Citrus Sinensis ID: 048653

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
EHKKAAALHEKLQLLRSITNSHALSKTSIIVDASNYIEELKQKGFMINLFSKKSCPGLLVSILGSAFEELALNVLEARVSCTDTFSLQAIGGKNEEQGETIDAHVVKQALLQVIRNWSESNEQV
cHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccEEEEEEEcccccccHHHHHHHHHHHHcHHHHHHHcccccccEEEEEccccccccccccHHHHHHHHHHHHHccccccccc
cHHHHHHHHHHHHHHHHHcccccccccEEEEcHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEEccccEEEEEEEcccccccccccHHHHHHHHHHHHHHcccccccc
EHKKAAALHEKLQLLRSITnshalsktsIIVDASNYIEELKQKGFMINLFSKKSCPGLLVSILGSAFEELALNVLEARVSctdtfslqaiggkneeqgeTIDAHVVKQALLQVIRNWSESNEQV
EHKKAAALHEKLQLLRSitnshalsktsiiVDASNYIEELKQKGFMINLFSKKSCPGLLVSILGSAFEELALNVLEARVSCTDTFSLQAIGGKNEEQGETIDAHVVKQALLQVIRnwsesneqv
EHKKAAALHEKLQLLRSITNSHALSKTSIIVDASNYIEELKQKGFMINLFSKKSCPGLLVSILGSAFEELALNVLEARVSCTDTFSLQAIGGKNEEQGETIDAHVVKQALLQVIRNWSESNEQV
***********LQLLRSITNSHALSKTSIIVDASNYIEELKQKGFMINLFSKKSCPGLLVSILGSAFEELALNVLEARVSCTDTFSLQAIGGKNEEQGETIDAHVVKQALLQVIRNW*******
***********LQLLRSIT**********IVDASNYIEELKQKGFMINLFSKKSCPGLLVSILGSAFEELALNVLEARVSCTDTFSLQAI**********IDAHVVKQALLQV***********
EHKKAAALHEKLQLLRSITNSHALSKTSIIVDASNYIEELKQKGFMINLFSKKSCPGLLVSILGSAFEELALNVLEARVSCTDTFSLQAIGGKNEEQGETIDAHVVKQALLQVIRNWSESNEQV
****AAALHEKLQLLRSITNSHALSKTSIIVDASNYIEELKQKGFMINLFSKKSCPGLLVSILGSAFEELALNVLEARVSCTDTFSLQAIGGKNEEQGETIDAHVVKQALLQVIRNWS******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EHKKAAALHEKLQLLRSITNSHALSKTSIIVDASNYIEELKQKGFMINLFSKKSCPGLLVSILGSAFEELALNVLEARVSCTDTFSLQAIGGKNEEQGETIDAHVVKQALLQVIRNWSESNEQV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query124
356540030157 PREDICTED: uncharacterized protein LOC10 0.967 0.764 0.598 4e-40
359486354158 PREDICTED: transcription factor bHLH61 [ 0.983 0.772 0.587 8e-40
297736527159 unnamed protein product [Vitis vinifera] 0.983 0.767 0.583 9e-40
359481316156 PREDICTED: transcription factor bHLH61-l 0.967 0.769 0.576 2e-39
356554638156 PREDICTED: uncharacterized protein LOC10 0.959 0.762 0.602 3e-39
351725705156 uncharacterized protein LOC100306253 [Gl 0.959 0.762 0.609 3e-39
356567913157 PREDICTED: uncharacterized protein LOC10 0.975 0.770 0.568 2e-37
388507236159 unknown [Lotus japonicus] 0.943 0.735 0.587 4e-37
357492909155 Transcription factor bHLH93 [Medicago tr 0.959 0.767 0.549 7e-36
255559611156 DNA binding protein, putative [Ricinus c 0.959 0.762 0.589 3e-34
>gi|356540030|ref|XP_003538494.1| PREDICTED: uncharacterized protein LOC100814138 [Glycine max] Back     alignment and taxonomy information
 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 91/152 (59%), Positives = 105/152 (69%), Gaps = 32/152 (21%)

Query: 3   KKAAALHEKLQLLRSITNSHALSKTSIIVDASNYIEELKQ-------------------- 42
           +K AALHEKLQLLRSITNSHAL+KTSII+DAS YIEELKQ                    
Sbjct: 6   QKRAALHEKLQLLRSITNSHALNKTSIIIDASKYIEELKQKVERLNQHVANAQTSSDQNT 65

Query: 43  ----------KGFMINLFSKKSCPGLLVSILGSAFEELALNVLEARVSCTDTFSLQAIGG 92
                     KGF+IN++S K+CPGLLVSIL S FEE+ LNVLEARV+CTDTF   A+GG
Sbjct: 66  LPMVTVETLEKGFLINVYSAKTCPGLLVSILES-FEEIGLNVLEARVTCTDTFRFHAVGG 124

Query: 93  KNEEQG-ETIDAHVVKQALLQVIRNWSESNEQ 123
           KNEEQG E IDA  VKQ L Q I+NWS++ +Q
Sbjct: 125 KNEEQGDEGIDAQTVKQELGQAIKNWSQNADQ 156

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359486354|ref|XP_002278871.2| PREDICTED: transcription factor bHLH61 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297736527|emb|CBI25398.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481316|ref|XP_002268100.2| PREDICTED: transcription factor bHLH61-like [Vitis vinifera] gi|297735573|emb|CBI18067.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356554638|ref|XP_003545651.1| PREDICTED: uncharacterized protein LOC100797684 [Glycine max] Back     alignment and taxonomy information
>gi|351725705|ref|NP_001236078.1| uncharacterized protein LOC100306253 [Glycine max] gi|255628009|gb|ACU14349.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356567913|ref|XP_003552159.1| PREDICTED: uncharacterized protein LOC100813030 [Glycine max] Back     alignment and taxonomy information
>gi|388507236|gb|AFK41684.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|357492909|ref|XP_003616743.1| Transcription factor bHLH93 [Medicago truncatula] gi|355518078|gb|AES99701.1| Transcription factor bHLH93 [Medicago truncatula] gi|388504310|gb|AFK40221.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255559611|ref|XP_002520825.1| DNA binding protein, putative [Ricinus communis] gi|223539956|gb|EEF41534.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query124
TAIR|locus:2828302158 AT2G40435 [Arabidopsis thalian 0.661 0.518 0.595 1.9e-33
TAIR|locus:2078411156 AT3G56220 [Arabidopsis thalian 0.903 0.717 0.456 1.7e-20
UNIPROTKB|Q10LR1163 Os03g0338400 "BHLH transcripti 0.645 0.490 0.607 2.5e-19
UNIPROTKB|Q8LII5157 OJ1167_G06.116 "Putative uncha 0.580 0.458 0.612 1.1e-18
UNIPROTKB|Q5WMQ1153 OSJNBa0053E01.1 "Putative unch 0.846 0.686 0.421 3.7e-16
UNIPROTKB|Q2QYP296 LOC_Os12g02020 "Os12g0111400 p 0.346 0.447 0.674 1.1e-12
TAIR|locus:2155725351 bHLH093 "AT5G65640" [Arabidops 0.451 0.159 0.385 4.2e-09
UNIPROTKB|Q2R3F6524 Os11g0523700 "Helix-loop-helix 0.516 0.122 0.318 0.00039
TAIR|locus:2090847494 ICE1 "AT3G26744" [Arabidopsis 0.5 0.125 0.296 0.00074
TAIR|locus:2828302 AT2G40435 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 245 (91.3 bits), Expect = 1.9e-33, Sum P(2) = 1.9e-33
 Identities = 50/84 (59%), Positives = 64/84 (76%)

Query:    39 ELKQKGFMINLFSKKSCPGLLVSILGSAFEELALNVLEARVSCTDTFSLQAIGGKNEEQG 98
             E   KGFMIN+FS K+ PG+LVS+L  AFE++ LNVLEAR SCTD+FSL A+G +NE+ G
Sbjct:    74 ETLDKGFMINVFSGKNQPGMLVSVL-EAFEDIGLNVLEARASCTDSFSLHAMGLENED-G 131

Query:    99 ETIDAHVVKQALLQVIRNWSESNE 122
             E +DA  VKQA+   IR+W E N+
Sbjct:   132 ENMDAEAVKQAVTDAIRSWGEIND 155
GO:0005634 "nucleus" evidence=ISM
TAIR|locus:2078411 AT3G56220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q10LR1 Os03g0338400 "BHLH transcription factor" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q8LII5 OJ1167_G06.116 "Putative uncharacterized protein OJ1167_G06.116" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q5WMQ1 OSJNBa0053E01.1 "Putative uncharacterized protein OSJNBa0053E01.1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q2QYP2 LOC_Os12g02020 "Os12g0111400 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2155725 bHLH093 "AT5G65640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q2R3F6 Os11g0523700 "Helix-loop-helix DNA-binding domain containing protein, expressed" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2090847 ICE1 "AT3G26744" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00029398001
SubName- Full=Chromosome chr13 scaffold_48, whole genome shotgun sequence; (158 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 124
smart0035353 HLH helix loop helix domain. 99.28
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.21
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.13
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 98.3
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 98.29
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 98.18
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 98.16
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 98.16
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 97.82
KOG1318411 consensus Helix loop helix transcription factor EB 97.8
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 97.8
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 97.65
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 97.53
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 97.36
KOG0561 373 consensus bHLH transcription factor [Transcription 97.18
KOG4304250 consensus Transcriptional repressors of the hairy/ 97.13
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 97.05
PRK00275895 glnD PII uridylyl-transferase; Provisional 96.95
PRK05007884 PII uridylyl-transferase; Provisional 96.86
KOG1319229 consensus bHLHZip transcription factor BIGMAX [Tra 96.72
PRK01759854 glnD PII uridylyl-transferase; Provisional 96.54
PRK03059856 PII uridylyl-transferase; Provisional 96.48
PRK05092931 PII uridylyl-transferase; Provisional 96.39
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 96.38
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 96.37
PRK04374869 PII uridylyl-transferase; Provisional 96.32
PRK03381774 PII uridylyl-transferase; Provisional 96.29
KOG4029228 consensus Transcription factor HAND2/Transcription 96.23
PRK00275 895 glnD PII uridylyl-transferase; Provisional 96.19
KOG2483232 consensus Upstream transcription factor 2/L-myc-2 96.11
PRK03381774 PII uridylyl-transferase; Provisional 96.04
KOG3960284 consensus Myogenic helix-loop-helix transcription 95.97
PRK01759854 glnD PII uridylyl-transferase; Provisional 95.86
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 95.71
PRK05007 884 PII uridylyl-transferase; Provisional 95.39
PRK03059856 PII uridylyl-transferase; Provisional 95.28
PRK05092 931 PII uridylyl-transferase; Provisional 95.23
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 95.22
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 95.03
PRK04374869 PII uridylyl-transferase; Provisional 95.03
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 94.29
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 94.16
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 93.99
PRK0019490 hypothetical protein; Validated 93.72
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 93.37
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 93.26
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 93.15
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 92.85
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 92.56
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 92.53
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 92.52
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 92.41
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 92.05
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 92.01
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 91.41
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 90.92
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 90.74
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 90.4
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 90.23
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 90.08
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 89.6
cd0211660 ACT ACT domains are commonly involved in specifica 89.0
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 89.0
KOG3559 598 consensus Transcriptional regulator SIM1 [Transcri 88.92
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 88.83
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 88.77
PRK08577136 hypothetical protein; Provisional 88.68
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 88.52
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 88.5
KOG2588 953 consensus Predicted DNA-binding protein [Transcrip 88.28
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 87.5
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 87.3
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 86.44
PRK04435147 hypothetical protein; Provisional 85.94
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 85.65
CHL00100174 ilvH acetohydroxyacid synthase small subunit 84.98
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 84.92
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 84.79
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 84.66
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 83.97
PRK07334403 threonine dehydratase; Provisional 83.65
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 83.25
COG2844 867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 83.1
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 82.92
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 82.77
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 81.9
>smart00353 HLH helix loop helix domain Back     alignment and domain information 
Probab=99.28  E-value=3.6e-12  Score=78.69  Aligned_cols=43  Identities=30%  Similarity=0.482  Sum_probs=40.0

Q ss_pred             CchhHHHHhHhhHhhhhcCC----CCCccccchHHhHHHHHHHHHHc
Q 048653            1 EHKKAAALHEKLQLLRSITN----SHALSKTSIIVDASNYIEELKQK   43 (124)
Q Consensus         1 ER~RR~klnerl~~LRslvP----~sk~dKaSIl~daI~YikeL~~~   43 (124)
                      ||+||.++|+.|..|++++|    ..++||++||..||+||++|+.+
T Consensus         4 Er~RR~~~n~~~~~L~~lip~~~~~~k~~k~~iL~~ai~yi~~L~~~   50 (53)
T smart00353        4 ERRRRRKINEAFDELRSLLPTLPNNKKLSKAEILRLAIEYIKSLQEE   50 (53)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Confidence            78999999999999999999    45799999999999999999874

>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>KOG0561 consensus bHLH transcription factor [Transcription] Back     alignment and domain information
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>KOG2588 consensus Predicted DNA-binding protein [Transcription] Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 37.5 bits (86), Expect = 4e-04
 Identities = 21/126 (16%), Positives = 44/126 (34%), Gaps = 13/126 (10%)

Query: 2   HKKAAALHEKLQLLRSITNS--HALS---KTSIIVDASNYIEELKQKGFMI---NLFSKK 53
            +    L + L  LR   N     +    KT + +D     +   +  F I   N     
Sbjct: 134 LQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLN-LKNC 192

Query: 54  SCPGLLVSILGSAFEELALNVLEARVSCTDTFSLQAIGGKNEEQGETIDAHVVKQALLQV 113
           + P  ++ +L     ++  N   +R   +    L+    + E +   + +   +  LL V
Sbjct: 193 NSPETVLEMLQKLLYQIDPN-WTSRSDHSSNIKLRIHSIQAELR-RLLKSKPYENCLL-V 249

Query: 114 IRN-WS 118
           + N  +
Sbjct: 250 LLNVQN 255

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query124
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.41
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.4
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.4
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.35
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.31
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.27
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.24
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.23
4ati_A118 MITF, microphthalmia-associated transcription fact 99.23
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.13
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 98.96
4f3l_A 361 Mclock, circadian locomoter output cycles protein 98.87
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 98.87
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 98.79
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.64
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.54
4ath_A83 MITF, microphthalmia-associated transcription fact 97.68
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 97.43
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 96.3
1u8s_A 192 Glycine cleavage system transcriptional repressor, 94.59
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 94.44
1u8s_A192 Glycine cleavage system transcriptional repressor, 94.23
2nyi_A195 Unknown protein; protein structure initiative, PSI 93.65
2nyi_A 195 Unknown protein; protein structure initiative, PSI 93.62
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 91.67
2pc6_A165 Probable acetolactate synthase isozyme III (small; 90.48
2jhe_A 190 Transcription regulator TYRR; aromatic hydrocarbon 88.39
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 87.28
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 85.57
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 85.23
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 85.11
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 83.08
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
Probab=99.41  E-value=5.9e-14  Score=94.74  Aligned_cols=43  Identities=21%  Similarity=0.431  Sum_probs=41.1

Q ss_pred             CchhHHHHhHhhHhhhhcCC-C-CCccccchHHhHHHHHHHHHHc
Q 048653            1 EHKKAAALHEKLQLLRSITN-S-HALSKTSIIVDASNYIEELKQK   43 (124)
Q Consensus         1 ER~RR~klnerl~~LRslvP-~-sk~dKaSIl~daI~YikeL~~~   43 (124)
                      ||+||.++|++|..||++|| . +|+||++||.+||+||++|+.+
T Consensus        14 ErrRR~~in~~f~~L~~lvP~~~~k~~Ka~IL~~Ai~YI~~Lq~~   58 (82)
T 1am9_A           14 EKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHS   58 (82)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhccCCCCCCCHHHHHHHHHHHHHHHHHH
Confidence            78999999999999999999 4 8999999999999999999986
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query124
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.37
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.29
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.23
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.15
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 95.98
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 95.85
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 95.53
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 95.29
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 95.27
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 92.95
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 91.3
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 90.59
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 90.3
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Pho4 B/HLH domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.37  E-value=2.3e-13  Score=86.04  Aligned_cols=43  Identities=33%  Similarity=0.385  Sum_probs=40.3

Q ss_pred             CchhHHHHhHhhHhhhhcCC--------CCCccccchHHhHHHHHHHHHHc
Q 048653            1 EHKKAAALHEKLQLLRSITN--------SHALSKTSIIVDASNYIEELKQK   43 (124)
Q Consensus         1 ER~RR~klnerl~~LRslvP--------~sk~dKaSIl~daI~YikeL~~~   43 (124)
                      ||+||.+||+.|..||+++|        ..|+||++||..||+||+.|+++
T Consensus        10 Er~RR~~in~~~~~L~~llP~~~~~~~~~~k~sKa~iL~~Av~yI~~Lq~~   60 (63)
T d1a0aa_          10 EQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHLQQN   60 (63)
T ss_dssp             THHHHHHHHHHHHHHHHTSCHHHHTSSCCCCSCTTHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHHHHHCCCcccccCCcccccHHHHHHHHHHHHHHHHHh
Confidence            89999999999999999999        36899999999999999999975
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure