Citrus Sinensis ID: 048657


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450------
MSTRIALNTSFLQIIGESMPSLKYLSLSDSNSSRILDRGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELMLSNNHFQIPISLEPFFNHSRLKFFYAENNQINAEITQSHSLIPPKFQLSRLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLIQLSVVNDSLAGPFRLPIHSHKQLRLLDISTNNFRGHIPVEIGDVLPSLYVFNNSMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLESLALSNNNLEGHMFSRNFNLANLKLLQLEGNRFVGEIPQSLSKCSSLEGLHLNNNSLSGRIPRWLGNLTWLQYIIMPNNHLEGLIPVEFCQLDSLQILDISDNNISGSLPACFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSIPDW
cccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEccccccEEcccHHHHccccccEEEccccEEEEEcccccccccccccEEEccccEEEEEcccccccccccccEEEEEccEEEEEcccccccccccccccEEEccccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEEccccEEEEEccccccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHHccccccEEEccccEEcccccccccccccccEEEccccEEEEcccccccccccccEEEcccccccccccHHHHccccccccccccccccccccHHHcccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccccc
ccccccccccccHHHHHHHccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHHHccccccEEEcccccccccccHHHHcccccccEEEcccccccccccHHHccccccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHccHcccEEEcccccccccccHHHccccccEEEEEccccccccccHHHHHHHHHccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHHccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccEEEEEcccccccccccHHHHcccccccEEEccccccccccccc
MSTRIALNTSFLQIIGesmpslkylslsdsnssrildrGLCSLVHLQelyidnndlrgslpwclanmtslrildvssnqltgsisssplvhLTSIEELMlsnnhfqipislepffnhsrlkffyaennqinaeitqshslippkfqlsrlslssgyedgvtfpkflyhqhdleyvdlshikmngefptwllenNTKLIQLSVVndslagpfrlpihshkqlRLLDistnnfrghipveigdvlpslyvfnnsmnaldgsipssfgnmkFLQILDlsnnhltgeipehlavGCVNLESLAlsnnnleghmfsrnfNLANLKLLQlegnrfvgeipqslskcssleglhlnnnslsgriprwlgnLTWLQYIImpnnhleglipvefcqldslqildisdnnisgslpacfhplsikqvHLSKnmlhgqlkrgtffncsslvtldlsynrlngsipdw
mstrialnTSFLQIIGESMPSLKYLSLSDSNSSRILDRGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELMLSNNHFQIPISLEPFFNHSRLKFFYAENNQINAEITQSHSLIPPKFQLSRLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLIQLSVVNDSLAGPFRLPIHSHKQLRLLDISTNNFRGHIPVEIGDVLPSLYVFNNSMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLESLALSNNNLEGHMFSRNFNLANLKLLQLEGNRFVGEIPQSLSKCSSLEGLHLNNNSLSGRIPRWLGNLTWLQYIIMPNNHLEGLIPVEFCQLDSLQILDISDNNISGSLPACFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVtldlsynrlngsipdw
MSTRIALNTSFLQIIGESMPSLKYLSLSDSNSSRILDRGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELMLSNNHFQIPISLEPFFNHSRLKFFYAENNQINAEITQSHSLIPPKFQLSRLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLIQLSVVNDSLAGPFRLPIHSHKQLRLLDISTNNFRGHIPVEIGDVLPSLYVFNNSMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLAVGCVnleslalsnnnleGHMFSRNFNLANLKLLQLEGNRFVGEIPQSLSKCSSLEGLHLNNNSLSGRIPRWLGNLTWLQYIIMPNNHLEGLIPVEFCQLDSLQILDISDNNISGSLPACFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSIPDW
*****ALNTSFLQIIGESMPSLKYLSL*****SRILDRGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELMLSNNHFQIPISLEPFFNHSRLKFFYAENNQINAEITQSHSLIPPKFQLSRLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLIQLSVVNDSLAGPFRLPIHSHKQLRLLDISTNNFRGHIPVEIGDVLPSLYVFNNSMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLESLALSNNNLEGHMFSRNFNLANLKLLQLEGNRFVGEIPQSLSKCSSLEGLHLNNNSLSGRIPRWLGNLTWLQYIIMPNNHLEGLIPVEFCQLDSLQILDISDNNISGSLPACFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRL*******
MSTRIALNTSFLQIIGESMPSLKYLSLSDSNSSRILDRGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELMLSNNHFQIPISLEPFFNHSRLKFFYAENNQINAEITQSHSLIPPKFQLSRLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLIQLSVVNDSLAGPFRLPIHSHKQLRLLDISTNNFRGHIPVEIGDVLPSLYVFNNSMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLESLALSNNNLEGHMFSRNFNLANLKLLQLEGNRFVGEIPQSLSKCSSLEGLHLNNNSLSGRIPRWLGNLTWLQYIIMPNNHLEGLIPVEFCQLDSLQILDISDNNISGSLPACFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSIPDW
MSTRIALNTSFLQIIGESMPSLKYLSLSDSNSSRILDRGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELMLSNNHFQIPISLEPFFNHSRLKFFYAENNQINAEITQSHSLIPPKFQLSRLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLIQLSVVNDSLAGPFRLPIHSHKQLRLLDISTNNFRGHIPVEIGDVLPSLYVFNNSMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLESLALSNNNLEGHMFSRNFNLANLKLLQLEGNRFVGEIPQSLSKCSSLEGLHLNNNSLSGRIPRWLGNLTWLQYIIMPNNHLEGLIPVEFCQLDSLQILDISDNNISGSLPACFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSIPDW
****IALNTSFLQIIGESMPSLKYLSLSDSNSSRILDRGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELMLSNNHFQIPISLEPFFNHSRLKFFYAENNQINAEITQSHSLIPPKFQLSRLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLIQLSVVNDSLAGPFRLPIHSHKQLRLLDISTNNFRGHIPVEIGDVLPSLYVFNNSMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLESLALSNNNLEGHMFSRNFNLANLKLLQLEGNRFVGEIPQSLSKCSSLEGLHLNNNSLSGRIPRWLGNLTWLQYIIMPNNHLEGLIPVEFCQLDSLQILDISDNNISGSLPACFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSIP*W
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTRIALNTSFLQIIGESMPSLKYLSLSDSNSSRILDRGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELMLSNNHFQIPISLEPFFNHSRLKFFYAENNQINAEITQSHSLIPPKFQLSRLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLIQLSVVNDSLAGPFRLPIHSHKQLRLLDISTNNFRGHIPVEIGDVLPSLYVFNNSMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLESLALSNNNLEGHMFSRNFNLANLKLLQLEGNRFVGEIPQSLSKCSSLEGLHLNNNSLSGRIPRWLGNLTWLQYIIMPNNHLEGLIPVEFCQLDSLQILDISDNNISGSLPACFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSIPDW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query456 2.2.26 [Sep-21-2011]
Q9LHP4 1141 Receptor-like protein kin no no 0.820 0.327 0.335 3e-43
C0LGQ5 1249 LRR receptor-like serine/ no no 0.888 0.324 0.343 5e-42
Q9FL28 1173 LRR receptor-like serine/ no no 0.881 0.342 0.325 2e-40
Q9FZ59 1088 Leucine-rich repeat recep no no 0.866 0.363 0.325 3e-40
C0LGS2 1136 Probable LRR receptor-lik no no 0.842 0.338 0.318 7e-40
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.940 0.342 0.304 1e-39
Q9M0G7 1013 Leucine-rich repeat recep no no 0.822 0.370 0.331 5e-37
Q9ZUI0 980 Putative leucine-rich rep no no 0.846 0.393 0.329 6e-37
C0LGV1 1135 LRR receptor-like serine/ no no 0.901 0.362 0.292 6e-37
Q42371 976 LRR receptor-like serine/ no no 0.868 0.405 0.302 1e-36
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function desciption
 Score =  176 bits (447), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 144/429 (33%), Positives = 229/429 (53%), Gaps = 55/429 (12%)

Query: 38  RGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEE 97
           R +  L  L++L++  N L G +P  + N ++L+++D+S N L+GSI SS +  L+ +EE
Sbjct: 292 REIGQLTKLEQLFLWQNSLVGGIPEEIGNCSNLKMIDLSLNLLSGSIPSS-IGRLSFLEE 350

Query: 98  LMLSNNHFQ--IPISLEPFFNHSRLKFFYAENNQINAEITQSHSLIPPKF-QLSRLSLSS 154
            M+S+N F   IP ++    N S L     + NQI+        LIP +   L++L+L  
Sbjct: 351 FMISDNKFSGSIPTTIS---NCSSLVQLQLDKNQISG-------LIPSELGTLTKLTLFF 400

Query: 155 GYEDGV--TFPKFLYHQHDLEYVDLSHIKMNGEFPT--WLLENNTKLIQLSVVNDSLAGP 210
            + + +  + P  L    DL+ +DLS   + G  P+  ++L N TKL+ +S         
Sbjct: 401 AWSNQLEGSIPPGLADCTDLQALDLSRNSLTGTIPSGLFMLRNLTKLLLIS--------- 451

Query: 211 FRLPIHSHKQLRLLDISTNNFRGHIPVEIGDVLPSLYVFNNSMNALDGSIPSSFGNMKFL 270
                             N+  G IP EIG+   SL       N + G IPS  G++K +
Sbjct: 452 ------------------NSLSGFIPQEIGNC-SSLVRLRLGFNRITGEIPSGIGSLKKI 492

Query: 271 QILDLSNNHLTGEIPEHLAVGCVNLESLALSNNNLEGHMFSRNFNLANLKLLQLEGNRFV 330
             LD S+N L G++P+ +   C  L+ + LSNN+LEG + +   +L+ L++L +  N+F 
Sbjct: 493 NFLDFSSNRLHGKVPDEIG-SCSELQMIDLSNNSLEGSLPNPVSSLSGLQVLDVSANQFS 551

Query: 331 GEIPQSLSKCSSLEGLHLNNNSLSGRIPRWLGNLTWLQYIIMPNNHLEGLIPVEFCQLDS 390
           G+IP SL +  SL  L L+ N  SG IP  LG  + LQ + + +N L G IP E   +++
Sbjct: 552 GKIPASLGRLVSLNKLILSKNLFSGSIPTSLGMCSGLQLLDLGSNELSGEIPSELGDIEN 611

Query: 391 LQI-LDISDNNISGSLP---ACFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSY 446
           L+I L++S N ++G +P   A  + LSI  + LS NML G L      N  +LV+L++SY
Sbjct: 612 LEIALNLSSNRLTGKIPSKIASLNKLSI--LDLSHNMLEGDL--APLANIENLVSLNISY 667

Query: 447 NRLNGSIPD 455
           N  +G +PD
Sbjct: 668 NSFSGYLPD 676





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query456
255581263 912 serine-threonine protein kinase, plant-t 0.973 0.486 0.547 1e-122
224102049 577 predicted protein [Populus trichocarpa] 0.905 0.715 0.489 5e-96
224142481 781 predicted protein [Populus trichocarpa] 0.903 0.527 0.488 3e-95
359476165 1464 PREDICTED: LRR receptor-like serine/thre 0.973 0.303 0.462 6e-94
224073436 1014 predicted protein [Populus trichocarpa] 0.978 0.439 0.453 7e-92
224123984 1016 predicted protein [Populus trichocarpa] 0.973 0.437 0.459 9e-92
224134891 953 predicted protein [Populus trichocarpa] 0.971 0.464 0.450 4e-89
224073422 969 predicted protein [Populus trichocarpa] 0.973 0.458 0.452 7e-89
224124490 981 predicted protein [Populus trichocarpa] 0.953 0.443 0.447 6e-87
224098008 1097 predicted protein [Populus trichocarpa] 0.973 0.404 0.434 6e-86
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  446 bits (1146), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 248/453 (54%), Positives = 318/453 (70%), Gaps = 9/453 (1%)

Query: 4   RIALNTSFLQIIGESMPSLKYLSLSDSNSSRILD--RGLCSLVHLQELYIDNNDLRGSLP 61
           +I L  SFLQ +G  M SLK LSLS    +  L   +GLC L+HL+ L + +N+  G LP
Sbjct: 186 KIELENSFLQTVG-VMTSLKVLSLSGCGLTGALPNVQGLCELIHLRVLDVSSNEFHGILP 244

Query: 62  WCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELMLSNNHFQIPISLEPFFNHSRLK 121
           WCL+N+TSL++LD+SSNQ  G IS+SPL  L S+ +L +SNNHFQ+P SL PFFNHS LK
Sbjct: 245 WCLSNLTSLQLLDLSSNQFVGDISNSPLKILKSLVDLDVSNNHFQVPFSLGPFFNHSNLK 304

Query: 122 FFYAENNQINAEITQSHSLIPPKFQLSRLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHIK 181
               +NN I  E  + HS   P+FQL  + + SGY    TFP FLYHQ++L++VDLSH+ 
Sbjct: 305 HIRGQNNAIYLE-AELHS--APRFQLISI-IFSGYGICGTFPNFLYHQNNLQFVDLSHLS 360

Query: 182 MNGEFPTWLLENNTKLIQLSVVNDSLAGPFRLPIHSHKQLRLLDISTNNFRGHIPVEIGD 241
           + GEFP WLL NNT+L  L +VN+SL+G  +LP+H H  L  LDIS N+   HIP+EIG 
Sbjct: 361 LKGEFPNWLLTNNTRLEILDLVNNSLSGHLQLPLHPHVNLLALDISNNHVHDHIPLEIGT 420

Query: 242 VLPSLYVFNNSMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLESLALS 301
            LP L + N S N  DGSIPSSFGNM  L+ILDLSNN L+G IPEHLA GC +L +L LS
Sbjct: 421 FLPKLELLNMSSNGFDGSIPSSFGNMNSLRILDLSNNQLSGSIPEHLATGCFSLNTLILS 480

Query: 302 NNNLEGHMFSRNFNLANLKLLQLEGNRFVGEIPQSLSKCSSLEGLHLNNNSLSGRIPRWL 361
           NN+L+G MFS+ FNL NL  L+L+ N F G IP+SLSK S+L  + L++N LSG IP W+
Sbjct: 481 NNSLQGQMFSKQFNLTNLWWLELDKNHFSGRIPKSLSK-SALSIMDLSDNHLSGMIPGWI 539

Query: 362 GNLTWLQYIIMPNNHLEGLIPVEFCQLDSLQILDISDNNISGSLPACFHPLSIKQVHLSK 421
           GNL++LQ +I+ NN L+G IPVEFCQL  L++LD+++N++SG LP+C  P SI  VHLS+
Sbjct: 540 GNLSYLQNLILSNNRLKGPIPVEFCQLHYLEVLDLANNSVSGILPSCLSPSSIIHVHLSQ 599

Query: 422 NMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSIP 454
           NM+ G      F     LVTLDLS NR+ G IP
Sbjct: 600 NMIEGPWTNA-FSGSHFLVTLDLSSNRITGRIP 631




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224102049|ref|XP_002334215.1| predicted protein [Populus trichocarpa] gi|222870030|gb|EEF07161.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142481|ref|XP_002324585.1| predicted protein [Populus trichocarpa] gi|222866019|gb|EEF03150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359476165|ref|XP_002283141.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224073436|ref|XP_002304095.1| predicted protein [Populus trichocarpa] gi|222841527|gb|EEE79074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224123984|ref|XP_002330258.1| predicted protein [Populus trichocarpa] gi|222871714|gb|EEF08845.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134891|ref|XP_002327515.1| predicted protein [Populus trichocarpa] gi|222836069|gb|EEE74490.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073422|ref|XP_002304093.1| predicted protein [Populus trichocarpa] gi|222841525|gb|EEE79072.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224124490|ref|XP_002330036.1| predicted protein [Populus trichocarpa] gi|222871461|gb|EEF08592.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224098008|ref|XP_002334579.1| predicted protein [Populus trichocarpa] gi|222873205|gb|EEF10336.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query456
TAIR|locus:2025012 1083 RLP1 "AT1G07390" [Arabidopsis 0.892 0.375 0.389 1.7e-64
TAIR|locus:2037313 1000 RLP13 "AT1G74170" [Arabidopsis 0.890 0.406 0.374 9.7e-64
TAIR|locus:2019662 965 RLP15 "AT1G74190" [Arabidopsis 0.903 0.426 0.368 6.9e-63
TAIR|locus:2101943 891 RLP45 "AT3G53240" [Arabidopsis 0.938 0.480 0.342 9.8e-58
TAIR|locus:2155909 908 RLP56 "AT5G49290" [Arabidopsis 0.927 0.465 0.355 3.8e-57
TAIR|locus:2037308 976 RLP14 "AT1G74180" [Arabidopsis 0.888 0.414 0.361 4.1e-56
TAIR|locus:2137296 811 RLP46 "receptor like protein 4 0.824 0.463 0.315 1.9e-50
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.947 0.462 0.330 1.1e-48
TAIR|locus:2091353 1016 AT3G28040 [Arabidopsis thalian 0.925 0.415 0.317 9.5e-43
TAIR|locus:2161825 1090 AT5G56040 [Arabidopsis thalian 0.934 0.390 0.325 1.9e-42
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 664 (238.8 bits), Expect = 1.7e-64, P = 1.7e-64
 Identities = 162/416 (38%), Positives = 233/416 (56%)

Query:    39 GLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSI-EE 97
             G+C L+ L+EL + +N L  SLP+CL N+T LR LD+S+NQL G++SS  +  L S+ E 
Sbjct:   353 GICRLMKLRELDLSSNALT-SLPYCLGNLTHLRTLDLSNNQLNGNLSSF-VSGLPSVLEY 410

Query:    98 LMLSNNHFQIPISLEPFFNHSRLKFFYAENNQINAEITQSHSLIPPKFQLSRLSLSSGYE 157
             L L +N+F          N +RL  F   ++++     Q+ S   P FQL  L LS+   
Sbjct:   411 LSLLDNNFDGSFLFNSLVNQTRLTVFKL-SSKVGVIQVQTESSWAPLFQLKMLYLSN-CS 468

Query:   158 DGVTFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLIQLSVVNDSLAGPFRLPIHS 217
              G T   FL HQ DL +VDLSH K+ G FPTWL++NNT+L  + +  +SL    +LPI  
Sbjct:   469 LGSTMLGFLVHQRDLCFVDLSHNKLTGTFPTWLVKNNTRLQTILLSGNSLT-KLQLPILV 527

Query:   218 HKQLRLLDISTNNFRGHIPVEIGDVLPSLYVFNNSMNALDGSIPSSFGNMKFLQILDLSN 277
             H  L++LDIS+N     I  +IG V P+L   N S N   G+IPSS G MK LQ+LD+S+
Sbjct:   528 HG-LQVLDISSNMIYDSIQEDIGMVFPNLRFMNFSSNHFQGTIPSSIGEMKSLQVLDMSS 586

Query:   278 NHLTGEIPEHLAVGCVXXXXXXXXXXXXXGHMFSRNFNLANLKLLQLEGNRFVGEIPQSL 337
             N L G++P     GC              G +FS++ NL  L  L L+GN F G + + L
Sbjct:   587 NGLYGQLPIMFLSGCYSLRVLKLSNNQLQGKIFSKHANLTGLVGLFLDGNNFTGSLEEGL 646

Query:   338 SKCSSLEGLHLNNNSLSGRIPRWLGNLTWLQYIIMPNNHLEGLIPVEFCQLDSLQILDIS 397
              K  +L  L +++N  SG +P W+G ++ L Y+ M  N L+G  P    Q   ++++DIS
Sbjct:   647 LKSKNLTLLDISDNRFSGMLPLWIGRISRLSYLYMSGNQLKGPFPF-LRQSPWVEVMDIS 705

Query:   398 DNNISGSLPACFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSI 453
              N+ SGS+P   +  S++++ L  N   G L  G  F  + L  LDL  N  +G I
Sbjct:   706 HNSFSGSIPRNVNFPSLRELRLQNNEFTG-LVPGNLFKAAGLEVLDLRNNNFSGKI 760


GO:0005575 "cellular_component" evidence=ND
GO:0007165 "signal transduction" evidence=IC
GO:0006457 "protein folding" evidence=RCA
GO:0006857 "oligopeptide transport" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091353 AT3G28040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00181071
annotation not avaliable (645 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query456
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-48
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-42
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-39
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-34
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-08
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  178 bits (452), Expect = 2e-48
 Identities = 153/444 (34%), Positives = 236/444 (53%), Gaps = 18/444 (4%)

Query: 15  IGESMPSLKYLSLSDSNSSRILDRGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILD 74
           I  +  SL+YL+LS++N +  + RG  S+ +L+ L + NN L G +P  + + +SL++LD
Sbjct: 113 IFTTSSSLRYLNLSNNNFTGSIPRG--SIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLD 170

Query: 75  VSSNQLTGSISSSPLVHLTSIEELMLSNNHF--QIPISLEPFFNHSRLKFFYAENNQINA 132
           +  N L G I +S L +LTS+E L L++N    QIP  L    +   LK+ Y   N ++ 
Sbjct: 171 LGGNVLVGKIPNS-LTNLTSLEFLTLASNQLVGQIPRELGQMKS---LKWIYLGYNNLSG 226

Query: 133 EITQSHSLIPPKFQLSRLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLE 192
           EI      I     L+ L L      G   P  L +  +L+Y+ L   K++G  P  +  
Sbjct: 227 EIPYE---IGGLTSLNHLDLVYNNLTG-PIPSSLGNLKNLQYLFLYQNKLSGPIPPSIF- 281

Query: 193 NNTKLIQLSVVNDSLAGPFRLPIHSHKQLRLLDISTNNFRGHIPVEIGDVLPSLYVFNNS 252
           +  KLI L + ++SL+G     +   + L +L + +NNF G IPV +   LP L V    
Sbjct: 282 SLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTS-LPRLQVLQLW 340

Query: 253 MNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLESLALSNNNLEGHMFSR 312
            N   G IP + G    L +LDLS N+LTGEIPE L     NL  L L +N+LEG +   
Sbjct: 341 SNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLC-SSGNLFKLILFSNSLEGEIPKS 399

Query: 313 NFNLANLKLLQLEGNRFVGEIPQSLSKCSSLEGLHLNNNSLSGRIPRWLGNLTWLQYIIM 372
                +L+ ++L+ N F GE+P   +K   +  L ++NN+L GRI     ++  LQ + +
Sbjct: 400 LGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSL 459

Query: 373 PNNHLEGLIPVEFCQLDSLQILDISDNNISGSLPACFHPLS-IKQVHLSKNMLHGQLKRG 431
             N   G +P +      L+ LD+S N  SG++P     LS + Q+ LS+N L G++   
Sbjct: 460 ARNKFFGGLP-DSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPD- 517

Query: 432 TFFNCSSLVTLDLSYNRLNGSIPD 455
              +C  LV+LDLS+N+L+G IP 
Sbjct: 518 ELSSCKKLVSLDLSHNQLSGQIPA 541


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 456
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.93
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
KOG4237498 consensus Extracellular matrix protein slit, conta 99.82
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.77
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.67
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.67
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.48
KOG0617264 consensus Ras suppressor protein (contains leucine 99.47
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.23
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.22
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.2
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.17
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.12
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.07
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.05
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.02
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.02
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.01
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.98
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.9
KOG4341483 consensus F-box protein containing LRR [General fu 98.89
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.88
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.87
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.84
PLN03150623 hypothetical protein; Provisional 98.83
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.83
PLN03150623 hypothetical protein; Provisional 98.82
KOG4341483 consensus F-box protein containing LRR [General fu 98.81
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.79
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.71
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.61
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.47
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.44
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.38
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.38
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.28
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.26
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.22
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.22
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.11
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.98
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.97
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.94
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.94
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.94
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.93
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.89
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.88
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.78
PRK15386 426 type III secretion protein GogB; Provisional 97.78
PRK15386 426 type III secretion protein GogB; Provisional 97.71
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.55
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.49
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.26
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.17
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.79
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.49
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.46
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.8
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.68
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.95
KOG4308 478 consensus LRR-containing protein [Function unknown 92.51
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.88
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.51
smart0037026 LRR Leucine-rich repeats, outliers. 91.51
KOG4308478 consensus LRR-containing protein [Function unknown 88.92
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.63
smart0037026 LRR Leucine-rich repeats, outliers. 88.63
KOG0473326 consensus Leucine-rich repeat protein [Function un 87.9
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 86.89
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 82.35
KOG0473 326 consensus Leucine-rich repeat protein [Function un 81.03
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.2e-45  Score=381.21  Aligned_cols=441  Identities=31%  Similarity=0.479  Sum_probs=309.1

Q ss_pred             ccccccchhhhHHhhcCCCccEEeccCCCCCCcccccccCCCCCcEEEcccCcccccchhhhhcCCCCcEEeccCCcccc
Q 048657            3 TRIALNTSFLQIIGESMPSLKYLSLSDSNSSRILDRGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTG   82 (456)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~i~~   82 (456)
                      ++|.+.+.+|..+.. +++|++|++++|.+....+..+.++++|++|++++|.+.+..|..+.++++|++|++++|.+++
T Consensus       148 s~n~~~~~~p~~~~~-l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~  226 (968)
T PLN00113        148 SNNMLSGEIPNDIGS-FSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSG  226 (968)
T ss_pred             cCCcccccCChHHhc-CCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCC
Confidence            345555556666655 6666666666665443333455666666666666666655556666666666666666666654


Q ss_pred             ccCCCCCcCCCCccEEEcCCceeeeccCCCcccccccceEEeccCcccccccccCcCCCCCccccceeeccCCCCCCCCc
Q 048657           83 SISSSPLVHLTSIEELMLSNNHFQIPISLEPFFNHSRLKFFYAENNQINAEITQSHSLIPPKFQLSRLSLSSGYEDGVTF  162 (456)
Q Consensus        83 ~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~  162 (456)
                      .++. .+.++++|++|++++|.+.+ ..+..+..+++|+.|++++|.+....+..   +....+|+.|++..+ .....+
T Consensus       227 ~~p~-~l~~l~~L~~L~L~~n~l~~-~~p~~l~~l~~L~~L~L~~n~l~~~~p~~---l~~l~~L~~L~Ls~n-~l~~~~  300 (968)
T PLN00113        227 EIPY-EIGGLTSLNHLDLVYNNLTG-PIPSSLGNLKNLQYLFLYQNKLSGPIPPS---IFSLQKLISLDLSDN-SLSGEI  300 (968)
T ss_pred             cCCh-hHhcCCCCCEEECcCceecc-ccChhHhCCCCCCEEECcCCeeeccCchh---HhhccCcCEEECcCC-eeccCC
Confidence            4444 55566666666666665542 23344555666666666666554322211   123346666666433 233345


Q ss_pred             hHHhhcCCCccEEEecCcccccccchhhhhccccceeeeecccCcCCCCCcCccCCccccEEeCCCCccCCCCchhhhcc
Q 048657          163 PKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLIQLSVVNDSLAGPFRLPIHSHKQLRLLDISTNNFRGHIPVEIGDV  242 (456)
Q Consensus       163 ~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~  242 (456)
                      +..+..+++|+.|++++|.+.+..+.. +..+++|+.|++.+|.+....+..++.+++|+.|++++|.+.+..|..+.. 
T Consensus       301 p~~~~~l~~L~~L~l~~n~~~~~~~~~-~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~-  378 (968)
T PLN00113        301 PELVIQLQNLEILHLFSNNFTGKIPVA-LTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCS-  378 (968)
T ss_pred             ChhHcCCCCCcEEECCCCccCCcCChh-HhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhC-
Confidence            556666667777777766665555544 355667777777777666666666666777777777777766555555443 


Q ss_pred             CCcceEEEccCCccCCCccccccCCCCCcEEeccCCcCCCcccchhhcCCCcccEEEccCCcccccccccccccccccEE
Q 048657          243 LPSLYVFNNSMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLESLALSNNNLEGHMFSRNFNLANLKLL  322 (456)
Q Consensus       243 ~~~L~~l~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L  322 (456)
                      +++++.+++..|.+.+.+|..+..+++|+.|++++|.+.+..+..+ ..+++|+.+++++|.+.+..+..+..+++|+.|
T Consensus       379 ~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~-~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L  457 (968)
T PLN00113        379 SGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEF-TKLPLVYFLDISNNNLQGRINSRKWDMPSLQML  457 (968)
T ss_pred             cCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhH-hcCCCCCEEECcCCcccCccChhhccCCCCcEE
Confidence            5677777777777777777777778888888888887775555543 367788888888888777666666678888888


Q ss_pred             EccCccccccccccccCCCCCcEEEcCCCcCccccCccccCCCCCcEEEcCCCcccccCchhccCCCCCCeEeCcCCccC
Q 048657          323 QLEGNRFVGEIPQSLSKCSSLEGLHLNNNSLSGRIPRWLGNLTWLQYIIMPNNHLEGLIPVEFCQLDSLQILDISDNNIS  402 (456)
Q Consensus       323 ~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~  402 (456)
                      ++++|.+.+..|..+ ..++|+.|++++|.+++..|..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.++
T Consensus       458 ~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~  536 (968)
T PLN00113        458 SLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLS  536 (968)
T ss_pred             ECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCccc
Confidence            888888876666544 4578999999999998888888999999999999999999888999999999999999999999


Q ss_pred             CCCCcccc-cccccEEEccCcccCCCCCcccccCCCcceEEEccCcccCCCCCC
Q 048657          403 GSLPACFH-PLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSIPD  455 (456)
Q Consensus       403 ~~~~~~~~-~~~L~~l~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~p~  455 (456)
                      +..+..+. +++|+.|++++|++.+.+|.. +..+++|+.|++++|++.+.+|+
T Consensus       537 ~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~-l~~l~~L~~l~ls~N~l~~~~p~  589 (968)
T PLN00113        537 GQIPASFSEMPVLSQLDLSQNQLSGEIPKN-LGNVESLVQVNISHNHLHGSLPS  589 (968)
T ss_pred             ccCChhHhCcccCCEEECCCCcccccCChh-HhcCcccCEEeccCCcceeeCCC
Confidence            88887765 689999999999998888877 78899999999999999999985



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query456
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-31
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-11
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-31
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-11
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-09
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-07
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 5e-04
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 5e-04
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 5e-04
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 5e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 133 bits (334), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 143/521 (27%), Positives = 224/521 (42%), Gaps = 123/521 (23%) Query: 14 IIGESMPSLKYLSLSDSNSSRILDRGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRIL 73 ++ + LK+L++S + S +D C V+L+ L + +N+ +P+ L + ++L+ L Sbjct: 172 VLSDGCGELKHLAISGNKISGDVDVSRC--VNLEFLDVSSNNFSTGIPF-LGDCSALQHL 228 Query: 74 DVSSNQLTGSISSSPLVHLTSIEELMLSNNHFQIPISLEPFFNHSRLKFFYAENNQINAE 133 D+S N+L+G S + + T ++ L +S+N F PI P L++ N+ E Sbjct: 229 DISGNKLSGDFSRA-ISTCTELKLLNISSNQFVGPIPPLPL---KSLQYLSLAENKFTGE 284 Query: 134 ITQSHSLIPPKF------QLSRLSLSSGYEDGVTFPKF---------------------- 165 I P F L+ L LS + G P F Sbjct: 285 I--------PDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPM 336 Query: 166 --LYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLIQLSVVNDSLAGPF--RLPIHSHKQL 221 L L+ +DLS + +GE P L + L+ L + +++ +GP L + L Sbjct: 337 DTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTL 396 Query: 222 RLLDISTNNFRGHIPVEIGDV--LPSLYVFNNSMNALDGSIPSSFGNMKFLQILDLSNNH 279 + L + N F G IP + + L SL++ S N L G+IPSS G++ L+ L L N Sbjct: 397 QELYLQNNGFTGKIPPTLSNCSELVSLHL---SFNYLSGTIPSSLGSLSKLRDLKLWLNM 453 Query: 280 LTGEIPEHLAVGCVXXXXXXXXXXXXXGHMFSRNFNLANLKLLQLEGNRFVGEIPQSLSK 339 L GEIP+ L M+ + L+ L L+ N GEIP LS Sbjct: 454 LEGEIPQEL--------------------MYVKT-----LETLILDFNDLTGEIPSGLSN 488 Query: 340 CSSLEGLHLNNNSLSGRIPRWLGNLTWLQYIIMPNNHLEGLIPVEFCQLDSLQILDISDN 399 C++L + L+NN L+G IP+W+G L L + + NN G IP E SL LD++ N Sbjct: 489 CTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTN 548 Query: 400 NISGSLPACFHPLS---------------------IKQVHLSKNMLHGQLKRG------- 431 +G++PA S K+ H + N+L Q R Sbjct: 549 LFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLS 608 Query: 432 ------------------TFFNCSSLVTLDLSYNRLNGSIP 454 TF N S++ LD+SYN L+G IP Sbjct: 609 TRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIP 649
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query456
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-89
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-85
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-81
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-75
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-73
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-73
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-60
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-39
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-54
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-40
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-34
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-32
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-53
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-46
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-45
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-32
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-53
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-50
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-48
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-41
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-37
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-30
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-51
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-48
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-28
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-47
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-42
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-38
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-34
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-41
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-40
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-44
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-41
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-41
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-37
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-40
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-36
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-33
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-30
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-34
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-28
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-17
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-26
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-25
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-25
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-21
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-25
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-24
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-23
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-20
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-13
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-15
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-13
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-12
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-19
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 3e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-19
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-12
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-11
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-09
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-13
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-11
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 3e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-05
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 5e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-08
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 4e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 2e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  286 bits (733), Expect = 6e-89
 Identities = 124/466 (26%), Positives = 195/466 (41%), Gaps = 43/466 (9%)

Query: 18  SMPSLKYLSLSDSN-SSRILDRGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVS 76
               LK+L++S +  S  +    +   V+L+ L + +N+    +P+ L + ++L+ LD+S
Sbjct: 176 GCGELKHLAISGNKISGDV---DVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDIS 231

Query: 77  SNQLTGSISSSPLVHLTSIEELMLSNNHFQIPISLEPFFNHSRLKFFYAENNQINAEITQ 136
            N+L+G  S + +   T ++ L +S+N F  PI   P      L++     N+   EI  
Sbjct: 232 GNKLSGDFSRA-ISTCTELKLLNISSNQFVGPI---PPLPLKSLQYLSLAENKFTGEIPD 287

Query: 137 SHSLIPPKFQLSRLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTK 196
             S       L+ L LS  +  G   P F      LE + LS    +GE P   L     
Sbjct: 288 FLSGACDT--LTGLDLSGNHFYG-AVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRG 344

Query: 197 LIQLSVVNDSLAGPFRLPIHS-HKQLRLLDISTNNFRGHIPVEIGDV-LPSLYVFNNSMN 254
           L  L +  +  +G     + +    L  LD+S+NNF G I   +      +L       N
Sbjct: 345 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 404

Query: 255 ALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLESLALSNNNLEGHMFSRNF 314
              G IP +  N   L  L LS N+L+G IP  L      L  L L  N LEG +     
Sbjct: 405 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG-SLSKLRDLKLWLNMLEGEIPQELM 463

Query: 315 NLANLKLLQLEGNRFVGEIPQSLSKCSSLEGLHLNNNSLSGRIPRWLGNLTWLQYIIMPN 374
            +  L+ L L+ N   GEIP  LS C++L  + L+NN L+G IP+W+G L  L  + + N
Sbjct: 464 YVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSN 523

Query: 375 NHLEGLIPVEFCQLDSLQILDISDNNISGSLPACFHPLSIKQVHLSKNMLHGQLKRG--- 431
           N   G IP E     SL  LD++ N  +G++PA     S     ++ N + G+       
Sbjct: 524 NSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQS---GKIAANFIAGKRYVYIKN 580

Query: 432 ----------------------TFFNCSSLVTLDLSYNRLNGSIPD 455
                                      S+    +++     G    
Sbjct: 581 DGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSP 626


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query456
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.98
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.86
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.81
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.75
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.69
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.69
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.69
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.6
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.56
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.54
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.52
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.52
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.34
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.32
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.31
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.3
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.28
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.26
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.22
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.1
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.82
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.72
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.61
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.51
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.49
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.48
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.18
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.0
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.33
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.31
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.75
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.75
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 85.14
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 81.71
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=9.9e-49  Score=398.16  Aligned_cols=439  Identities=32%  Similarity=0.432  Sum_probs=326.4

Q ss_pred             ccccccchhhhHHhhcCCCccEEeccCCCCCCcccccccCCCCCcEEEcccCcccccchhhhhcCCCCcEEeccCCcccc
Q 048657            3 TRIALNTSFLQIIGESMPSLKYLSLSDSNSSRILDRGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTG   82 (456)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~i~~   82 (456)
                      ++|.+.+..+.  .. +++|++|++++|.++...+. +.++++|++|++++|.+++..|..+..+++|++|++++|.+++
T Consensus       186 s~n~l~~~~~~--~~-l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~  261 (768)
T 3rgz_A          186 SGNKISGDVDV--SR-CVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVG  261 (768)
T ss_dssp             CSSEEESCCBC--TT-CTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEE
T ss_pred             CCCcccccCCc--cc-CCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccC
Confidence            56777776654  55 88888888888887665543 7888888888888888887778888888888888888888775


Q ss_pred             ccCCCCCcCCCCccEEEcCCceeeeccCCCcccccccceEEeccCcccccccccCcCCCCCccccceeeccCCCCCCCCc
Q 048657           83 SISSSPLVHLTSIEELMLSNNHFQIPISLEPFFNHSRLKFFYAENNQINAEITQSHSLIPPKFQLSRLSLSSGYEDGVTF  162 (456)
Q Consensus        83 ~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~  162 (456)
                      .++.  . .+++|++|++++|.+.+..+......+++|+.|++++|.+.......+   ....+|+.|++..+... +.+
T Consensus       262 ~~~~--~-~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~---~~l~~L~~L~L~~n~l~-~~i  334 (768)
T 3rgz_A          262 PIPP--L-PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFF---GSCSLLESLALSSNNFS-GEL  334 (768)
T ss_dssp             SCCC--C-CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGG---GGCTTCCEEECCSSEEE-EEC
T ss_pred             ccCc--c-ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHH---hcCCCccEEECCCCccc-CcC
Confidence            5554  2 667777777777777644443333334677777777776654332222   22335555555333221 122


Q ss_pred             hH-HhhcCCCccEEEecCcccccccchhhhh--------------------------ccccceeeeecccCcCCCCCcCc
Q 048657          163 PK-FLYHQHDLEYVDLSHIKMNGEFPTWLLE--------------------------NNTKLIQLSVVNDSLAGPFRLPI  215 (456)
Q Consensus       163 ~~-~l~~~~~L~~L~l~~~~~~~~~~~~~~~--------------------------~~~~L~~L~l~~~~~~~~~~~~l  215 (456)
                      +. .+..+++|+.|++++|.+.+.++..+..                          .++.|++|++.+|.+.+..+..+
T Consensus       335 p~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l  414 (768)
T 3rgz_A          335 PMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL  414 (768)
T ss_dssp             CHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGG
T ss_pred             CHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHH
Confidence            22 2444555555555555444333333211                          14566677777766666666777


Q ss_pred             cCCccccEEeCCCCccCCCCchhhhccCCcceEEEccCCccCCCccccccCCCCCcEEeccCCcCCCcccchhhcCCCcc
Q 048657          216 HSHKQLRLLDISTNNFRGHIPVEIGDVLPSLYVFNNSMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLAVGCVNL  295 (456)
Q Consensus       216 ~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~L  295 (456)
                      ..+++|+.|++++|.+.+..|..+.. +++|+.++++.|.+.+.+|..+..+++|++|++++|.+.+.+|..+ ..+++|
T Consensus       415 ~~l~~L~~L~Ls~N~l~~~~p~~l~~-l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l-~~l~~L  492 (768)
T 3rgz_A          415 SNCSELVSLHLSFNYLSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGL-SNCTNL  492 (768)
T ss_dssp             GGCTTCCEEECCSSEEESCCCGGGGG-CTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGG-GGCTTC
T ss_pred             hcCCCCCEEECcCCcccCcccHHHhc-CCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHH-hcCCCC
Confidence            78888888888888887667766654 7888888888888888888888888889999998888886666654 478889


Q ss_pred             cEEEccCCcccccccccccccccccEEEccCccccccccccccCCCCCcEEEcCCCcCccccCcc---------------
Q 048657          296 ESLALSNNNLEGHMFSRNFNLANLKLLQLEGNRFVGEIPQSLSKCSSLEGLHLNNNSLSGRIPRW---------------  360 (456)
Q Consensus       296 ~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~---------------  360 (456)
                      ++|++++|++.+..+.++..+++|+.|++++|.+.+..|..+..+++|++|++++|.+++.+|..               
T Consensus       493 ~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~  572 (768)
T 3rgz_A          493 NWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAG  572 (768)
T ss_dssp             CEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCS
T ss_pred             CEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccc
Confidence            99999999888888888888899999999999998888888889999999999988876555433               


Q ss_pred             -------------------------------------------------------ccCCCCCcEEEcCCCcccccCchhc
Q 048657          361 -------------------------------------------------------LGNLTWLQYIIMPNNHLEGLIPVEF  385 (456)
Q Consensus       361 -------------------------------------------------------~~~~~~L~~L~l~~~~~~~~~~~~~  385 (456)
                                                                             +..+++|+.|++++|.+++.+|..+
T Consensus       573 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l  652 (768)
T 3rgz_A          573 KRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEI  652 (768)
T ss_dssp             CEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGG
T ss_pred             ccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHH
Confidence                                                                   3345778899999999998899999


Q ss_pred             cCCCCCCeEeCcCCccCCCCCcccc-cccccEEEccCcccCCCCCcccccCCCcceEEEccCcccCCCCCC
Q 048657          386 CQLDSLQILDISDNNISGSLPACFH-PLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSIPD  455 (456)
Q Consensus       386 ~~~~~L~~L~l~~~~l~~~~~~~~~-~~~L~~l~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~p~  455 (456)
                      ..+++|+.|++++|.+++.+|..+. .++|++||+++|++.+.+|.. +..+++|+.|++++|+++|.||+
T Consensus       653 ~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~-l~~l~~L~~L~ls~N~l~g~iP~  722 (768)
T 3rgz_A          653 GSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQA-MSALTMLTEIDLSNNNLSGPIPE  722 (768)
T ss_dssp             GGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGG-GGGCCCCSEEECCSSEEEEECCS
T ss_pred             hccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChH-HhCCCCCCEEECcCCcccccCCC
Confidence            9999999999999999988887765 789999999999999888887 88899999999999999999995



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 456
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-12
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 3e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 88.5 bits (218), Expect = 8e-20
 Identities = 72/364 (19%), Positives = 130/364 (35%), Gaps = 30/364 (8%)

Query: 43  LVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELMLSN 102
           L  +  L  D   ++ S+   +  + +L  ++ S+NQLT      PL +LT + +++++N
Sbjct: 43  LDQVTTLQADRLGIK-SIDG-VEYLNNLTQINFSNNQLTDIT---PLKNLTKLVDILMNN 97

Query: 103 NHFQIPISLEPFFNHSRLKFFYAENNQINAEITQSHSLIPPKFQLSRLSLSSGYEDGVTF 162
           N       L    N + L  F  +   I+     ++         +   +S+        
Sbjct: 98  NQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQ 157

Query: 163 PKFLYHQH-------DLEYVDLSHIKMNGEFPTWLLENNTKLIQLSVVNDSLAGPFRLPI 215
                +Q        +L  ++   I  N      +L   T L  L   N+ ++     P+
Sbjct: 158 QLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDIT--PL 215

Query: 216 HSHKQLRLLDISTNNFRGHIPVEIGDVLPSLYVFNNSMNALDGSIPSSFGNMKFLQILDL 275
                L  L ++ N  +    +     L +L   + + N +    P     +  L  L L
Sbjct: 216 GILTNLDELSLNGNQLKDIGTLAS---LTNLTDLDLANNQISNLAP--LSGLTKLTELKL 270

Query: 276 SNNHLTGEIPEHLAVGCVNLESLALSNNNLEGHMFSRNFNLANLKLLQLEGNRFVGEIPQ 335
             N ++   P        N     L  N  +    S   NL NL  L L  N      P 
Sbjct: 271 GANQISNISPLAGLTALTN-----LELNENQLEDISPISNLKNLTYLTLYFNNISDISP- 324

Query: 336 SLSKCSSLEGLHLNNNSLSGRIPRWLGNLTWLQYIIMPNNHLEGLIPVEFCQLDSLQILD 395
            +S  + L+ L   NN +S      L NLT + ++   +N +  L P     L  +  L 
Sbjct: 325 -VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP--LANLTRITQLG 379

Query: 396 ISDN 399
           ++D 
Sbjct: 380 LNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query456
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.68
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.66
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.25
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.18
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.99
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.9
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.39
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.38
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.95  E-value=1.6e-25  Score=207.70  Aligned_cols=341  Identities=23%  Similarity=0.260  Sum_probs=196.1

Q ss_pred             CCCccEEeccCCCCCCcccccccCCCCCcEEEcccCcccccchhhhhcCCCCcEEeccCCccccccCCCCCcCCCCccEE
Q 048657           19 MPSLKYLSLSDSNSSRILDRGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEEL   98 (456)
Q Consensus        19 ~~~L~~L~L~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~i~~~~~~~~~~~l~~L~~L   98 (456)
                      +.+|++|+++++.++++  +++..+++|++|++++|++++. + .+.++++|++|++++|+++ .++.  +.++++|+.|
T Consensus        43 l~~l~~L~l~~~~I~~l--~gl~~L~nL~~L~Ls~N~l~~l-~-~l~~L~~L~~L~L~~n~i~-~i~~--l~~l~~L~~L  115 (384)
T d2omza2          43 LDQVTTLQADRLGIKSI--DGVEYLNNLTQINFSNNQLTDI-T-PLKNLTKLVDILMNNNQIA-DITP--LANLTNLTGL  115 (384)
T ss_dssp             HTTCCEEECCSSCCCCC--TTGGGCTTCCEEECCSSCCCCC-G-GGTTCTTCCEEECCSSCCC-CCGG--GTTCTTCCEE
T ss_pred             hCCCCEEECCCCCCCCc--cccccCCCCCEEeCcCCcCCCC-c-cccCCcccccccccccccc-cccc--cccccccccc
Confidence            45677777777776665  2566677777777777777633 2 2667777777777777766 4442  6667777777


Q ss_pred             EcCCceeeeccCCCcccccccceEEeccCcccccccccCcCCCCCccccceeeccCCCCCCCCchHHhhcCCCccEEEec
Q 048657           99 MLSNNHFQIPISLEPFFNHSRLKFFYAENNQINAEITQSHSLIPPKFQLSRLSLSSGYEDGVTFPKFLYHQHDLEYVDLS  178 (456)
Q Consensus        99 ~l~~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~l~~~~~L~~L~l~  178 (456)
                      +++++.+...   ........+.......+.+........                            ............
T Consensus       116 ~~~~~~~~~~---~~~~~~~~~~~~~~~~~~l~~~~~~~~----------------------------~~~~~~~~~~~~  164 (384)
T d2omza2         116 TLFNNQITDI---DPLKNLTNLNRLELSSNTISDISALSG----------------------------LTSLQQLSFGNQ  164 (384)
T ss_dssp             ECCSSCCCCC---GGGTTCTTCSEEEEEEEEECCCGGGTT----------------------------CTTCSEEEEEES
T ss_pred             cccccccccc---ccccccccccccccccccccccccccc----------------------------cccccccccccc
Confidence            7776655421   112223333333333332211110000                            000000111111


Q ss_pred             CcccccccchhhhhccccceeeeecccCcCCCCCcCccCCccccEEeCCCCccCCCCchhhhccCCcceEEEccCCccCC
Q 048657          179 HIKMNGEFPTWLLENNTKLIQLSVVNDSLAGPFRLPIHSHKQLRLLDISTNNFRGHIPVEIGDVLPSLYVFNNSMNALDG  258 (456)
Q Consensus       179 ~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~  258 (456)
                      .....     . ..............+..  ........+++++.++++++.+.+..+.   ...++|+.+++.++.+..
T Consensus       165 ~~~~~-----~-~~~~~~~~~~~~~~~~~--~~~~~~~~l~~~~~l~l~~n~i~~~~~~---~~~~~L~~L~l~~n~l~~  233 (384)
T d2omza2         165 VTDLK-----P-LANLTTLERLDISSNKV--SDISVLAKLTNLESLIATNNQISDITPL---GILTNLDELSLNGNQLKD  233 (384)
T ss_dssp             CCCCG-----G-GTTCTTCCEEECCSSCC--CCCGGGGGCTTCSEEECCSSCCCCCGGG---GGCTTCCEEECCSSCCCC
T ss_pred             cchhh-----h-hcccccccccccccccc--ccccccccccccceeeccCCccCCCCcc---cccCCCCEEECCCCCCCC
Confidence            10000     0 11111112222222111  1122345556677777777766532221   225677777777776653


Q ss_pred             CccccccCCCCCcEEeccCCcCCCcccchhhcCCCcccEEEccCCcccccccccccccccccEEEccCcccccccccccc
Q 048657          259 SIPSSFGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLESLALSNNNLEGHMFSRNFNLANLKLLQLEGNRFVGEIPQSLS  338 (456)
Q Consensus       259 ~~~~~l~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~  338 (456)
                        ...+..+++|+.++++++.+. .++.  +..+++|++++++++++.+..  .+..++.++.+.+.++.+.+  ...+.
T Consensus       234 --~~~l~~l~~L~~L~l~~n~l~-~~~~--~~~~~~L~~L~l~~~~l~~~~--~~~~~~~l~~l~~~~n~l~~--~~~~~  304 (384)
T d2omza2         234 --IGTLASLTNLTDLDLANNQIS-NLAP--LSGLTKLTELKLGANQISNIS--PLAGLTALTNLELNENQLED--ISPIS  304 (384)
T ss_dssp             --CGGGGGCTTCSEEECCSSCCC-CCGG--GTTCTTCSEEECCSSCCCCCG--GGTTCTTCSEEECCSSCCSC--CGGGG
T ss_pred             --cchhhcccccchhccccCccC-CCCc--ccccccCCEeeccCcccCCCC--cccccccccccccccccccc--ccccc
Confidence              235667777888888877776 3332  235677888888877776533  24567777888888877753  23466


Q ss_pred             CCCCCcEEEcCCCcCccccCccccCCCCCcEEEcCCCcccccCchhccCCCCCCeEeCcCCccCCCCCcccccccccEEE
Q 048657          339 KCSSLEGLHLNNNSLSGRIPRWLGNLTWLQYIIMPNNHLEGLIPVEFCQLDSLQILDISDNNISGSLPACFHPLSIKQVH  418 (456)
Q Consensus       339 ~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~L~~l~  418 (456)
                      .+++++.|++++|.+++..  .+..+++|++|++++|.+++.  ..+..+++|++|++++|++++..+ ...+++|++|+
T Consensus       305 ~~~~l~~L~ls~n~l~~l~--~l~~l~~L~~L~L~~n~l~~l--~~l~~l~~L~~L~l~~N~l~~l~~-l~~l~~L~~L~  379 (384)
T d2omza2         305 NLKNLTYLTLYFNNISDIS--PVSSLTKLQRLFFANNKVSDV--SSLANLTNINWLSAGHNQISDLTP-LANLTRITQLG  379 (384)
T ss_dssp             GCTTCSEEECCSSCCSCCG--GGGGCTTCCEEECCSSCCCCC--GGGGGCTTCCEEECCSSCCCBCGG-GTTCTTCSEEE
T ss_pred             hhcccCeEECCCCCCCCCc--ccccCCCCCEEECCCCCCCCC--hhHcCCCCCCEEECCCCcCCCChh-hccCCCCCEee
Confidence            7788888888888776432  377788888888888887643  357778888888888888876543 44467888888


Q ss_pred             ccCc
Q 048657          419 LSKN  422 (456)
Q Consensus       419 l~~~  422 (456)
                      +++|
T Consensus       380 L~~N  383 (384)
T d2omza2         380 LNDQ  383 (384)
T ss_dssp             CCCE
T ss_pred             CCCC
Confidence            8876



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure