Citrus Sinensis ID: 048677

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13

MHGYKGCLETERTALLEIKSFFISSVSDNKILPSWVGEDDGMPSDCCDDWEGVKCNATTRRVMQLSLNNTKRLNHYYGTSASLLNMSLFHPFEELQRLDLLGNWFTGIYENRAYDSFGSLKQLKILDLG

ccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEccccccEEEEEccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccc

cccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccHHccccEEEcccccEEEEEEcccccccccccccccccEEHHHcccHHHHHcccccccccccccccccHHHHHccccccEEccc

MHGYKGCLETERTALLEIKSFFIssvsdnkilpswvgeddgmpsdccddwegvkcnaTTRRVMQLSLNNTKRLNHYYGTSASLlnmslfhpfeelqRLDLLGNWftgiyenraydsfgslkqlkildlg

MHGYKGCLETERTALLEIKSFFISSVSDNKILPSWVGEDDGMPSDCCDDWEGVKCNATTRRVMQLSLNNTKRLNHYYGTSASLLNMSLFHPFEELQRLDLLGNWFTGIYENraydsfgslkqlkildlg

MHGYKGCLETERTALLEIKSFFISSVSDNKILPSWVGEDDGMPSDCCDDWEGVKCNATTRRVMQLSLNNTKRLNHYYGTSASLLNMSLFHPFEELQRLDLLGNWFTGIYENRAYDSFGSLKQLKILDLG

*****GCLETERTALLEIKSFFISSVSDNKILPSWVGEDDGMPSDCCDDWEGVKCNATTRRVMQLSLNNTKRLNHYYGTSASLLNMSLFHPFEELQRLDLLGNWFTGIYENRAYDSFGSLKQLKIL***

****KGCLETERTALLEIKSFFISSVSDNKILPSWVGEDDGMPSDCCDDWEGVKCNATTRRVMQLSLNNTKRLNHYYGTSASLLNMSLFHPFEELQRLDLLGNWFTGIYENRAYDSFGSLKQLKILDLG

MHGYKGCLETERTALLEIKSFFISSVSDNKILPSWVGEDDGMPSDCCDDWEGVKCNATTRRVMQLSLNNTKRLNHYYGTSASLLNMSLFHPFEELQRLDLLGNWFTGIYENRAYDSFGSLKQLKILDLG

**GYKGCLETERTALLEIKSFFISSVS**KILPSWVGEDDGMPSDCCDDWEGVKCNATTRRVMQLSLNNTKRLNHYYGTSASLLNMSLFHPFEELQRLDLLGNWFTGIYENRAYDSFGSLKQLKILDLG

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MHGYKGCLETERTALLEIKSFFISSVSDNKILPSWVGEDDGMPSDCCDDWEGVKCNATTRRVMQLSLNNTKRLNHYYGTSASLLNMSLFHPFEELQRLDLLGNWFTGIYENRAYDSFGSLKQLKILDLG

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		129	2.2.26 [Sep-21-2011]
Q0WR59		1048	Probable inactive recepto	no	no	0.875	0.107	0.304	9e-06
C0LGP4		1010	Probable LRR receptor-lik	no	no	0.798	0.101	0.346	0.0008

>sp\|Q0WR59\|Y5020_ARATH Probable inactive receptor kinase At5g10020 OS=Arabidopsis thaliana GN=At5g10020 PE=1 SV=2	Back alignment and function desciption

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 54/128 (42%), Gaps = 15/128 (11%)

Query: 2   HGYKGCLETERTALLEIKSFFISSVSDNKILPSWVGEDDGM-PSDCCDDWEGVKCNATTR 60
           HG     ETE  +LLE +       S  +I  SW        PS C +DW G+ C+  T 
Sbjct: 17  HGANAVTETELRSLLEFRKGIRDETSHQRI--SWSDTSSLTDPSTCPNDWPGISCDPETG 74

Query: 61  RVMQLSLNNTKRLNHYYGTSASLLNMSLFHPFEELQRLDLLGNWFTGIYENRAYDSFGSL 120
            ++ ++L+         G S   L  S       L+ L L GN F+G    R   S G +
Sbjct: 75  SIIAINLDR-------RGLSGE-LKFSTLSGLTRLRNLSLSGNSFSG----RVVPSLGGI 122

Query: 121 KQLKILDL 128
             L+ LDL
Sbjct: 123 SSLQHLDL 130

Arabidopsis thaliana (taxid: 3702)

>sp\|C0LGP4\|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		129
297745031		869	unnamed protein product [Vitis vinifera]	0.968	0.143	0.474	3e-24
359483099		1231	PREDICTED: probable LRR receptor-like se	0.945	0.099	0.451	2e-19
359482745		1026	PREDICTED: leucine-rich repeat receptor	0.945	0.118	0.429	2e-18
359482725		1144	PREDICTED: leucine-rich repeat receptor	0.945	0.106	0.437	3e-18
225465991		1031	PREDICTED: LRR receptor-like serine/thre	0.868	0.108	0.451	4e-18
359482749		1067	PREDICTED: leucine-rich repeat receptor	0.945	0.114	0.443	6e-18
359482757		1027	PREDICTED: LRR receptor-like serine/thre	0.945	0.118	0.422	8e-18
359482735		1097	PREDICTED: receptor-like protein 12-like	0.937	0.110	0.440	1e-17
240256417		908	receptor like protein 56 [Arabidopsis th	0.914	0.129	0.401	2e-17
10177158		888	disease resistance protein-like [Arabido	0.914	0.132	0.401	2e-17

>gi\|297745031\|emb\|CBI38623.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 88/137 (64%), Gaps = 12/137 (8%)

Query: 1   MHGYKGCLETERTALLEIKSFFISSVSD-NKILPSWVGEDDGMPSDCCDDWEGVKCNATT 59
           +HGYK CLE ER  LLE K F  S+  D +++LPSWV +++   SDCC  WE V CN+TT
Sbjct: 19  IHGYKCCLEKERMGLLEFKRFLRSNNEDADRLLPSWVNDEE---SDCCY-WERVVCNSTT 74

Query: 60  RRVMQLSLNNTKRLNHY---YGTSAS----LLNMSLFHPFEELQRLDLLGNWFTGIYENR 112
             V QLSLNN +++  Y   YG +       LN+SLFHPFEEL  LDL  NWF    E++
Sbjct: 75  GTVTQLSLNNIRQIEFYHRVYGLAPPKKTWFLNVSLFHPFEELVSLDLSENWFADSLEDQ 134

Query: 113 AYDSFGSLKQLKILDLG 129
            ++    LK+L++L++G
Sbjct: 135 GFEKLKGLKKLEMLNIG 151

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359483099\|ref\|XP_002262931.2\| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359482745\|ref\|XP_003632825.1\| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359482725\|ref\|XP_003632817.1\| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225465991\|ref\|XP_002264576.1\| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359482749\|ref\|XP_002262614.2\| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359482757\|ref\|XP_002268914.2\| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359482735\|ref\|XP_003632821.1\| PREDICTED: receptor-like protein 12-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|240256417\|ref\|NP_199740.4\| receptor like protein 56 [Arabidopsis thaliana] gi\|332008410\|gb\|AED95793.1\| receptor like protein 56 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|10177158\|dbj\|BAB10347.1\| disease resistance protein-like [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		129
TAIR\|locus:2037308		976	RLP14 "AT1G74180" [Arabidopsis	0.914	0.120	0.437	1.8e-21
TAIR\|locus:2155909		908	RLP56 "AT5G49290" [Arabidopsis	0.906	0.128	0.412	1.8e-19
TAIR\|locus:2040075		935	RLP21 "AT2G25470" [Arabidopsis	0.914	0.126	0.4	2.2e-18
TAIR\|locus:2019662		965	RLP15 "AT1G74190" [Arabidopsis	0.914	0.122	0.364	4.8e-18
TAIR\|locus:2119445		719	AT4G13820 [Arabidopsis thalian	0.860	0.154	0.346	1.9e-09
TAIR\|locus:2025012		1083	RLP1 "AT1G07390" [Arabidopsis	0.821	0.097	0.352	5.2e-09
TAIR\|locus:2101943		891	RLP45 "AT3G53240" [Arabidopsis	0.651	0.094	0.384	1.8e-08
TAIR\|locus:2154463		589	AT5G23400 [Arabidopsis thalian	0.813	0.178	0.380	5.7e-08
TAIR\|locus:2184058		1048	AT5G10020 [Arabidopsis thalian	0.875	0.107	0.307	1.4e-06
TAIR\|locus:2119535		725	RLP48 "receptor like protein 4	0.837	0.148	0.358	3.1e-06

TAIR\|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 263 (97.6 bits), Expect = 1.8e-21, P = 1.8e-21
 Identities = 59/135 (43%), Positives = 86/135 (63%)

Query:     1 MHGYKGCLETERTALLEIKSFFISSVSD---NKILPSWVGEDDGMPSDCCDDWEGVKCNA 57
             + GYK C+E ER ALLE+K + IS  +D   + +LP+W  +     S+CC  WEG+KCN 
Sbjct:    21 LRGYKCCIEKERKALLELKKYMISKTADWGLDSVLPTWTNDTK---SNCCR-WEGLKCNQ 76

Query:    58 TTRRVMQLSLNNTKRLNHYYGTSASLLNMSLFHPFEELQRLDLLG---NWFTGIYEN-RA 113
             T+ R+++LS+  T   N      +SLLN+SL HPFEEL+ L+L G   N F G++++   
Sbjct:    77 TSGRIIELSIGQT---NF---KESSLLNLSLLHPFEELRSLNLSGEIYNEFNGLFDDVEG 130

Query:   114 YDSFGSLKQLKILDL 128
             Y+S   L+ L+ILDL
Sbjct:   131 YESLRRLRNLEILDL 145

GO:0007165 "signal transduction" evidence=IC

GO:0009507 "chloroplast" evidence=IDA

TAIR\|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2119445 AT4G13820 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2154463 AT5G23400 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2184058 AT5G10020 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2119535 RLP48 "receptor like protein 48" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00030803001	SubName- Full=Chromosome undetermined scaffold_52, whole genome shotgun sequence; (268 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		129
pfam08263		42	pfam08263, LRRNT_2, Leucine rich repeat N-terminal	9e-05

>gnl\|CDD\|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain	Back alignment and domain information

 Score = 37.3 bits (87), Expect = 9e-05
 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 7/49 (14%)

Query: 8  LETERTALLEIKSFFISSVSDNKILPSWVGEDDGMPSDCCDDWEGVKCN 56
          L  +R ALL  KS      S    L SW        SD C  W GV C+
Sbjct: 1  LNDDRDALLAFKSSLNGDPSG--ALSSWNPSS----SDPCS-WTGVTCD 42

Leucine Rich Repeats pfam00560 are short sequence motifs present in a number of proteins with diverse functions and cellular locations. Leucine Rich Repeats are often flanked by cysteine rich domains. This domain is often found at the N-terminus of tandem leucine rich repeats. Length = 42

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		129
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.51
PLN03150		623	hypothetical protein; Provisional	99.31
PF08263		43	LRRNT_2: Leucine rich repeat N-terminal domain; In	99.01
PLN03150		623	hypothetical protein; Provisional	98.39
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.21
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.87
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	97.85
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	97.35
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.17
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	96.32
KOG0617		264	consensus Ras suppressor protein (contains leucine	96.15
KOG0472		565	consensus Leucine-rich repeat protein [Function un	95.68
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	95.41
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	95.33
PLN03210		1153	Resistant to P. syringae 6; Provisional	95.11
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	94.77
PLN03210		1153	Resistant to P. syringae 6; Provisional	94.73
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	94.68
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	94.64
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	94.42
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	94.12
KOG0617		264	consensus Ras suppressor protein (contains leucine	93.94
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	93.92
KOG4237		498	consensus Extracellular matrix protein slit, conta	93.83
KOG0472		565	consensus Leucine-rich repeat protein [Function un	93.7
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	93.64
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	93.55
smart00370		26	LRR Leucine-rich repeats, outliers.	93.55
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	93.18
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	92.65
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	92.25
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	92.06
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	91.83
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	91.72
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	91.61
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	91.08
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	90.37
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	89.84
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	89.67
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	89.51
KOG4237		498	consensus Extracellular matrix protein slit, conta	88.94
KOG2982		418	consensus Uncharacterized conserved protein [Funct	88.25
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	88.24
smart00368		28	LRR_RI Leucine rich repeat, ribonuclease inhibitor	87.39
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	86.4
smart00365		26	LRR_SD22 Leucine-rich repeat, SDS22-like subfamily	85.82
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	82.39
smart00364		26	LRR_BAC Leucine-rich repeats, bacterial type.	80.76
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	80.47
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	80.37

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

Probab=99.51  E-value=6.3e-14  Score=120.50  Aligned_cols=84  Identities=25%  Similarity=0.457  Sum_probs=61.8

Q ss_pred             CHHHHHHHHHHHHhccCCCCCCCCCCCCCCCCCCCCCCCCCCCCceEeCCCCCcEEEEeccCCCccccccCCCcceecCc
Q 048677            8 LETERTALLEIKSFFISSVSDNKILPSWVGEDDGMPSDCCDDWEGVKCNATTRRVMQLSLNNTKRLNHYYGTSASLLNMS   87 (129)
Q Consensus         8 ~~~~~~aLl~~k~~l~~~~~~~~~l~~W~~~~~~~~~~~C~~w~Gv~C~~~~~~v~~l~L~~~~l~G~i~~~~l~~l~ls   87 (129)
                      .+.|+++|++||+.+.++   .+.+.+|..     ..+|| .|.||+|+. .++|+.|+|+++++.|.++..        
T Consensus        27 ~~~~~~~l~~~~~~~~~~---~~~~~~w~~-----~~~~c-~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~~--------   88 (968)
T PLN00113         27 HAEELELLLSFKSSINDP---LKYLSNWNS-----SADVC-LWQGITCNN-SSRVVSIDLSGKNISGKISSA--------   88 (968)
T ss_pred             CHHHHHHHHHHHHhCCCC---cccCCCCCC-----CCCCC-cCcceecCC-CCcEEEEEecCCCccccCChH--------
Confidence            568899999999999654   456789964     46899 999999985 579999999999999988765        


Q ss_pred             cccCCCCCcEEEccCcccccccC
Q 048677           88 LFHPFEELQRLDLLGNWFTGIYE  110 (129)
Q Consensus        88 ~~~~l~~L~~L~Ls~N~lsG~iP  110 (129)
                       +..+++|++|+|++|+++|.+|
T Consensus        89 -~~~l~~L~~L~Ls~n~~~~~ip  110 (968)
T PLN00113         89 -IFRLPYIQTINLSNNQLSGPIP  110 (968)
T ss_pred             -HhCCCCCCEEECCCCccCCcCC
Confidence             3334444444444444444444

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>smart00364 LRR_BAC Leucine-rich repeats, bacterial type	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		129
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-16
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-11
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	7e-04

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

 Score = 73.8 bits (182), Expect = 1e-16
 Identities = 29/124 (23%), Positives = 47/124 (37%), Gaps = 25/124 (20%)

Query: 6   GCLETERTALLEIKSFFISSVSDNKILPSWVGEDDGMPSDCCDDWEGVKCNATTRRVMQL 65
             L  E   L+  K      + D  +LP W         + C  ++GV C     +V  +
Sbjct: 8   QSLYREIHQLISFK----DVLPDKNLLPDWSSN-----KNPC-TFDGVTCR--DDKVTSI 55

Query: 66  SLNNTKRLNHYYGT-SASLLNMSLFHPFEELQRLDLLGNWFTGIYENRAYDSFGSLKQLK 124
            L++   LN  +   S+SLL+++       L+ L L  +   G     +   F     L 
Sbjct: 56  DLSSK-PLNVGFSAVSSSLLSLT------GLESLFLSNSHING-----SVSGFKCSASLT 103

Query: 125 ILDL 128
            LDL
Sbjct: 104 SLDL 107

PyMOL of 3rgz

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		129
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.72
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.72
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.58
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.53
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.29
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.67
3e6j_A		229	Variable lymphocyte receptor diversity region; var	98.6
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	98.58
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.53
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.46
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	98.45
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	98.41
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	98.37
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.35
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	98.34
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	98.33
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	98.32
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.26
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.25
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	98.23
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	98.22
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.21
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	98.21
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.2
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	98.16
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	98.15
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	98.14
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.13
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	98.13
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.11
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	98.11
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	98.11
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	98.09
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	98.09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	98.08
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	98.05
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	98.04
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	98.04
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.0
3e6j_A		229	Variable lymphocyte receptor diversity region; var	97.99
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	97.98
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	97.97
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	97.96
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	97.94
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	97.94
3m19_A		251	Variable lymphocyte receptor A diversity region; a	97.9
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	97.9
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	97.88
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	97.87
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	97.85
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	97.85
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	97.85
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	97.85
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	97.84
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	97.81
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	97.81
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	97.8
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	97.8
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	97.8
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	97.8
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	97.79
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	97.79
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	97.78
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	97.78
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	97.75
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	97.75
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	97.74
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	97.74
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	97.73
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	97.73
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	97.72
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	97.72
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	97.71
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	97.7
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	97.69
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	97.68
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.67
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	97.67
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	97.67
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	97.67
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	97.64
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	97.63
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	97.63
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	97.63
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	97.62
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	97.61
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	97.61
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	97.6
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	97.6
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	97.59
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	97.59
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	97.58
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	97.58
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	97.58
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	97.58
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	97.57
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	97.56
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	97.54
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	97.51
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	97.51
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	97.5
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	97.48
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	97.46
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	97.44
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	97.43
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	97.41
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	97.36
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	97.24
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.22
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	97.22
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	97.15
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	97.05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	97.04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	97.03
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	97.02
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	97.01
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	97.01
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	96.97
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	96.95
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	96.91
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	96.91
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	96.88
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	96.88
1o6v_A		466	Internalin A; bacterial infection, extracellular r	96.87
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	96.84
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	96.82
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	96.82
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	96.79
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	96.71
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	96.66
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	96.55
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	96.49
1o6v_A		466	Internalin A; bacterial infection, extracellular r	96.36
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	96.34
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	95.85
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	95.52
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.42
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	95.29
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	95.01
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	94.97
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	94.37
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	94.26
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	93.79
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	93.12
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	92.95
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	92.35
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	91.99
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	91.12
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	90.98
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	90.42
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	88.81
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	82.77

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

Probab=99.72  E-value=8.2e-18  Score=140.13  Aligned_cols=108  Identities=27%  Similarity=0.418  Sum_probs=86.8

Q ss_pred             CCCHHHHHHHHHHHHhccCCCCCCCCCCCCCCCCCCCCCCCCCCCCceEeCCCCCcEEEEeccCCCcccc---ccCC---
Q 048677            6 GCLETERTALLEIKSFFISSVSDNKILPSWVGEDDGMPSDCCDDWEGVKCNATTRRVMQLSLNNTKRLNH---YYGT---   79 (129)
Q Consensus         6 ~~~~~~~~aLl~~k~~l~~~~~~~~~l~~W~~~~~~~~~~~C~~w~Gv~C~~~~~~v~~l~L~~~~l~G~---i~~~---   79 (129)
                      .+.++|++||++||+.+.++   . .+++|..     +.+|| .|.||+|+  .++|++|+|+++++.|.   +++.   
T Consensus         8 ~~~~~~~~all~~k~~~~~~---~-~l~~W~~-----~~~~C-~w~gv~C~--~~~v~~L~L~~~~l~g~~~~l~~~l~~   75 (768)
T 3rgz_A            8 QSLYREIHQLISFKDVLPDK---N-LLPDWSS-----NKNPC-TFDGVTCR--DDKVTSIDLSSKPLNVGFSAVSSSLLS   75 (768)
T ss_dssp             CCHHHHHHHHHHHHTTCSCT---T-SSTTCCT-----TSCGG-GSTTEEEE--TTEEEEEECTTSCCCEEHHHHHHHTTT
T ss_pred             cCCHHHHHHHHHHHhhCCCc---c-cccCCCC-----CCCCc-CCcceEEC--CCcEEEEECCCCCcCCccCccChhHhc
Confidence            35678999999999999754   4 7899974     57899 99999998  58999999999999997   6643   


Q ss_pred             --CcceecCc---------cccCCCCCcEEEccCcccccccCCCCcc--ccCCCCCCcEeeCC
Q 048677           80 --SASLLNMS---------LFHPFEELQRLDLLGNWFTGIYENRAYD--SFGSLKQLKILDLG  129 (129)
Q Consensus        80 --~l~~l~ls---------~~~~l~~L~~L~Ls~N~lsG~iP~~~~~--~l~~l~~L~~L~Ls  129 (129)
                        .|..++++         .++.+++|++|+|++|.|+|.+|    .  .++++++|++|+|+
T Consensus        76 L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~----~~~~l~~l~~L~~L~Ls  134 (768)
T 3rgz_A           76 LTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVT----TLTSLGSCSGLKFLNVS  134 (768)
T ss_dssp             CTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGG----GGGGGGGCTTCCEEECC
T ss_pred             cCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCC----ChHHHhCCCCCCEEECc
Confidence              23333322         36778899999999999999888    7  88888888888875

PyMOL of 3rgz

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		129
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	3e-08
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	0.002

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 48.2 bits (113), Expect = 3e-08
 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 13/84 (15%)

Query: 7  CLETERTALLEIKSFFISSVSDNKILPSWVGEDDGMPSDCCDD-WEGVKCNATTR--RVM 63
          C   ++ ALL+IK      + +   L SW+       +DCC+  W GV C+  T+  RV 
Sbjct: 3  CNPQDKQALLQIKK----DLGNPTTLSSWLPT-----TDCCNRTWLGVLCDTDTQTYRVN 53

Query: 64 QLSLNNTKRLNHYYGTSASLLNMS 87
           L L+    L   Y   +SL N+ 
Sbjct: 54 NLDLSGL-NLPKPYPIPSSLANLP 76

PyMOL of d1ogqa_

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		129
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.86
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	98.59
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	98.45
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.05
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	98.0
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	97.91
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	97.89
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	97.89
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	97.87
d2ifga3		156	High affinity nerve growth factor receptor, N-term	97.74
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	97.59
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	97.56
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	97.56
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	97.54
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	97.49
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	97.37
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	97.37
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	97.24
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	97.07
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	97.04
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	96.99
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	96.96
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	96.76
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	96.69
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	96.38
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	96.28
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	96.18
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	96.0
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	95.82
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	95.78
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	95.27
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	94.8
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	94.53
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	94.43
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	93.93
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	92.16
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	91.25
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	84.72
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	80.64

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.86  E-value=3.3e-22  Score=148.56  Aligned_cols=102  Identities=29%  Similarity=0.477  Sum_probs=88.0

Q ss_pred             CCCHHHHHHHHHHHHhccCCCCCCCCCCCCCCCCCCCCCCCCC-CCCceEeCCC--CCcEEEEeccCCCccc--cccCCC
Q 048677            6 GCLETERTALLEIKSFFISSVSDNKILPSWVGEDDGMPSDCCD-DWEGVKCNAT--TRRVMQLSLNNTKRLN--HYYGTS   80 (129)
Q Consensus         6 ~~~~~~~~aLl~~k~~l~~~~~~~~~l~~W~~~~~~~~~~~C~-~w~Gv~C~~~--~~~v~~l~L~~~~l~G--~i~~~~   80 (129)
                      -|.++|++||++||+.+.++    ..+++|..     +.+||. .|.||+|+..  ..||++|+|+++++.|  .+|.+ 
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~----~~l~sW~~-----~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~-   71 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNP----TTLSSWLP-----TTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSS-   71 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCC----GGGTTCCT-----TSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGG-
T ss_pred             CCCHHHHHHHHHHHHHCCCC----CcCCCCCC-----CCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChH-
Confidence            49999999999999999765    36889975     578992 3999999863  3489999999999998  46776 


Q ss_pred             cceecCccccCCCCCcEEEccC-cccccccCCCCccccCCCCCCcEeeCC
Q 048677           81 ASLLNMSLFHPFEELQRLDLLG-NWFTGIYENRAYDSFGSLKQLKILDLG  129 (129)
Q Consensus        81 l~~l~ls~~~~l~~L~~L~Ls~-N~lsG~iP~~~~~~l~~l~~L~~L~Ls  129 (129)
                              ++++++|++|+|++ |+|+|+||    ++|+++++|++|+|+
T Consensus        72 --------l~~L~~L~~L~Ls~~N~l~g~iP----~~i~~L~~L~~L~Ls  109 (313)
T d1ogqa_          72 --------LANLPYLNFLYIGGINNLVGPIP----PAIAKLTQLHYLYIT  109 (313)
T ss_dssp             --------GGGCTTCSEEEEEEETTEESCCC----GGGGGCTTCSEEEEE
T ss_pred             --------HhcCccccccccccccccccccc----cccccccccchhhhc
Confidence                    88999999999986 89999999    999999999999874

PyMOL of d1ogqa_

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure