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 4e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 6e-06
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 3e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 3e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  154 bits (393), Expect = 1e-46
 Identities = 42/167 (25%), Positives = 77/167 (46%), Gaps = 5/167 (2%)

Query: 2   SLTKLILRGNQLTGRLPTEIGSFKEL-EYLDLSANRFNNSVPKSLGSLLKLHYLSLSNNQ 60
           +L  +   GN+++G +P   GSF +L   + +S NR    +P +  +L  L ++ LS N 
Sbjct: 150 NLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL-NLAFVDLSRNM 208

Query: 61  FVQELPKELEKLVQLSELDLSHNFLGGELLSQICNMESLEKLNLSHNNLSGSIPNCFEGM 120
              +            ++ L+ N L  +L  ++   ++L  L+L +N + G++P     +
Sbjct: 209 LEGDASVLFGSDKNTQKIHLAKNSLAFDL-GKVGLSKNLNGLDLRNNRIYGTLPQGLTQL 267

Query: 121 HGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKELCGGVKGMQPC 167
             L  +++S N L G +P     +   V A   NK LCG    +  C
Sbjct: 268 KFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGS--PLPAC 312


>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.91
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.91
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.88
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.88
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.86
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.86
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.86
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.86
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.86
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.86
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.86
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.85
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.85
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.85
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.85
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.85
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.83
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.83
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.83
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.83
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.82
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.82
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.82
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.82
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.82
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.82
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.82
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.81
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.81
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.81
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.81
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.81
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.81
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.81
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.8
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.8
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.8
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.8
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.8
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.8
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.8
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.8
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.8
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.79
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.79
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.79
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.79
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.78
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.78
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.78
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.78
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.78
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.77
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.77
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.77
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.77
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.76
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.76
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.76
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.75
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.75
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.74
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.74
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.73
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.73
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.73
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.72
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.7
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.7
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.69
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.69
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.68
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.67
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.65
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.64
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.63
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.63
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.63
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.62
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.61
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.61
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.6
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.6
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.6
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.59
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.57
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.57
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.56
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.56
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.54
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.51
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.51
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.49
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.46
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.44
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.4
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.38
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.36
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.2
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.08
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.01
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.01
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.96
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.92
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.89
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.86
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.83
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.68
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.59
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.58
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.57
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.24
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.23
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.23
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.2
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.15
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.08
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.95
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.75
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.41
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 95.09
2k1k_A38 Ephrin type-A receptor 1; EPHA1, receptor tyrosine 93.75
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 93.55
2k9y_A41 Ephrin type-A receptor 2; receptor tyrosine kinase 92.42
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 92.01
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 91.95
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 88.06
1iij_A35 ERBB-2 receptor protein-tyrosine kinase; alpha-hel 86.91
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 83.94
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.92  E-value=1.1e-24  Score=185.91  Aligned_cols=121  Identities=31%  Similarity=0.519  Sum_probs=109.6

Q ss_pred             CCCCCeeeccCCcCCCccchhhhCCCCCCEEecCCCCCCCchhHHhhcCCCCCEEeCCCCcCCCCccccccCCCCCCEEE
Q 048618           48 LLKLHYLSLSNNQFVQELPKELEKLVQLSELDLSHNFLGGELLSQICNMESLEKLNLSHNNLSGSIPNCFEGMHGLSVID  127 (207)
Q Consensus        48 l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~l~  127 (207)
                      +++|+.|++++|++++.+|..++.++.|+.|++++|.+++.+|..++.+++|+.|+|++|.+++.+|..+..+++|+.|+
T Consensus       631 l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~  710 (768)
T 3rgz_A          631 NGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEID  710 (768)
T ss_dssp             SBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEE
T ss_pred             cccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEE
Confidence            45677888888888888899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcCcccCCCCcccCCCCcccccCCCCCCCCCCCCCCCccc
Q 048618          128 ISDNQLQGPVPNSTAFRNAPVEALEGNKELCGGVKGMQPCKVF  170 (207)
Q Consensus       128 l~~n~~~~~~~~~~~~~~~~~~~~~~n~~~c~~~~~~~~~~~~  170 (207)
                      +++|+++|.+|....+..+....+.+|+.+|+.+..  .|...
T Consensus       711 ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~--~C~~~  751 (768)
T 3rgz_A          711 LSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP--RCDPS  751 (768)
T ss_dssp             CCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC--CCCSC
T ss_pred             CcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc--CCCCC
Confidence            999999999999988999999999999999997643  66543



>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>2k9y_A Ephrin type-A receptor 2; receptor tyrosine kinase, membrane protein, dimeric transmembrane domain, ephrin receptor, ATP-binding, glycoprotein; NMR {Homo sapiens} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>1iij_A ERBB-2 receptor protein-tyrosine kinase; alpha-helix-PI-bulge-alpha-helix, signaling protein; NMR {Synthetic} SCOP: j.35.1.1 Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 207
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-14
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-12
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-09
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-07
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-07
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 6e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 8e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 3e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-04
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 70.4 bits (171), Expect = 5e-15
 Identities = 33/150 (22%), Positives = 61/150 (40%), Gaps = 28/150 (18%)

Query: 2   SLTKLILRGNQLTGRLPTEIGSFKELEYLDLSANRFNNSVP------------------- 42
           +LT L L  NQ++   P  +    +L  L L AN+ +N  P                   
Sbjct: 242 NLTDLDLANNQISNLAP--LSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLED 299

Query: 43  -KSLGSLLKLHYLSLSNNQFVQELPKELEKLVQLSELDLSHNFLGGELLSQICNMESLEK 101
              + +L  L YL+L  N      P  +  L +L  L  ++N +    +S + N+ ++  
Sbjct: 300 ISPISNLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINW 355

Query: 102 LNLSHNNLSGSIPNCFEGMHGLSVIDISDN 131
           L+  HN +S   P     +  ++ + ++D 
Sbjct: 356 LSAGHNQISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.87
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.84
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.83
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.82
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.78
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.77
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.74
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.73
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.67
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.65
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.58
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.57
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.54
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.52
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.5
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.5
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.45
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.4
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.32
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.23
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.22
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.05
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 99.01
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.0
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.94
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.93
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.79
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.68
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.6
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.52
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.49
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.1
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.08
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Slit
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.87  E-value=2.5e-22  Score=142.51  Aligned_cols=158  Identities=23%  Similarity=0.300  Sum_probs=132.3

Q ss_pred             ccEEECCCCCCcccCCcccCCCCCCCEeeCcCCCCCC-CcchhhcCCCCCCeeeccCCcCCCccchhhhCCCCCCEEecC
Q 048618            3 LTKLILRGNQLTGRLPTEIGSFKELEYLDLSANRFNN-SVPKSLGSLLKLHYLSLSNNQFVQELPKELEKLVQLSELDLS   81 (207)
Q Consensus         3 L~~L~l~~n~i~~~~~~~~~~l~~L~~L~L~~n~i~~-~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~   81 (207)
                      .+.++.+++.++ .+|..+.  +++++|+|++|.|+. ..+..|.++++|+.|++++|.+....++.|..+++|++|+++
T Consensus        10 ~~~v~Cs~~~L~-~iP~~lp--~~l~~L~Ls~N~i~~~~~~~~f~~l~~L~~L~L~~N~i~~~~~~~~~~~~~L~~L~Ls   86 (192)
T d1w8aa_          10 GTTVDCTGRGLK-EIPRDIP--LHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLG   86 (192)
T ss_dssp             TTEEECTTSCCS-SCCSCCC--TTCSEEECCSCCCCSBCCSCSGGGCTTCCEEECCSSCCCCBCTTTTTTCTTCCEEECC
T ss_pred             CCEEEEeCCCcC-ccCCCCC--CCCCEEEeCCCCCcccccccccCCCceEeeeeccccccccccccccccccccceeeec
Confidence            357889999999 6676653  789999999999976 456678999999999999999999999999999999999999


Q ss_pred             CCCCCCchhHHhhcCCCCCEEeCCCCcCCCCccccccCCCCCCEEECCCCcCcccCCCCcccCCCCcccccCCCCCCCCC
Q 048618           82 HNFLGGELLSQICNMESLEKLNLSHNNLSGSIPNCFEGMHGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKELCGGV  161 (207)
Q Consensus        82 ~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~l~l~~n~~~~~~~~~~~~~~~~~~~~~~n~~~c~~~  161 (207)
                      +|+++...+..|.++++|++|+|++|.+++..++.|..+++|+.+++++|++.+.++.......+....+..+...|..+
T Consensus        87 ~N~l~~l~~~~F~~l~~L~~L~L~~N~l~~i~~~~f~~l~~L~~l~L~~N~~~~~~~~~~~~~~l~~~~l~~~~~~c~~p  166 (192)
T d1w8aa_          87 ENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAARCGAP  166 (192)
T ss_dssp             SCCCCEECSSSSTTCTTCCEEECCSSCCCEECTTSSTTCTTCCEEECTTCCBCCSGGGHHHHHHHHHHCCSGGGCBBCSS
T ss_pred             cccccccCHHHHhCCCcccccccCCccccccCHHHhcCCcccccccccccccccccchHHHhhhhhhhcccCCCeEeCCC
Confidence            99999888888999999999999999999888899999999999999999998877654333334444455566667655


Q ss_pred             CC
Q 048618          162 KG  163 (207)
Q Consensus       162 ~~  163 (207)
                      ..
T Consensus       167 ~~  168 (192)
T d1w8aa_         167 SK  168 (192)
T ss_dssp             TT
T ss_pred             hh
Confidence            43



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure