Citrus Sinensis ID: 048652
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1382 | 2.2.26 [Sep-21-2011] | |||||||
| Q00416 | 2231 | Helicase SEN1 OS=Saccharo | yes | no | 0.191 | 0.118 | 0.381 | 6e-44 | |
| B6SFA4 | 818 | Probable helicase MAGATAM | no | no | 0.230 | 0.389 | 0.330 | 1e-41 | |
| O94387 | 1944 | Uncharacterized ATP-depen | yes | no | 0.188 | 0.134 | 0.392 | 2e-41 | |
| Q86AS0 | 967 | Probable helicase DDB_G02 | no | no | 0.217 | 0.310 | 0.346 | 1e-40 | |
| Q92355 | 1687 | Helicase sen1 OS=Schizosa | no | no | 0.191 | 0.157 | 0.369 | 1e-40 | |
| P30771 | 971 | ATP-dependent helicase NA | no | no | 0.193 | 0.274 | 0.352 | 5e-36 | |
| Q9HEH1 | 1093 | Regulator of nonsense tra | N/A | no | 0.191 | 0.241 | 0.36 | 2e-35 | |
| Q9FJR0 | 1254 | Regulator of nonsense tra | no | no | 0.201 | 0.222 | 0.346 | 2e-35 | |
| Q9EPU0 | 1124 | Regulator of nonsense tra | yes | no | 0.201 | 0.248 | 0.342 | 4e-35 | |
| Q92900 | 1129 | Regulator of nonsense tra | yes | no | 0.201 | 0.247 | 0.342 | 9e-35 |
| >sp|Q00416|SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN1 PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 180 bits (457), Expect = 6e-44, Method: Compositional matrix adjust.
Identities = 105/275 (38%), Positives = 161/275 (58%), Gaps = 10/275 (3%)
Query: 587 LVIDEAAQLKESESTIPLQLAGINHAVLIGDECQLPAMVESKISDGASFGRSLFERLTLL 646
++IDEA Q E S IPL+ G +++GD QLP V S + + +SLF R+
Sbjct: 1587 VIIDEACQCTELSSIIPLRYGG-KRCIMVGDPNQLPPTVLSGAASNFKYNQSLFVRMEK- 1644
Query: 647 NHSKHLLDIQYRMHPSISLFPNLQFYRNQILDGANVKSKSYEK-HYLPGTEFGPYTFINI 705
N S +LLD+QYRMHPSIS FP+ +FY+ ++ DG + + H L PY F +I
Sbjct: 1645 NSSPYLLDVQYRMHPSISKFPSSEFYQGRLKDGPGMDILNKRPWHQL--EPLAPYKFFDI 1702
Query: 706 IGGREE--FIYHSCRNMVEVSVVIKILQKLYKAWVGSKQMVS-IGVVSPYTAQVVAIRKK 762
I GR+E S NM E+ V I+++ L++ + IG++SPY Q+ +RK+
Sbjct: 1703 ISGRQEQNAKTMSYTNMEEIRVAIELVDYLFRKFDNKIDFTGKIGIISPYREQMQKMRKE 1762
Query: 763 IGSEYENKDGFTVKVKSVDGFQGGEEDIIIISTVRC-NTGGSIGFISNPQRVNVALTRAR 821
+ ++ ++DGFQG E++II+IS VR +T S+GF+ + +R+NVALTRA+
Sbjct: 1763 FARYFGGMINKSIDFNTIDGFQGQEKEIILISCVRADDTKSSVGFLKDFRRMNVALTRAK 1822
Query: 822 HCLWILGNERTLISSESIWGTLVCDAKARQCFFKA 856
+W+LG++R+L S+ +W L+ DAK R C A
Sbjct: 1823 TSIWVLGHQRSLAKSK-LWRDLIEDAKDRSCLAYA 1856
|
ATP-dependent 5'->3' DNA/RNA helicase required for the expression and maturation of diverse classes of non-protein-coding RNAs like precursor tRNAs, rRNAs and small nuclear (snRNA) and nucleolar (snoRNA) RNAs. Directs RNA polymerase II transcription termination on snoRNAs as well as on several short protein-coding genes. May also play a role in transcription-coupled nucleotide excision repair. Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292) EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: - |
| >sp|B6SFA4|MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O94387|YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.10c PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q86AS0|Y4399_DICDI Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9EPU0|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1382 | ||||||
| 359473525 | 2792 | PREDICTED: uncharacterized protein LOC10 | 0.643 | 0.318 | 0.575 | 0.0 | |
| 297738288 | 2562 | unnamed protein product [Vitis vinifera] | 0.610 | 0.329 | 0.557 | 0.0 | |
| 359473527 | 2788 | PREDICTED: uncharacterized protein LOC10 | 0.638 | 0.316 | 0.555 | 0.0 | |
| 255555527 | 2820 | conserved hypothetical protein [Ricinus | 0.642 | 0.314 | 0.546 | 0.0 | |
| 356510822 | 2812 | PREDICTED: uncharacterized protein LOC10 | 0.629 | 0.309 | 0.540 | 0.0 | |
| 297738290 | 6100 | unnamed protein product [Vitis vinifera] | 0.573 | 0.13 | 0.522 | 0.0 | |
| 449445385 | 2763 | PREDICTED: uncharacterized protein LOC10 | 0.605 | 0.302 | 0.516 | 0.0 | |
| 359473529 | 883 | PREDICTED: uncharacterized protein LOC10 | 0.628 | 0.983 | 0.508 | 0.0 | |
| 356577345 | 1636 | PREDICTED: uncharacterized protein LOC10 | 0.626 | 0.529 | 0.473 | 0.0 | |
| 147865014 | 2676 | hypothetical protein VITISV_037587 [Viti | 0.524 | 0.270 | 0.566 | 0.0 |
| >gi|359473525|ref|XP_003631315.1| PREDICTED: uncharacterized protein LOC100265010 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1042 bits (2695), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 527/915 (57%), Positives = 661/915 (72%), Gaps = 26/915 (2%)
Query: 2 MEGKGCSSSTKKAVGFTGHTV---FSWSLENIFNQSLFKDQVEKIPESFQSVKQYFGSFV 58
ME +G S+ K+A+ + FSWSLE+I N L+++QVE+IPE+F + YFGS++
Sbjct: 1 MEKEG--SNKKRAIAKDSRLIELLFSWSLEDISNNDLYRNQVERIPETFGTAGHYFGSYI 58
Query: 59 FPLLEETRMQLRSGLEAMRRAPYAEVIAFEELKPYGANRYGIEVDYWRNTICNSGKEPYK 118
FPLLEE R ++ S +E + AP+AEV +F+E KPYG+ Y ++VD WRN + G+EPYK
Sbjct: 59 FPLLEEIRAEMCSSMEDIHSAPFAEVTSFDESKPYGSLLYDVKVDNWRNRFSDHGREPYK 118
Query: 119 TLPGDILVLADFKPEKVSDLLRVGRMWTFVSVTMVPDDEVENKNKKKNYYEVKARNNLQV 178
TLPGDIL+L D KPE VSDL RVGR WTF SVT +PDDE E+ N Y++VK +V
Sbjct: 119 TLPGDILILTDAKPETVSDLQRVGRTWTFASVTRIPDDENED-NSSSTYFKVKISKEYEV 177
Query: 179 HDGTKKSFFFIYLTNILPSKRIWNSLHMCGNWKVITQVLGTDSVVEESCELCSLQRKGIW 238
D ++S F I+L NI+ +KRIWN+LHM GN +I++VL +DS+V+E+C C + G++
Sbjct: 178 DDEKQRSMFVIFLINIVTNKRIWNALHMSGNISIISEVLSSDSLVKENCCQCPVWSDGVY 237
Query: 239 DEKFGPSLSSTLNEPQVGAVFACLRRLDCDHKSGVELRWGPPGTGKTKTVSMLLFSLLRI 298
E F S SS LNE Q AV CLR++ C+HK VEL WGPPGTGKTKTVS+LLF LLR
Sbjct: 238 AENFPMSSSSNLNESQTKAVVTCLRKIQCNHKPSVELIWGPPGTGKTKTVSVLLFKLLRT 297
Query: 299 KCRTLACTPTNVAITELASRALRLVKESYKRDSRNNTPFCPLGDILLFGNKDRLKVNPGF 358
RTLAC PTNVA+TE+ASR L+L KES++ N+ FC LGDIL+FGNKDRLKV
Sbjct: 298 NIRTLACAPTNVAVTEVASRVLKLTKESFE-----NSLFCSLGDILIFGNKDRLKVGADI 352
Query: 359 EEIYLDYRVKRLMECFAPLSGWRHCFSSMIDLLEDCVSQYHIYVE-KLKEREDC-NENQS 416
E+YLDYRV RL+ECF PL+GWR+CF+SMID LEDCVS YHI++E +L++ + C NE S
Sbjct: 353 VEVYLDYRVDRLIECFGPLTGWRYCFNSMIDFLEDCVSHYHIFLENELRKEKSCSNEGGS 412
Query: 417 EEKKCRKETEGSKGEC-------KPFLEYVRESFNCAVIPLRNCIFIFCTHLPKTYISEN 469
+++ + E S EC K F+E+ R+ F PLR C+ IFCTHL K +I E
Sbjct: 413 TKEEVFMKNELSSNECGSSKKVDKSFIEFARDRFKATAGPLRRCVQIFCTHLSKDFILEQ 472
Query: 470 SFQDMVALKSLLDSFRSLLFQKNVVSEELEKLFSHSVDEDFSLAFVGKRYLLQLHQRRSE 529
+FQ+MV L LLDSF SLL + +VV EELEKLFSH S L L+ R E
Sbjct: 473 NFQNMVDLIRLLDSFESLLSKDDVVPEELEKLFSHQEAVQDSSPSFSDSSNL-LYMSRGE 531
Query: 530 CLSVLRNLWNSLDELNLPCTTSKQLLKDFCFKRASLFFSTASSSYKLHSVKIEPLNFLVI 589
CLSVL+ L SL++L+LP ++ L+K+FCFK ASL F TASSSYKLHS ++PL+ LVI
Sbjct: 532 CLSVLKILRGSLNKLSLPSGMNEGLIKEFCFKMASLIFCTASSSYKLHSANMKPLDLLVI 591
Query: 590 DEAAQLKESESTIPLQLAGINHAVLIGDECQLPAMVESKISDGASFGRSLFERLTLLNHS 649
DEAAQLKE ESTIPLQL GI HA+LIGDECQLPAMV SK+S A FGRSLFERL+ L H
Sbjct: 592 DEAAQLKECESTIPLQLPGIRHAILIGDECQLPAMVSSKVSKEAGFGRSLFERLSSLGHF 651
Query: 650 KHLLDIQYRMHPSISLFPNLQFYRNQILDGANVKSKSYEKHYLPGTEFGPYTFINIIGGR 709
KHLL++QYRMHPSIS FPN +FY NQILD NVKSKSY KHYL G FG Y+FIN+ G
Sbjct: 652 KHLLNVQYRMHPSISFFPNSKFYFNQILDAPNVKSKSYTKHYLSGPMFGSYSFINVRGKE 711
Query: 710 E-EFIYHSCRNMVEVSVVIKILQKLYKAWVGSKQMVSIGVVSPYTAQVVAIRKKIGSEYE 768
E + + S +NM+EV++VIKI++ LYK W GS Q +SIGV+SPY AQVVAI+ K+G +YE
Sbjct: 712 EHDDVGKSRKNMIEVAIVIKIVRNLYKEWSGSNQKLSIGVISPYAAQVVAIQDKLGQKYE 771
Query: 769 NKDGFTVKVKSVDGFQGGEEDIIIISTVRCNTGGSIGFISNPQRVNVALTRARHCLWILG 828
F+VKVK+VDGFQGGEEDIIII TVR NTGGSIGF+SNPQR NVALTRAR+CLWILG
Sbjct: 772 KLGNFSVKVKTVDGFQGGEEDIIIICTVRSNTGGSIGFLSNPQRTNVALTRARYCLWILG 831
Query: 829 NERTLISSESIWGTLVCDAKARQCFFKADEDRNLAKARLEVSKESVE----IDAESLTSR 884
NERTL +SESIW LV DAK R+CFF ADED+++A A LEV E + +D S+ +
Sbjct: 832 NERTLANSESIWEDLVLDAKKRKCFFNADEDKDIANAILEVKTEFDQLNHLLDGSSILFK 891
Query: 885 SQRGKLCYKPKYEKT 899
S K+ + ++K+
Sbjct: 892 SAMWKVLFSDNFKKS 906
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297738288|emb|CBI27489.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359473527|ref|XP_002263192.2| PREDICTED: uncharacterized protein LOC100243095 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255555527|ref|XP_002518800.1| conserved hypothetical protein [Ricinus communis] gi|223542181|gb|EEF43725.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356510822|ref|XP_003524133.1| PREDICTED: uncharacterized protein LOC100802419 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297738290|emb|CBI27491.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449445385|ref|XP_004140453.1| PREDICTED: uncharacterized protein LOC101214394 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359473529|ref|XP_003631316.1| PREDICTED: uncharacterized protein LOC100855072 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356577345|ref|XP_003556787.1| PREDICTED: uncharacterized protein LOC100781902 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147865014|emb|CAN78970.1| hypothetical protein VITISV_037587 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1382 | ||||||
| TAIR|locus:2018561 | 1050 | AT1G65810 [Arabidopsis thalian | 0.254 | 0.335 | 0.558 | 6.2e-157 | |
| TAIR|locus:2018536 | 1065 | AT1G65780 [Arabidopsis thalian | 0.617 | 0.800 | 0.391 | 8.3e-151 | |
| TAIR|locus:2166173 | 839 | AT5G37150 [Arabidopsis thalian | 0.259 | 0.426 | 0.505 | 1.2e-147 | |
| TAIR|locus:2166183 | 871 | AT5G37160 [Arabidopsis thalian | 0.240 | 0.382 | 0.525 | 4.7e-140 | |
| TAIR|locus:2173033 | 676 | AT5G52090 [Arabidopsis thalian | 0.287 | 0.587 | 0.471 | 2e-135 | |
| TAIR|locus:2166163 | 692 | AT5G37140 [Arabidopsis thalian | 0.255 | 0.510 | 0.497 | 1e-134 | |
| TAIR|locus:2152627 | 638 | AT5G37030 [Arabidopsis thalian | 0.220 | 0.478 | 0.542 | 5.4e-124 | |
| TAIR|locus:2135472 | 689 | AT4G05540 [Arabidopsis thalian | 0.452 | 0.907 | 0.422 | 4.4e-116 | |
| DICTYBASE|DDB_G0285243 | 2069 | DDB_G0285243 "putative splicin | 0.216 | 0.144 | 0.354 | 9.5e-48 | |
| TAIR|locus:2059088 | 1090 | AT2G19120 "AT2G19120" [Arabido | 0.209 | 0.265 | 0.398 | 9.6e-48 |
| TAIR|locus:2018561 AT1G65810 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 966 (345.1 bits), Expect = 6.2e-157, Sum P(3) = 6.2e-157
Identities = 201/360 (55%), Positives = 258/360 (71%)
Query: 526 RRSECLSVLRNLWNSLDELNLPCTTSKQLLKDFCFKRASLFFSTASSSYKLHSVKIEPLN 585
R +CL +L ++ S+ LP SK L+ C A L F TASSS +LH P+
Sbjct: 500 RTQDCLEMLTSISMSI---KLPDFISKFELQKLCLDNAYLLFCTASSSARLHMSS--PIQ 554
Query: 586 FLVIDEAAQLKESESTIPLQLAGINHAVLIGDECQLPAMVESKISDGASFGRSLFERLTL 645
LVIDEAAQLKE ES IPLQL G+ HA+LIGDE QLPAM++S I+ A GRSLFERL L
Sbjct: 555 LLVIDEAAQLKECESAIPLQLRGLQHAILIGDEKQLPAMIKSNIASEADLGRSLFERLVL 614
Query: 646 LNHSKHLLDIQYRMHPSISLFPNLQFYRNQILDGANVKSKSYEKHYLPGTEFGPYTFINI 705
L H+K LL++QYRMHPSIS+FPN +FY +ILD +V+ +SYEK +LP +GPY+FINI
Sbjct: 615 LGHNKQLLNMQYRMHPSISIFPNREFYDMKILDAPSVRLRSYEKKFLPEKMYGPYSFINI 674
Query: 706 IGGREEFIY-HSCRNMVEVSVVIKILQKLYKAWVGSKQMVSIGVVSPYTAQVVAIRKKIG 764
GRE+F +S +N+VEVSVV +I+ KLY + + +S+GV+SPY AQV AI+++IG
Sbjct: 675 AYGREQFGEGYSSKNLVEVSVVAEIVSKLYSVSRKTGRTISVGVISPYKAQVFAIQERIG 734
Query: 765 SEYENKDGFTVKVKSVDGFQGGEEDIIIISTVRCNTGGSIGFISNPQRVNVALTRARHCL 824
+Y + FTV V+SVDGFQGGEEDIIIISTVR N G+IGF+SN QR NVALTRAR+CL
Sbjct: 735 EKYNTEGTFTVSVRSVDGFQGGEEDIIIISTVRSNGNGAIGFLSNQQRTNVALTRARYCL 794
Query: 825 WILGNERTLISSESIWGTLVCDAKARQCFFKADEDRNLAKARLEVSKESVEIDAESLTSR 884
WILGNE TL ++ S+W LV DAKAR CF A+ED +LA+ +E S +++ D L ++
Sbjct: 795 WILGNEATLTNNRSVWRQLVDDAKARNCFHNAEEDESLAQC-IERSTTALD-DLNKLQNK 852
|
|
| TAIR|locus:2018536 AT1G65780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166173 AT5G37150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166183 AT5G37160 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173033 AT5G52090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166163 AT5G37140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152627 AT5G37030 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135472 AT4G05540 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0285243 DDB_G0285243 "putative splicing endonuclease" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2059088 AT2G19120 "AT2G19120" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.6.4 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00021285001 | SubName- Full=Chromosome chr1 scaffold_22, whole genome shotgun sequence; Flags- Fragment; (1776 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1382 | |||
| pfam13087 | 195 | pfam13087, AAA_12, AAA domain | 4e-71 | |
| COG1112 | 767 | COG1112, COG1112, Superfamily I DNA and RNA helica | 5e-41 | |
| TIGR00376 | 637 | TIGR00376, TIGR00376, DNA helicase, putative | 2e-40 | |
| pfam13086 | 220 | pfam13086, AAA_11, AAA domain | 1e-14 | |
| pfam13086 | 220 | pfam13086, AAA_11, AAA domain | 3e-13 | |
| pfam13245 | 73 | pfam13245, AAA_19, Part of AAA domain | 2e-04 | |
| TIGR00376 | 637 | TIGR00376, TIGR00376, DNA helicase, putative | 0.001 |
| >gnl|CDD|221913 pfam13087, AAA_12, AAA domain | Back alignment and domain information |
|---|
Score = 235 bits (602), Expect = 4e-71
Identities = 81/197 (41%), Positives = 117/197 (59%), Gaps = 6/197 (3%)
Query: 635 FGRSLFERL-TLLNHSKHLLDIQYRMHPSISLFPNLQFYRNQILDGANVKSKSYEKHYLP 693
RSLFERL + +LD QYRMHP IS FP+ FY ++ DG +V + +
Sbjct: 1 LDRSLFERLQEAGPEAVVMLDTQYRMHPDISEFPSELFYGGKLKDGESVAERPLPWDFHL 60
Query: 694 GTEFGPYTFINIIGGREEF-IYHSCRNMVEVSVVIKILQKLYKAWVGSKQMVSIGVVSPY 752
GP FI++ G EE S N E +V+++++KL K+ + IG+++PY
Sbjct: 61 PDPLGPLVFIDVDGSEEEEEKSTSYSNEAEAELVVQLVEKLLKSGPEKNK--DIGIITPY 118
Query: 753 TAQVVAIRKKIGSEYENKDGFTVKVKSVDGFQGGEEDIIIISTVRCNTGGSIGFISNPQR 812
AQV I+K + ++ ++V +VDGFQG E+D+II STVR N G IGF+S+P+R
Sbjct: 119 RAQVRLIKKLLKRKF--GGEPDIEVNTVDGFQGREKDVIIFSTVRSNEKGGIGFLSDPRR 176
Query: 813 VNVALTRARHCLWILGN 829
+NVALTRA+ L I+GN
Sbjct: 177 LNVALTRAKRGLIIVGN 193
|
This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins. Length = 195 |
| >gnl|CDD|224037 COG1112, COG1112, Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|221912 pfam13086, AAA_11, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221912 pfam13086, AAA_11, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|222005 pfam13245, AAA_19, Part of AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1382 | |||
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 100.0 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 100.0 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 100.0 | |
| KOG1801 | 827 | consensus tRNA-splicing endonuclease positive effe | 100.0 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 100.0 | |
| KOG1807 | 1025 | consensus Helicases [Replication, recombination an | 100.0 | |
| COG1112 | 767 | Superfamily I DNA and RNA helicases and helicase s | 100.0 | |
| PF13087 | 200 | AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP | 100.0 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 99.98 | |
| KOG1806 | 1320 | consensus DEAD box containing helicases [Replicati | 99.96 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 99.96 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 99.95 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 99.91 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 99.91 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 99.91 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 99.9 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 99.89 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 99.88 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 99.87 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 99.86 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 99.82 | |
| PRK13909 | 910 | putative recombination protein RecB; Provisional | 99.81 | |
| TIGR00609 | 1087 | recB exodeoxyribonuclease V, beta subunit. All pro | 99.81 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 99.78 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 99.78 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 99.78 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 99.77 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 99.76 | |
| PRK10876 | 1181 | recB exonuclease V subunit beta; Provisional | 99.76 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 99.74 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 99.69 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 99.64 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 99.59 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 99.56 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 99.53 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 99.51 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 99.41 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 99.23 | |
| COG0507 | 696 | RecD ATP-dependent exoDNAse (exonuclease V), alpha | 99.07 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 99.06 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 99.05 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 99.03 | |
| COG3972 | 660 | Superfamily I DNA and RNA helicases [General funct | 98.62 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 98.59 | |
| TIGR02773 | 1158 | addB_Gpos ATP-dependent nuclease subunit B. DNA re | 98.54 | |
| PF13361 | 351 | UvrD_C: UvrD-like helicase C-terminal domain; PDB: | 98.46 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 98.4 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 98.04 | |
| PF13538 | 104 | UvrD_C_2: UvrD-like helicase C-terminal domain; PD | 97.99 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 97.93 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 97.92 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 97.72 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 97.65 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 97.64 | |
| KOG2108 | 853 | consensus 3'-5' DNA helicase [Replication, recombi | 97.53 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 97.36 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 97.34 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.17 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.13 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 97.1 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 97.09 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 97.03 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 96.98 | |
| PRK08181 | 269 | transposase; Validated | 96.98 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 96.94 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.91 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.91 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 96.9 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 96.85 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.84 | |
| PRK06526 | 254 | transposase; Provisional | 96.79 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 96.74 | |
| PRK08116 | 268 | hypothetical protein; Validated | 96.72 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 96.69 | |
| PTZ00424 | 401 | helicase 45; Provisional | 96.69 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 96.63 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 96.61 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 96.61 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 96.57 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 96.57 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 96.51 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 96.49 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.48 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 96.44 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 96.44 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.44 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.42 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 96.41 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 96.4 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.38 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.38 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 96.38 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 96.37 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 96.34 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 96.33 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 96.29 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 96.28 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 96.27 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 96.25 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 96.23 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 96.23 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 96.22 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 96.2 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 96.2 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 96.19 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 96.17 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 96.15 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 96.15 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 96.14 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 96.11 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 96.1 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 96.07 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 96.06 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 96.06 | |
| KOG1920 | 1265 | consensus IkappaB kinase complex, IKAP component [ | 96.05 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 96.04 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 96.03 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 96.01 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 95.97 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 95.96 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 95.96 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 95.95 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 95.92 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 95.91 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 95.89 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 95.89 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 95.86 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 95.86 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 95.86 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 95.85 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 95.84 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 95.81 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 95.78 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 95.77 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 95.77 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 95.76 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 95.75 | |
| PRK08727 | 233 | hypothetical protein; Validated | 95.75 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 95.74 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 95.73 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 95.73 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 95.72 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 95.71 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 95.66 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 95.65 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 95.62 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 95.61 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 95.59 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 95.58 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 95.58 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 95.58 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 95.58 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 95.57 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 95.56 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 95.55 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 95.55 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 95.54 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 95.53 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 95.47 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 95.46 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 95.45 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 95.43 | |
| KOG2108 | 853 | consensus 3'-5' DNA helicase [Replication, recombi | 95.43 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 95.42 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 95.42 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 95.37 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 95.36 | |
| PF13173 | 128 | AAA_14: AAA domain | 95.36 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 95.35 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 95.35 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 95.33 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 95.29 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 95.27 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 95.26 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 95.25 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 95.24 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 95.22 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 95.22 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 95.21 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 95.21 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 95.21 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 95.2 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 95.2 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 95.18 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 95.17 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 95.15 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 95.15 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 95.15 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 95.15 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 95.15 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 95.14 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 95.12 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 95.08 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 95.05 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 95.05 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 95.05 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 95.03 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 95.03 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 95.02 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 95.01 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 94.99 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 94.99 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 94.98 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 94.98 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 94.96 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 94.94 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 94.93 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 94.92 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 94.92 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.92 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 94.9 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 94.83 | |
| PF05729 | 166 | NACHT: NACHT domain | 94.82 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 94.8 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 94.79 | |
| PRK13768 | 253 | GTPase; Provisional | 94.78 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 94.77 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 94.76 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 94.76 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 94.74 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 94.74 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 94.72 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 94.72 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.71 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 94.68 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 94.65 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 94.65 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 94.61 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 94.61 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 94.59 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 94.55 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 94.52 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 94.52 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 94.49 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 94.48 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 94.46 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 94.46 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 94.46 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 94.45 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 94.45 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 94.45 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 94.41 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 94.41 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 94.41 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 94.39 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 94.39 | |
| PRK06696 | 223 | uridine kinase; Validated | 94.38 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 94.35 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 94.33 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 94.29 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.28 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 94.22 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 94.21 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 94.21 | |
| PTZ00110 | 545 | helicase; Provisional | 94.18 | |
| PRK06620 | 214 | hypothetical protein; Validated | 94.18 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 94.18 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 94.18 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 94.16 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 94.15 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 94.13 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 94.11 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 94.09 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 94.08 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 94.08 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 94.06 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 94.06 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 94.0 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 94.0 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 94.0 | |
| PHA02244 | 383 | ATPase-like protein | 94.0 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 93.98 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 93.97 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 93.96 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 93.92 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 93.89 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 93.86 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 93.85 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 93.84 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 93.8 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 93.77 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 93.77 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 93.73 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 93.7 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 93.69 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 93.67 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 93.63 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 93.62 | |
| PRK13764 | 602 | ATPase; Provisional | 93.57 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 93.53 | |
| PRK07667 | 193 | uridine kinase; Provisional | 93.52 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 93.5 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 93.47 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 93.46 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 93.4 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 93.39 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 93.38 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 93.36 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 93.35 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 93.33 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 93.29 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 93.26 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 93.23 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 93.22 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 93.19 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 93.19 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 93.18 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 93.17 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 93.14 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 93.1 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 93.05 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 93.05 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 93.04 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 93.0 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 92.99 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 92.96 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 92.95 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 92.93 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 92.92 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 92.92 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 92.9 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 92.9 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 92.84 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 92.83 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 92.82 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 92.82 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 92.81 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 92.81 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 92.79 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 92.78 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 92.74 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 92.73 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 92.7 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 92.61 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 92.55 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 92.54 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 92.51 | |
| PF05127 | 177 | Helicase_RecD: Helicase; InterPro: IPR007807 This | 92.49 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 92.47 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 92.47 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 92.47 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 92.45 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 92.44 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 92.41 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 92.37 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 92.34 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 92.33 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 92.33 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 92.3 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 92.29 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 92.28 | |
| PHA02624 | 647 | large T antigen; Provisional | 92.27 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 92.26 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 92.25 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 92.23 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 92.22 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 92.19 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 92.15 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 92.15 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 92.11 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 92.11 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 92.09 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 92.07 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 92.06 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 92.04 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 92.04 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 92.02 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 92.0 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 91.98 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 91.97 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 91.87 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 91.85 | |
| KOG0990 | 360 | consensus Replication factor C, subunit RFC5 [Repl | 91.84 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 91.83 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 91.79 | |
| cd00550 | 254 | ArsA_ATPase Oxyanion-translocating ATPase (ArsA). | 91.78 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 91.77 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 91.75 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 91.73 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 91.73 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 91.72 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 91.69 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 91.67 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 91.65 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 91.65 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 91.64 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 91.61 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 91.59 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 91.59 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 91.57 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 91.56 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 91.54 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 91.52 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 91.52 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 91.51 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 91.47 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 91.46 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 91.45 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 91.45 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 91.42 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 91.42 | |
| PRK03839 | 180 | putative kinase; Provisional | 91.41 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 91.38 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 91.37 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 91.35 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 91.32 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 91.29 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 91.29 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 91.28 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 91.27 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 91.22 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 91.2 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 91.18 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 91.17 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 91.13 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 91.13 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 91.12 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 91.11 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 91.1 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 91.1 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 91.08 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 91.08 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 91.04 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 91.03 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 91.01 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 91.01 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 91.0 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 90.99 | |
| cd02035 | 217 | ArsA ArsA ATPase functionas as an efflux pump loca | 90.98 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 90.96 | |
| COG1702 | 348 | PhoH Phosphate starvation-inducible protein PhoH, | 90.92 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 90.92 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 90.91 | |
| PRK14494 | 229 | putative molybdopterin-guanine dinucleotide biosyn | 90.9 | |
| PRK09087 | 226 | hypothetical protein; Validated | 90.9 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 90.88 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 90.88 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 90.86 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 90.83 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 90.8 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 90.78 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 90.74 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 90.71 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 90.69 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 90.69 | |
| PLN02200 | 234 | adenylate kinase family protein | 90.69 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 90.63 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 90.63 | |
| PF13479 | 213 | AAA_24: AAA domain | 90.63 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 90.6 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 90.5 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 90.49 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 90.48 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 90.46 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 90.45 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 90.45 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 90.45 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 90.45 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 90.44 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 90.43 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 90.4 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 90.39 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 90.34 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 90.29 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 90.24 | |
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 90.19 | |
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 90.19 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 90.14 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 90.1 | |
| COG3911 | 183 | Predicted ATPase [General function prediction only | 90.09 | |
| TIGR02774 | 1076 | rexB_recomb ATP-dependent nuclease subunit B. DNA | 90.02 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 89.99 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 89.94 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 89.9 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 89.9 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 89.89 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 89.86 | |
| TIGR03029 | 274 | EpsG chain length determinant protein tyrosine kin | 89.84 | |
| PRK10646 | 153 | ADP-binding protein; Provisional | 89.82 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 89.73 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 89.72 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 89.66 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 89.66 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 89.66 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 89.64 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 89.58 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 89.57 | |
| PTZ00202 | 550 | tuzin; Provisional | 89.56 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 89.48 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 89.48 | |
| cd02037 | 169 | MRP-like MRP (Multiple Resistance and pH adaptatio | 89.47 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 89.45 | |
| cd02040 | 270 | NifH NifH gene encodes component II (iron protein) | 89.41 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 89.33 | |
| KOG4284 | 980 | consensus DEAD box protein [Transcription] | 89.3 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 89.26 | |
| PF10412 | 386 | TrwB_AAD_bind: Type IV secretion-system coupling p | 89.25 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 89.22 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 89.2 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 89.2 |
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5e-77 Score=693.08 Aligned_cols=600 Identities=26% Similarity=0.328 Sum_probs=441.2
Q ss_pred ccccccccCChHHHHhhchhhHHHHHHHHHHHhhhccCCCCceEEEeeeec-CCCCCceEEEEEeeecccccCCCCCCCC
Q 048652 40 VEKIPESFQSVKQYFGSFVFPLLEETRMQLRSGLEAMRRAPYAEVIAFEEL-KPYGANRYGIEVDYWRNTICNSGKEPYK 118 (1382)
Q Consensus 40 v~~IP~tF~S~~~Y~~sF~ppLlEEtra~l~Ssle~is~ap~~~i~~ve~~-~~~~~~~y~i~v~~~~~~~~~~~~e~y~ 118 (1382)
...+-.+|.+..+|-++|-|++-.|+..+ ..+.+....+.+.++=. +-++...-.+.+...++ ..+
T Consensus 229 ~~hv~~ry~da~~y~~vf~pliklea~yd-----k~~Kes~~q~~~tvRW~~gLnkk~~a~f~~~k~~~--------e~k 295 (935)
T KOG1802|consen 229 PPHVQLRYEDAYEYQNVFSPLIKLEADYD-----KRLKESQTQENGTVRWDIGLNKKRLAYFTLPKLDS--------ELK 295 (935)
T ss_pred CCcccccccchHHHhhhcchhhhhhhhhh-----hhhhhhcccccceEEeeeccccceEEEEecCCCcc--------hhc
Confidence 55677899999999999999999999887 23333333343444422 22222223333333222 256
Q ss_pred CCCCCEEEeeccCCCCcccccccCceEEEEEEEeecCCcccccccccceEEEEecCCccccCCCCceEEEEEEeccchhH
Q 048652 119 TLPGDILVLADFKPEKVSDLLRVGRMWTFVSVTMVPDDEVENKNKKKNYYEVKARNNLQVHDGTKKSFFFIYLTNILPSK 198 (1382)
Q Consensus 119 ~~~GDIv~Ls~~kP~~~sdl~~~~~~~~~a~V~~v~~~~~~~~~~~~~~~~v~~s~~i~~~~~~~~~~~~v~L~n~~T~~ 198 (1382)
.-.||-+.|+...-.. +. --.+|+|.++.+...+ ...+.+..+.+ ........+.+-|+.|-+++.
T Consensus 296 l~~GdE~~L~y~~~~~---~~----w~~~g~v~~~pd~~~d-----E~~lEl~~~~~--~p~e~~~~Ftvd~vwk~ts~d 361 (935)
T KOG1802|consen 296 LAIGDEIRLTYSGGLV---LP----WNGIGSVLKIPDNNGD-----EVKLELEFSQD--PPIEVTHGFTVDFVWKSTSFD 361 (935)
T ss_pred cccCCeeEEEecCCcC---Cc----ccccceEEecCCCCcc-----eeEEEeecCCC--CCcccccceEEEEEEcCccHH
Confidence 7799999998542211 11 1247888888775422 12344444443 223344566799999999999
Q ss_pred HHHHHHhccCC------chhhhhhcC-CCccchhhhhhhccccCCCCccccCCCCCCCCCHHHHHHHHHHHhhcccCCCC
Q 048652 199 RIWNSLHMCGN------WKVITQVLG-TDSVVEESCELCSLQRKGIWDEKFGPSLSSTLNEPQVGAVFACLRRLDCDHKS 271 (1382)
Q Consensus 199 R~~~aL~~~~~------~~li~~iL~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LN~sQ~~AV~~~l~~~~~~~~~ 271 (1382)
||..||..+.. .-+...+|. +.......+. .+..+......+||.||..||...|+ .
T Consensus 362 rm~~alk~la~D~~~vs~y~y~klLgh~~~~~~~k~~---------LP~~~s~~~lpkLN~SQ~~AV~~VL~-------r 425 (935)
T KOG1802|consen 362 RMQLALKLLAVDEKKVSGYLYHKLLGHPVEDSSLKKL---------LPRRFSVPNLPKLNASQSNAVKHVLQ-------R 425 (935)
T ss_pred HHHHHHHHhhhccccchhhhhhHHhcCcchhhhhccc---------CchhhcCCCchhhchHHHHHHHHHHc-------C
Confidence 99999987221 112223333 2222111111 12234445677999999999999998 6
Q ss_pred CeEEEEcCCCCchHHHHHHHHHHHHHc-CCceEEecCChHHHHHHHHHHHHHhhhhhcCCCCccccccCCcceEEeccCC
Q 048652 272 GVELRWGPPGTGKTKTVSMLLFSLLRI-KCRTLACTPTNVAITELASRALRLVKESYKRDSRNNTPFCPLGDILLFGNKD 350 (1382)
Q Consensus 272 ~~~LI~GPPGTGKTttI~~li~~Ll~~-~~RILVcAPTN~AVDeVa~RL~~l~~es~~~~~~~~~~~~~lgdIVr~Gn~~ 350 (1382)
+++|||||||||||.|.++++.+|+++ ..+||||||||.|||++++++.+... .|||+-.++
T Consensus 426 plsLIQGPPGTGKTvtsa~IVyhl~~~~~~~VLvcApSNiAVDqLaeKIh~tgL-----------------KVvRl~aks 488 (935)
T KOG1802|consen 426 PLSLIQGPPGTGKTVTSATIVYHLARQHAGPVLVCAPSNIAVDQLAEKIHKTGL-----------------KVVRLCAKS 488 (935)
T ss_pred CceeeecCCCCCceehhHHHHHHHHHhcCCceEEEcccchhHHHHHHHHHhcCc-----------------eEeeeehhh
Confidence 999999999999999999999999987 67999999999999999999998543 388888877
Q ss_pred CCCcCchhhhhcHHHHHHHHhhhccCCcccchhhhhhhHHHhhHHHHHHHHHHHHhhhhccccchhHHHHHhhhhccCcC
Q 048652 351 RLKVNPGFEEIYLDYRVKRLMECFAPLSGWRHCFSSMIDLLEDCVSQYHIYVEKLKEREDCNENQSEEKKCRKETEGSKG 430 (1382)
Q Consensus 351 rm~I~~~L~~v~Ld~Rv~~L~~~f~~~tgW~~~l~s~i~~Le~~~~~y~~~l~~~k~~~~~~~~~~~~~~i~~~~~~~kk 430 (1382)
|-.+..++.-..|.+.++++.. | + ++
T Consensus 489 RE~~~S~vs~L~lh~~~~~~~~---p--------------------E----Lq--------------------------- 514 (935)
T KOG1802|consen 489 REDIESDVSFLSLHEQLRNMDK---P--------------------E----LQ--------------------------- 514 (935)
T ss_pred hhhccCCccHHHHHHHHhccCc---H--------------------H----HH---------------------------
Confidence 7655444444444443333111 0 0 00
Q ss_pred CCCchhHHHHhhhhhhhhhHHhhHHHhhcCCCccccchhhHHhHHHHHHHHHHHHHHHhccCCCHHHHHHHhccccccch
Q 048652 431 ECKPFLEYVRESFNCAVIPLRNCIFIFCTHLPKTYISENSFQDMVALKSLLDSFRSLLFQKNVVSEELEKLFSHSVDEDF 510 (1382)
Q Consensus 431 ~~~sf~eflk~r~~~l~~~L~~~~~~l~~~lP~s~i~~~~~~~m~~~~~lL~~l~~lL~~~~l~~eel~~~~~~~~~~~~ 510 (1382)
+ +++ +.+...+...
T Consensus 515 ----------------------------------------------------~---l~k-----------lkde~gelS~ 528 (935)
T KOG1802|consen 515 ----------------------------------------------------K---LLK-----------LKDEGGELSS 528 (935)
T ss_pred ----------------------------------------------------H---HHh-----------hhhhcccccc
Confidence 0 000 0000000000
Q ss_pred hhhhhhhHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCcchhhHHHHHHhcCCcEEEEccccccccccccCCCccEEEec
Q 048652 511 SLAFVGKRYLLQLHQRRSECLSVLRNLWNSLDELNLPCTTSKQLLKDFCFKRASLFFSTASSSYKLHSVKIEPLNFLVID 590 (1382)
Q Consensus 511 ~~~~~~~~~~~~l~~~R~~~~~~L~~L~~~l~~~~lp~~~~~~~i~~~iL~~a~VI~~T~sss~~l~~~~~~~fd~VIID 590 (1382)
+ ...| +. ...+.....++..|+||||||.+++.... ....|..|+||
T Consensus 529 s------------D~~k------~~--------------~lk~~~e~ell~~AdVIccTcv~Agd~rl-~~~kfr~VLiD 575 (935)
T KOG1802|consen 529 S------------DEKK------YR--------------KLKRAAEKELLNQADVICCTCVGAGDRRL-SKFKFRTVLID 575 (935)
T ss_pred h------------hhHH------HH--------------HHHHHHHHHHHhhcCEEEEecccccchhh-ccccccEEEEe
Confidence 0 0000 00 01233455689999999999999986333 33689999999
Q ss_pred ccccCChHHHHHHHHhcCCCeEEEEecCCCCCccccccccccCCccccHHHHHHhcCCCceecccccCCCcccccccccc
Q 048652 591 EAAQLKESESTIPLQLAGINHAVLIGDECQLPAMVESKISDGASFGRSLFERLTLLNHSKHLLDIQYRMHPSISLFPNLQ 670 (1382)
Q Consensus 591 EAsQ~~E~e~lipL~l~~~krlVLVGD~~QLpP~V~s~~a~~~g~~~SLFeRL~~~~~~~~~L~~QYRmhp~I~~f~n~~ 670 (1382)
||.|++||+++||+.+ +++++||||||+||.|++.-+.+..+||.+|||+||+..|...++|.+||||||.|++||++.
T Consensus 576 EaTQatEpe~LiPlvl-G~kq~VlVGDh~QLgpvi~~kK~a~Agl~qsLferli~lg~~P~~L~vQYRmhP~lSefpsn~ 654 (935)
T KOG1802|consen 576 EATQATEPECLIPLVL-GAKQLVLVGDHKQLGPVIMCKKAATAGLSQSLFERLISLGIKPIRLQVQYRMHPALSEFPSNM 654 (935)
T ss_pred cccccCCcchhhhhhh-cceeEEEeccccccCceeeeHHHHHhHHHHHHHHHHHhccCCceEEEEeeeeChhhhhcchhh
Confidence 9999999999999987 899999999999999999999899999999999999999999999999999999999999999
Q ss_pred ccccccccCcccccccccccCCCCCC-CCCeEEEEecCCcccc--cccCCCCHHHHHHHHHHHHHHHHhhcCCCCCceEE
Q 048652 671 FYRNQILDGANVKSKSYEKHYLPGTE-FGPYTFINIIGGREEF--IYHSCRNMVEVSVVIKILQKLYKAWVGSKQMVSIG 747 (1382)
Q Consensus 671 FY~g~L~~~~~v~~~~~~~~~l~~~~-~~p~~fidv~~g~e~~--~~~S~~N~~Ea~~V~~lV~~L~~~~~~~~~~~~Ig 747 (1382)
||+|.|.++.....+......+|-+. ..|+.|... .|.|+. .|+|+.|..||..+.++|+.|++.+..+. .||
T Consensus 655 fY~G~LqnGVT~~~R~~~g~~~pwp~p~~pl~fy~~-~g~eeisasGtSf~Nr~Ea~~~ekii~~l~~~gv~~~---qIG 730 (935)
T KOG1802|consen 655 FYEGELQNGVTEIERSPLGVDFPWPQPDKPLFFYVC-YGQEEISASGTSFLNRTEAANCEKIITKLLKSGVKPS---QIG 730 (935)
T ss_pred hccchhhcCcchhhhccCCCCCCCCCCCCccceEEe-ccceeeeccccceecHHHHHHHHHHHHHHHHcCCCHH---Hee
Confidence 99999999977666554332222221 347777776 666655 78999999999999999999999987654 799
Q ss_pred EEeccHHHHHHHHHHHhhhhcC--CCCCcEEEecccCCCCccccEEEEeecccCCCCCcccccCCCcceeecccccceEE
Q 048652 748 VVSPYTAQVVAIRKKIGSEYEN--KDGFTVKVKSVDGFQGGEEDIIIISTVRCNTGGSIGFISNPQRVNVALTRARHCLW 825 (1382)
Q Consensus 748 VITPY~aQv~~I~~~L~~~~~~--~~~~~v~V~TVD~fQG~E~DiVIlS~Vrsn~~~~iGFl~d~rRLNVAlTRAK~~L~ 825 (1382)
|||||.+|...|-..+...... .--..|+|.|||+|||+|+|+||+||||+|....+||+.|+||||||+||||++|+
T Consensus 731 VITpYegQr~~i~~ym~~~gsl~~~ly~~veVasVDaFQGrEKdfIIlSCVRsn~~qgIGFl~d~RRlNVaLTRaK~glv 810 (935)
T KOG1802|consen 731 VITPYEGQRSYIVNYMQTNGSLHKDLYKEVEVASVDAFQGREKDFIILSCVRSNEHQGIGFLNDPRRLNVALTRAKYGLV 810 (935)
T ss_pred eecccchhHHHHHHHHHhcCccccchhheeEEEeeccccCcccceEEEEEeecccccccccccCchhhhhhhhhcccceE
Confidence 9999999999999888654321 11246799999999999999999999999999999999999999999999999999
Q ss_pred EEechhhhhcCccHHHHHHHHHHhcCceecccc
Q 048652 826 ILGNERTLISSESIWGTLVCDAKARQCFFKADE 858 (1382)
Q Consensus 826 IVGn~~~L~~s~~~W~~li~~~~~r~~~~~~~~ 858 (1382)
||||...|.+ .++|..+|.++++++|++.++-
T Consensus 811 ivGN~~~L~k-~~LW~~li~h~~eke~l~eg~l 842 (935)
T KOG1802|consen 811 IVGNPKVLRK-HPLWGHLITHYKEKEVLVEGPL 842 (935)
T ss_pred EecCHHHhhh-chHHHHHHHHhhcccceeecch
Confidence 9999999998 5999999999999999998643
|
|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1807 consensus Helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13087 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A 2XZL_A | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PRK13909 putative recombination protein RecB; Provisional | Back alignment and domain information |
|---|
| >TIGR00609 recB exodeoxyribonuclease V, beta subunit | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >PRK10876 recB exonuclease V subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >COG3972 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02773 addB_Gpos ATP-dependent nuclease subunit B | Back alignment and domain information |
|---|
| >PF13361 UvrD_C: UvrD-like helicase C-terminal domain; PDB: 1UAA_B 3U4Q_A 3U44_A 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF13538 UvrD_C_2: UvrD-like helicase C-terminal domain; PDB: 1W36_G 3K70_G 3DMN_A 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3911 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02774 rexB_recomb ATP-dependent nuclease subunit B | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG | Back alignment and domain information |
|---|
| >PRK10646 ADP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >KOG4284 consensus DEAD box protein [Transcription] | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1382 | ||||
| 2xzl_A | 802 | Upf1-Rna Complex Length = 802 | 5e-37 | ||
| 2wjv_A | 800 | Crystal Structure Of The Complex Between Human Nons | 7e-36 | ||
| 2gjk_A | 624 | Structural And Functional Insights Into The Human U | 9e-36 | ||
| 2xzo_A | 623 | Upf1 Helicase - Rna Complex Length = 623 | 1e-35 | ||
| 4b3f_X | 646 | Crystal Structure Of 1ghmbp2 Helicase Length = 646 | 4e-24 | ||
| 4b3g_A | 646 | Crystal Structure Of Ighmbp2 Helicase In Complex Wi | 4e-24 |
| >pdb|2XZL|A Chain A, Upf1-Rna Complex Length = 802 | Back alignment and structure |
|
| >pdb|2WJV|A Chain A, Crystal Structure Of The Complex Between Human Nonsense Mediated Decay Factors Upf1 And Upf2 Length = 800 | Back alignment and structure |
| >pdb|2GJK|A Chain A, Structural And Functional Insights Into The Human Upf1 Helicase Core Length = 624 | Back alignment and structure |
| >pdb|2XZO|A Chain A, Upf1 Helicase - Rna Complex Length = 623 | Back alignment and structure |
| >pdb|4B3F|X Chain X, Crystal Structure Of 1ghmbp2 Helicase Length = 646 | Back alignment and structure |
| >pdb|4B3G|A Chain A, Crystal Structure Of Ighmbp2 Helicase In Complex With Rna Length = 646 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
Score = 331 bits (850), Expect = 1e-97
Identities = 106/387 (27%), Positives = 173/387 (44%), Gaps = 23/387 (5%)
Query: 477 LKSLLDSFRSLLFQKNVVSEELEKLFSHSVDEDFSLAFVGKRYLLQLHQRRSECLSVLRN 536
L R + V + L H++ + K L L + + E + +
Sbjct: 425 RDLGLKVVRLTAKSREDVESSVSNLALHNLVGRGA-----KGELKNLLKLKDEVGELSAS 479
Query: 537 LWNSLDELNLPCTTSKQLLKDFCFKRASLFFSTASSSYKLHSVKIEPLNFLVIDEAAQLK 596
+L + + +A + T + ++IDE+ Q
Sbjct: 480 DTKRFVKL-------VRKTEAEILNKADVVCCTCVGAG--DKRLDTKFRTVLIDESTQAS 530
Query: 597 ESESTIPLQLAGINHAVLIGDECQLPAMVESKISDGASFGRSLFERLTLLNHSKHLLDIQ 656
E E IP+ + G +L+GD QL ++ + + A +SLFERL L H L++Q
Sbjct: 531 EPECLIPI-VKGAKQVILVGDHQQLGPVILERKAADAGLKQSLFERLISLGHVPIRLEVQ 589
Query: 657 YRMHPSISLFPNLQFYRNQILDGANVKSKSYEKHYLPGTEFGPYTFINIIGGREEFIY-- 714
YRM+P +S FP+ FY + +G ++ ++ P G GREE
Sbjct: 590 YRMNPYLSEFPSNMFYEGSLQNGVTIEQRTVPNSKFPWPIRGIPMMFWANYGREEISANG 649
Query: 715 HSCRNMVEVSVVIKILQKLYKAWVGSKQMVSIGVVSPYTAQVVAIRKKIG--SEYENKDG 772
S N +E +I+ KL++ V +Q IGV++PY Q I + + +
Sbjct: 650 TSFLNRIEAMNCERIITKLFRDGVKPEQ---IGVITPYEGQRAYILQYMQMNGSLDKDLY 706
Query: 773 FTVKVKSVDGFQGGEEDIIIISTVRCNTGGSIGFISNPQRVNVALTRARHCLWILGNERT 832
V+V SVD FQG E+D II+S VR N +IGF+ +P+R+NV LTRA++ L ILGN R+
Sbjct: 707 IKVEVASVDAFQGREKDYIILSCVRANEQQAIGFLRDPRRLNVGLTRAKYGLVILGNPRS 766
Query: 833 LISSESIWGTLVCDAKARQCFFKADED 859
L + ++W L+ + + C + D
Sbjct: 767 L-ARNTLWNHLLIHFREKGCLVEGTLD 792
|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Length = 446 | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Length = 574 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1382 | |||
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 100.0 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 100.0 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 100.0 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 100.0 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 99.94 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 99.94 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 99.92 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 99.92 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 99.91 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 99.88 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 99.84 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 99.82 | |
| 1w36_B | 1180 | RECB, exodeoxyribonuclease V beta chain; recombina | 99.69 | |
| 3dmn_A | 174 | Putative DNA helicase; APC89291.2, lactobacillus p | 99.36 | |
| 3u4q_B | 1166 | ATP-dependent helicase/deoxyribonuclease subunit; | 99.11 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 97.69 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 97.66 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 97.57 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 97.5 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 97.47 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 97.47 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 97.46 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 97.41 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 97.38 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 97.38 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 97.35 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 97.35 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 97.31 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 97.28 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 97.26 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 97.22 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 97.21 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 97.21 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 97.17 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 97.17 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 97.16 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 97.12 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.06 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 97.06 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 97.04 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 96.98 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 96.97 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 96.96 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 96.94 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 96.93 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 96.92 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 96.9 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 96.9 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 96.9 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 96.89 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 96.88 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 96.83 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 96.82 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 96.81 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 96.8 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 96.77 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 96.71 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 96.71 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 96.7 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 96.67 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 96.66 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 96.65 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 96.6 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.58 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 96.53 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 96.49 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 96.47 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 96.44 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 96.43 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 96.42 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 96.42 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 96.42 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 96.4 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 96.38 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 96.33 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 96.31 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 96.31 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 96.27 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 96.27 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 96.26 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 96.19 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 96.13 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 96.11 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 96.07 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 96.05 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 96.03 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 95.98 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 95.98 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 95.94 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 95.9 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 95.9 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 95.89 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 95.88 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 95.84 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 95.83 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 95.81 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 95.79 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 95.78 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 95.75 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 95.74 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 95.73 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 95.71 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 95.71 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 95.7 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 95.69 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 95.67 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 95.67 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 95.66 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 95.64 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 95.62 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 95.62 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 95.58 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 95.49 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 95.46 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 95.46 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 95.45 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 95.44 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 95.43 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 95.42 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 95.37 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 95.37 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 95.36 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 95.35 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 95.31 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 95.3 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 95.29 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 95.27 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 95.27 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 95.27 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 95.14 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 95.05 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 95.02 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 94.92 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 94.9 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 94.9 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 94.87 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 94.86 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 94.84 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 94.83 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 94.83 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 94.79 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 94.73 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 94.69 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 94.69 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 94.66 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 94.65 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 94.65 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 94.62 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 94.62 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 94.61 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 94.57 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 94.56 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 94.55 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 94.55 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 94.47 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 94.46 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 94.45 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 94.42 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 94.41 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 94.41 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 94.4 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 94.38 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 94.35 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 94.34 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 94.34 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 94.3 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 94.3 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 94.27 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 94.18 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 94.14 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 94.11 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 94.11 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 94.1 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 94.09 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 94.07 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 94.03 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 94.01 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 94.0 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 93.93 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 93.89 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 93.84 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 93.83 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 93.79 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 93.79 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 93.76 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 93.76 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 93.73 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 93.72 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 93.69 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 93.68 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 93.64 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 93.63 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 93.62 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 93.57 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 93.56 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 93.54 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 93.48 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 93.42 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 93.41 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 93.39 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 93.31 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 93.28 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 93.24 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 93.23 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 93.23 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 93.18 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 93.17 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 93.14 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 93.1 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 93.08 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 93.02 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 92.99 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 92.99 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 92.88 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 92.85 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 92.83 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 92.82 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 92.81 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 92.8 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 92.79 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 92.79 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 92.78 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 92.76 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 92.69 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 92.68 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 92.65 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 92.61 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 92.59 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 92.58 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 92.56 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 92.55 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 92.49 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 92.45 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 92.45 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 92.44 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 92.33 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 92.28 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 92.23 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 92.22 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 92.22 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 92.18 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 92.16 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 92.15 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 92.14 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 92.14 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 92.1 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 92.03 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 92.01 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 91.96 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 91.95 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 91.92 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 91.77 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 91.77 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 91.75 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 91.72 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 91.71 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 91.7 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 91.66 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 91.63 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 91.61 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 91.6 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 91.54 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 91.53 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 91.53 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 91.52 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 91.46 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 91.45 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 91.43 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 91.41 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 91.4 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 91.37 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 91.32 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 91.27 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 91.16 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 91.13 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 91.12 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 91.09 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 91.08 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 91.05 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 91.05 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 91.01 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 90.93 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 90.92 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 90.92 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 90.89 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 90.87 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 90.87 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 90.84 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 90.82 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 90.8 | |
| 2l8b_A | 189 | Protein TRAI, DNA helicase I; RECD, hydrolase; NMR | 90.79 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 90.78 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 90.77 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 90.76 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 90.75 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 90.75 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 90.72 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 90.71 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 90.68 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 90.68 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 90.67 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 90.66 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 90.66 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 90.62 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 90.58 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 90.58 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 90.58 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 90.56 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 90.56 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 90.55 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 90.53 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 90.49 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 90.47 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 90.46 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 90.46 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 90.41 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 90.23 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 90.21 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 90.12 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 90.1 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 90.07 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 89.99 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 89.98 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 89.95 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 89.94 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 89.92 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 89.82 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 89.81 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 89.8 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 89.78 | |
| 3cpe_A | 592 | Terminase, DNA packaging protein GP17; large termi | 89.65 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 89.52 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 89.52 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 89.46 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 89.41 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 89.37 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 89.22 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 89.14 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 89.11 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 89.01 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 88.92 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 88.84 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 88.81 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 88.8 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 88.75 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 88.72 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 88.57 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 88.48 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 88.34 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 88.23 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 88.22 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 88.18 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 88.06 | |
| 2o0j_A | 385 | Terminase, DNA packaging protein GP17; nucleotide- | 87.91 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 87.8 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 87.69 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 87.6 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 87.47 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 87.39 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 87.38 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 87.3 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 87.3 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 87.28 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 87.26 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 87.21 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 87.2 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 87.08 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 87.08 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 87.07 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 86.94 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 86.91 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 86.85 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 86.71 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 86.65 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 86.64 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 86.64 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 86.59 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 86.57 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 86.57 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 86.53 | |
| 2ph1_A | 262 | Nucleotide-binding protein; alpha-beta protein, st | 86.49 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 86.46 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 86.44 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 86.41 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 86.3 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 86.26 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 86.22 | |
| 1byi_A | 224 | Dethiobiotin synthase; biotin synthesis, cyclo-lig | 86.12 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 86.04 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 86.02 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 85.88 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 85.87 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 85.57 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 85.55 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 85.53 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 85.26 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 85.09 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 85.08 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 85.06 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 84.84 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 84.79 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 84.78 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 84.77 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 84.71 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 84.66 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 84.49 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 84.33 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 84.26 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 84.19 | |
| 3igf_A | 374 | ALL4481 protein; two-domained protein consisting o | 84.03 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 83.96 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 83.96 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 83.83 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 83.82 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 83.65 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 83.29 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 82.81 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 82.57 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 82.52 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 82.52 | |
| 1wcv_1 | 257 | SOJ, segregation protein; ATPase, bacterial, chrom | 82.38 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 81.97 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 81.95 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 81.94 | |
| 1w36_C | 1122 | RECC, exodeoxyribonuclease V gamma chain; recombin | 81.72 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 81.3 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 81.08 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 81.05 | |
| 2xj4_A | 286 | MIPZ; replication, cell division, ATPase, WACA; 1. | 81.02 | |
| 3pg5_A | 361 | Uncharacterized protein; structural genomics, PSI- | 81.01 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 80.96 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 80.87 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 80.84 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 80.83 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 80.71 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 80.54 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 80.52 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 80.42 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 80.13 |
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
Probab=100.00 E-value=8.6e-78 Score=762.95 Aligned_cols=606 Identities=25% Similarity=0.282 Sum_probs=427.6
Q ss_pred CChHHHHhhchhhHHHHHHHHHHHhhhccCCCCceE---------EEeee--ecCCCCCceEEEEEeeecccccCCCCCC
Q 048652 48 QSVKQYFGSFVFPLLEETRMQLRSGLEAMRRAPYAE---------VIAFE--ELKPYGANRYGIEVDYWRNTICNSGKEP 116 (1382)
Q Consensus 48 ~S~~~Y~~sF~ppLlEEtra~l~Ssle~is~ap~~~---------i~~ve--~~~~~~~~~y~i~v~~~~~~~~~~~~e~ 116 (1382)
.|+++|++.|.++|-.|-.+++....+.+...+..+ -+.+. ....++..++.+....... ...--.
T Consensus 2 ~~~~~~~~~~~~Ll~~E~~~e~~~~~~~~~~~~~~~~~~~G~~~~~l~~~~~~~~~~g~~~~~~~~~~~~~---~~~l~~ 78 (646)
T 4b3f_X 2 AAVESFVTKQLDLLELERDAEVEERRSWQENISLKELQSRGVCLLKLQVSSQRTGLYGRLLVTFEPRRYGS---AAALPS 78 (646)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCHHHHGGGTSEEEEEEEEEEEECSSSCEEEEEEESCC------CCCCC
T ss_pred hhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCHHHHHhCCceecceEEEEEEecCCCeEEEEEEecCCCC---CCCCcc
Confidence 368999999999999999888876655444433211 12222 2233443445554332211 112224
Q ss_pred CCCCCCCEEEeeccCCCCcccccccCceEEEEEEEeecCCcccccccccceEEEEecC--CccccCCCCceEEEEEEecc
Q 048652 117 YKTLPGDILVLADFKPEKVSDLLRVGRMWTFVSVTMVPDDEVENKNKKKNYYEVKARN--NLQVHDGTKKSFFFIYLTNI 194 (1382)
Q Consensus 117 y~~~~GDIv~Ls~~kP~~~sdl~~~~~~~~~a~V~~v~~~~~~~~~~~~~~~~v~~s~--~i~~~~~~~~~~~~v~L~n~ 194 (1382)
+.+++||+|+|++..|.. .....|+|+++..+. +.|.... +..........+.+.++.|.
T Consensus 79 ~~~~~Gd~v~~~~~~~~~--------~~~~~g~v~~~~~~~----------i~v~~~~~~~~~~~~~~~~~~~~~~~~~~ 140 (646)
T 4b3f_X 79 NSFTSGDIVGLYDAANEG--------SQLATGILTRVTQKS----------VTVAFDESHDFQLSLDRENSYRLLKLAND 140 (646)
T ss_dssp CCCCTTCEEEEEETTTTS--------CCCEEEEEEEEETTE----------EEEECC-------CCCSSCCEEEEEECCH
T ss_pred CCCCCCCEEEEEecCCCC--------CceEEEEEEEEeCCE----------EEEEECCccccccccCCCCcEEEEEeccc
Confidence 678999999999765432 234678999987653 4444322 22222233456789999999
Q ss_pred chhHHHHHHHhccC------CchhhhhhcCCCccchhhhhhhccccCCCCccccCCCCCCCCCHHHHHHHHHHHhhcccC
Q 048652 195 LPSKRIWNSLHMCG------NWKVITQVLGTDSVVEESCELCSLQRKGIWDEKFGPSLSSTLNEPQVGAVFACLRRLDCD 268 (1382)
Q Consensus 195 ~T~~R~~~aL~~~~------~~~li~~iL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LN~sQ~~AV~~~l~~~~~~ 268 (1382)
+|+.||+.||..+. ...+.+.++...++.. ... .......+..||++|++||..++..
T Consensus 141 ~~~~r~~~al~~l~~~~~~~~~~l~~~l~~~~~p~~---------~~~---~~~~~~~~~~LN~~Q~~AV~~al~~---- 204 (646)
T 4b3f_X 141 VTYRRLKKALIALKKYHSGPASSLIEVLFGRSAPSP---------ASE---IHPLTFFNTCLDTSQKEAVLFALSQ---- 204 (646)
T ss_dssp HHHHHHHHHHHHHHTCCSSTTHHHHHHHTTSSCCCC---------CCC---CCCCCCSSTTCCHHHHHHHHHHHHC----
T ss_pred hHHHHHHHHHHHhhhcccCchHHHHHHHcCCCCCCC---------ccc---cCcccccCCCCCHHHHHHHHHHhcC----
Confidence 99999999998732 2234555554332211 000 0011223468999999999999974
Q ss_pred CCCCeEEEEcCCCCchHHHHHHHHHHHHHcCCceEEecCChHHHHHHHHHHHHHhhhhhcCCCCccccccCCcceEEecc
Q 048652 269 HKSGVELRWGPPGTGKTKTVSMLLFSLLRIKCRTLACTPTNVAITELASRALRLVKESYKRDSRNNTPFCPLGDILLFGN 348 (1382)
Q Consensus 269 ~~~~~~LI~GPPGTGKTttI~~li~~Ll~~~~RILVcAPTN~AVDeVa~RL~~l~~es~~~~~~~~~~~~~lgdIVr~Gn 348 (1382)
.++.|||||||||||+||+.++..++..+.+||+|||||.|||++++||.... .+++|+|+
T Consensus 205 --~~~~lI~GPPGTGKT~ti~~~I~~l~~~~~~ILv~a~TN~AvD~i~erL~~~~-----------------~~ilRlG~ 265 (646)
T 4b3f_X 205 --KELAIIHGPPGTGKTTTVVEIILQAVKQGLKVLCCAPSNIAVDNLVERLALCK-----------------QRILRLGH 265 (646)
T ss_dssp --SSEEEEECCTTSCHHHHHHHHHHHHHHTTCCEEEEESSHHHHHHHHHHHHHTT-----------------CCEEECSC
T ss_pred --CCceEEECCCCCCHHHHHHHHHHHHHhCCCeEEEEcCchHHHHHHHHHHHhcC-----------------CceEEecc
Confidence 68999999999999999999999999999999999999999999999997532 25999999
Q ss_pred CCCCCcCchhhhhcHHHHHHHHhhhccCCcccchhhhhhhHHHhhHHHHHHHHHHHHhhhhccccchhHHHHHhhhhccC
Q 048652 349 KDRLKVNPGFEEIYLDYRVKRLMECFAPLSGWRHCFSSMIDLLEDCVSQYHIYVEKLKEREDCNENQSEEKKCRKETEGS 428 (1382)
Q Consensus 349 ~~rm~I~~~L~~v~Ld~Rv~~L~~~f~~~tgW~~~l~s~i~~Le~~~~~y~~~l~~~k~~~~~~~~~~~~~~i~~~~~~~ 428 (1382)
+.++ .+.+....++..+.+-. .. .. +.+. ++.+.......
T Consensus 266 ~~r~--~~~~~~~~l~~~~~~~~--------~~----~~---~~~~-----------------------~~~~~~~~~~~ 305 (646)
T 4b3f_X 266 PARL--LESIQQHSLDAVLARSD--------SA----QI---VADI-----------------------RKDIDQVFVKN 305 (646)
T ss_dssp CSSC--CHHHHTTBHHHHHTTTT--------CS----ST---HHHH-----------------------HHHHTTSSTTT
T ss_pred hhhh--hhhhhhhhHHHHHhhch--------HH----HH---HHHH-----------------------HHHHHHHHHhh
Confidence 9975 66777777765433200 00 00 0000 00000000000
Q ss_pred cCCCCchhHHHHhhhhhhhhhHHhhHHHhhcCCCccccchhhHHhHHHHHHHHHHHHHHHhccCCCHHHHHHHhcccccc
Q 048652 429 KGECKPFLEYVRESFNCAVIPLRNCIFIFCTHLPKTYISENSFQDMVALKSLLDSFRSLLFQKNVVSEELEKLFSHSVDE 508 (1382)
Q Consensus 429 kk~~~sf~eflk~r~~~l~~~L~~~~~~l~~~lP~s~i~~~~~~~m~~~~~lL~~l~~lL~~~~l~~eel~~~~~~~~~~ 508 (1382)
++... . ... ..
T Consensus 306 ~~~~~-------~-------------------~~~---------------------------------------~~---- 316 (646)
T 4b3f_X 306 KKTQD-------K-------------------REK---------------------------------------SN---- 316 (646)
T ss_dssp TC--------------------------------C---------------------------------------CS----
T ss_pred hhhhh-------H-------------------HHH---------------------------------------HH----
Confidence 00000 0 000 00
Q ss_pred chhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCcchhhHHHHHHhcCCcEEEEcccccccc---ccccCCCcc
Q 048652 509 DFSLAFVGKRYLLQLHQRRSECLSVLRNLWNSLDELNLPCTTSKQLLKDFCFKRASLFFSTASSSYKL---HSVKIEPLN 585 (1382)
Q Consensus 509 ~~~~~~~~~~~~~~l~~~R~~~~~~L~~L~~~l~~~~lp~~~~~~~i~~~iL~~a~VI~~T~sss~~l---~~~~~~~fd 585 (1382)
........+.+ ++.. ........+..++||++|+++++.. .......||
T Consensus 317 ----------~~~~~~~l~~~----l~~~--------------~~~~~~~~l~~~~vv~~t~~~a~~~~~~~~~~~~~Fd 368 (646)
T 4b3f_X 317 ----------FRNEIKLLRKE----LKER--------------EEAAMLESLTSANVVLATNTGASADGPLKLLPESYFD 368 (646)
T ss_dssp ----------SHHHHHHHHHH----HHHH--------------HHHHHHHHHHHCSEEEEETTTTCSSSGGGGSCTTCCS
T ss_pred ----------HHHHHHHHHHH----HHHH--------------HHHHHHHHHhhcceeeeehhhhhhhhHHHhhhhccCC
Confidence 00000000000 0000 1112233577899999999887652 334457899
Q ss_pred EEEecccccCChHHHHHHHHhcCCCeEEEEecCCCCCccccccccccCCccccHHHHHHhc--CCCceecccccCCCccc
Q 048652 586 FLVIDEAAQLKESESTIPLQLAGINHAVLIGDECQLPAMVESKISDGASFGRSLFERLTLL--NHSKHLLDIQYRMHPSI 663 (1382)
Q Consensus 586 ~VIIDEAsQ~~E~e~lipL~l~~~krlVLVGD~~QLpP~V~s~~a~~~g~~~SLFeRL~~~--~~~~~~L~~QYRmhp~I 663 (1382)
+||||||+|+.|+++++|+. .++++|+||||+||||++.+..+...|++.|+|+|+... +.+.++|++||||||.|
T Consensus 369 ~vIIDEAsQ~~e~~~lipL~--~~~~~ILVGD~~QLpP~v~~~~a~~~gl~~SlferL~~~~~~~~v~~L~~qYRmhp~I 446 (646)
T 4b3f_X 369 VVVIDECAQALEASCWIPLL--KARKCILAGDHKQLPPTTVSHKAALAGLSLSLMERLAEEYGARVVRTLTVQYRMHQAI 446 (646)
T ss_dssp EEEETTGGGSCHHHHTTTGG--GSSEEEEEECTTSCCCCCSCHHHHHTTTTCCHHHHHHHHHGGGTEEECCEESSSCHHH
T ss_pred EEEEcCccccchHHHHhhcc--ccceEEEcCCccccCceecchhhhhccccchHHHHHHHhcCCceeeecccccCCcHHH
Confidence 99999999999999999985 468999999999999999999888999999999999875 33467899999999999
Q ss_pred cccccccccccccccCccccccccccc---CCCCCCCCCeEEEEecCCc----ccccccCCCCHHHHHHHHHHHHHHHHh
Q 048652 664 SLFPNLQFYRNQILDGANVKSKSYEKH---YLPGTEFGPYTFINIIGGR----EEFIYHSCRNMVEVSVVIKILQKLYKA 736 (1382)
Q Consensus 664 ~~f~n~~FY~g~L~~~~~v~~~~~~~~---~l~~~~~~p~~fidv~~g~----e~~~~~S~~N~~Ea~~V~~lV~~L~~~ 736 (1382)
+.|+|+.||+|+|.+++.+..+..... ........|+.|+|+.+.. ++..+.|+.|..||..|..+++.|++.
T Consensus 447 ~~f~n~~fY~g~L~~~~~~~~~~~~~lp~~~~~~~~~~p~~f~d~~g~~~~~~~~~~~~s~~N~~EA~~V~~~v~~L~~~ 526 (646)
T 4b3f_X 447 MRWASDTMYLGQLTAHSSVARHLLRDLPGVAATEETGVPLLLVDTAGCGLFELEEEDEQSKGNPGEVRLVSLHIQALVDA 526 (646)
T ss_dssp HHHHHHHHSTTCCEECTTTTTCCGGGSTTCCCCTTTTCSEEEEECTTSSCCCCC-----CCCCHHHHHHHHHHHHHHHHH
T ss_pred HhhhHHhhcCCccccCcchhhhhhccccccccccccCCceEEEecCCCccccccccCCccccCHHHHHHHHHHHHHHHhc
Confidence 999999999999999887766543221 1112234689999996542 222678999999999999999999988
Q ss_pred hcCCCCCceEEEEeccHHHHHHHHHHHhhhhcCCCCCcEEEecccCCCCccccEEEEeecccCCCCCcccccCCCcceee
Q 048652 737 WVGSKQMVSIGVVSPYTAQVVAIRKKIGSEYENKDGFTVKVKSVDGFQGGEEDIIIISTVRCNTGGSIGFISNPQRVNVA 816 (1382)
Q Consensus 737 ~~~~~~~~~IgVITPY~aQv~~I~~~L~~~~~~~~~~~v~V~TVD~fQG~E~DiVIlS~Vrsn~~~~iGFl~d~rRLNVA 816 (1382)
+... .+|||||||++|+..|++.|.+.+ ..++|+|||+|||+|+||||+|+||+|..+.+||+.|+||+|||
T Consensus 527 gv~~---~dIgVItpYraQ~~~l~~~l~~~~-----~~i~v~TVd~fQG~E~dvII~S~vrsn~~~~iGFl~~~rRlNVA 598 (646)
T 4b3f_X 527 GVPA---RDIAVVSPYNLQVDLLRQSLVHRH-----PELEIKSVDGFQGREKEAVILSFVRSNRKGEVGFLAEDRRINVA 598 (646)
T ss_dssp TCCG---GGEEEEESCHHHHHHHHHHHTTTC-----TTCEEEEGGGGTTCCEEEEEEECCCCCTTCCCCSTTCHHHHHHH
T ss_pred CCCc---CcEEEECCCHHHHHHHHHHHHHhC-----CCCEECChhhcccccCCEEEEEeccCCCCCCccccCCcCcEEeE
Confidence 7653 489999999999999999997753 36899999999999999999999999999999999999999999
Q ss_pred cccccceEEEEechhhhhcCccHHHHHHHHHHhcCceeccc
Q 048652 817 LTRARHCLWILGNERTLISSESIWGTLVCDAKARQCFFKAD 857 (1382)
Q Consensus 817 lTRAK~~L~IVGn~~~L~~s~~~W~~li~~~~~r~~~~~~~ 857 (1382)
+||||++||||||..+|.+ +++|++|+++++++|+++.+.
T Consensus 599 lTRAk~~liivGn~~~l~~-~~~~~~li~~~~~~g~~~~~~ 638 (646)
T 4b3f_X 599 VTRARRHVAVICDSRTVNN-HAFLKTLVEYFTQHGEVRTAF 638 (646)
T ss_dssp HHTEEEEEEEEECHHHHTT-SHHHHHHHHHHHHSSEEEEGG
T ss_pred hhhhhCeEEEEEchHHhcC-CHHHHHHHHHHHHCCCEeeHH
Confidence 9999999999999999976 589999999999999998863
|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* | Back alignment and structure |
|---|
| >3dmn_A Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, STR genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* | Back alignment and structure |
|---|
| >2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* | Back alignment and structure |
|---|
| >2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* | Back alignment and structure |
|---|
| >1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1w36_C RECC, exodeoxyribonuclease V gamma chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.25 PDB: 3k70_C* | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A | Back alignment and structure |
|---|
| >3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1382 | ||||
| d1uaaa1 | 306 | c.37.1.19 (A:2-307) DEXX box DNA helicase {Escheri | 8e-06 | |
| g1qhh.1 | 623 | c.37.1.19 (A:,B:,C:,D:) DEXX box DNA helicase {Bac | 0.002 |
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Length = 306 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: DEXX box DNA helicase species: Escherichia coli, RepD [TaxId: 562]
Score = 47.0 bits (110), Expect = 8e-06
Identities = 35/248 (14%), Positives = 64/248 (25%), Gaps = 32/248 (12%)
Query: 250 LNEPQVGAVFACLRRLDCDHKSGVELRWGPPGTGKTKTVSMLLFSLLRIKC----RTLAC 305
LN Q AV + +G L G+GKT+ ++ + L+R A
Sbjct: 2 LNPGQQQAV---------EFVTGPCLVLAGAGSGKTRVITNKIAHLIRGCGYQARHIAAV 52
Query: 306 TPTNVAITELASRALRLVKESYKRDSRNNTPFCPLGDILLFGNKDRLKVNPGFEEIYLDY 365
T TN A E+ R + + R + F LG ++ L + F
Sbjct: 53 TFTNKAAREMKERVGQTLGRKEARGLMIS-TFHTLGLDIIKREYAALGMKANFSLFDDTD 111
Query: 366 RVKRLMECFAPLSGWRHC------------------FSSMIDLLEDCVSQYHIYVEKLKE 407
++ L E L S + + L +
Sbjct: 112 QLALLKELTEGLIEDDKVLLQQLISTISNWKNDLKTPSQAAASAIGERDRIFAHCYGLYD 171
Query: 408 REDCNENQSEEKKCRKETEGSKGECKPFLEYVRESFNCAVIPLRNCIFIFCTHLPKTYIS 467
N + + + + ++ L K +
Sbjct: 172 AHLKACNVLDFDDLILLPTLLLQANEEVRKRWQNKIRYLLVDEYQDTNTSQYELVKLLVG 231
Query: 468 ENSFQDMV 475
+ +V
Sbjct: 232 SRARFTVV 239
|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1382 | |||
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.89 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 99.81 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.76 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 99.75 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 99.53 | |
| d1w36d2 | 246 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 97.82 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 97.69 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 97.68 | |
| d1w36b2 | 395 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 97.56 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 97.55 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 97.46 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 97.39 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 97.27 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 97.26 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 97.15 | |
| d1uaaa2 | 333 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 97.13 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 97.13 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 97.11 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 97.07 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.07 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 97.07 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 97.01 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 96.99 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 96.94 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.91 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 96.91 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 96.85 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 96.81 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 96.8 | |
| d1pjra2 | 333 | DEXX box DNA helicase {Bacillus stearothermophilus | 96.76 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 96.76 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 96.75 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.74 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 96.73 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 96.71 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.68 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 96.67 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 96.65 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.5 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 96.39 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 96.36 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 96.32 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 96.31 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 96.16 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.12 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 95.97 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 95.83 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.82 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 95.8 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.77 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 95.71 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 95.68 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 95.66 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 95.63 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 95.61 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 95.58 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 95.58 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 95.54 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 95.52 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 95.51 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 95.51 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 95.49 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 95.41 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 95.4 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 95.27 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 95.25 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 95.18 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 95.1 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 95.07 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 95.04 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 94.95 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 94.92 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 94.86 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 94.77 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 94.72 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 94.61 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 94.55 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 94.48 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 94.37 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 94.29 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 94.27 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 94.27 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 94.27 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 94.18 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 93.99 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 93.96 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 93.94 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 93.94 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 93.91 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 93.88 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 93.77 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 93.74 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 93.69 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 93.65 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 93.65 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 93.63 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 93.6 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 93.55 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 93.54 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 93.44 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 93.4 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 93.39 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 93.32 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 93.13 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 93.03 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 92.74 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 92.73 | |
| d1w36c2 | 470 | Exodeoxyribonuclease V gamma chain (RecC), N-termi | 92.73 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 92.62 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 92.6 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 92.58 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 92.53 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 92.5 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 92.44 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 92.43 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 92.43 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 92.4 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 92.2 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 92.08 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 91.85 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 91.75 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 91.63 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 91.58 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 91.57 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 91.41 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 91.36 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 91.15 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 91.1 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 91.04 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 90.7 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 90.3 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 90.25 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 90.09 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 89.62 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 89.56 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 88.52 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 88.45 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 87.62 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 87.38 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 87.27 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 86.86 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 86.64 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 86.59 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 86.55 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 86.38 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 86.2 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 84.81 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 84.58 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 84.57 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 84.31 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 83.91 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 83.78 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 83.17 | |
| d1b89a_ | 336 | Clathrin heavy chain proximal leg segment {Cow (Bo | 82.97 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 82.95 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 82.73 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 82.59 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 82.49 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 82.46 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 80.55 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 80.11 |
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36d2 c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uaaa2 c.37.1.19 (A:308-640) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1pjra2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1w36c2 c.37.1.19 (C:348-817) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|