Citrus Sinensis ID: 048682


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-----
RLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQNLQQLNLPNN
ccccccccEEEEEccHHHHHHHHHccccEEEEccccccccccccccEEccccccccHHHHHHHHHHHHHcccccc
cccccHccEEEEEccHHHHHHHHHccccEEEEccccccHccHHHHHEHccccccccHHHHHHHHHcHHHcccccc
rlgisekdclVVEDSVIGLQAATRAGMACVITYtsstaeqdFKDAIaiypdlsnvRLKDLELLLQNLqqlnlpnn
rlgisekdclvVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLqnlqqlnlpnn
RLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDlelllqnlqqlnlpnn
*******DCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQNL********
**GISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQN*********
RLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQNLQQLNLPNN
*LGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQNLQQLNLPN*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQNLQQLNLPNN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query75 2.2.26 [Sep-21-2011]
P40119254 Protein CbbY, chromosomal yes no 0.72 0.212 0.425 3e-06
Q04541254 Protein CbbY, plasmid OS= yes no 0.72 0.212 0.425 5e-06
P54607220 Uncharacterized protein Y yes no 0.573 0.195 0.511 0.0005
>sp|P40119|CBBYC_CUPNH Protein CbbY, chromosomal OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbYC PE=3 SV=3 Back     alignment and function desciption
 Score = 50.4 bits (119), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 1   RLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSN 54
           RLG+   DCL +EDS  GL+AA  AG+  V+T T+ +A+  F+ A+ + P L +
Sbjct: 167 RLGLEGGDCLAIEDSANGLRAARAAGIPTVVTPTAFSAQDSFEGALLVLPHLGD 220





Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (taxid: 381666)
>sp|Q04541|CBBYP_CUPNH Protein CbbY, plasmid OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbYP PE=3 SV=1 Back     alignment and function description
>sp|P54607|YHCW_BACSU Uncharacterized protein YhcW OS=Bacillus subtilis (strain 168) GN=yhcW PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query75
296085644 192 unnamed protein product [Vitis vinifera] 0.893 0.348 0.925 4e-28
359496438 268 PREDICTED: protein CbbY, chromosomal-lik 0.893 0.25 0.925 6e-28
359496682 328 PREDICTED: protein CbbY-like [Vitis vini 0.893 0.204 0.925 6e-28
296088888 318 unnamed protein product [Vitis vinifera] 0.893 0.210 0.925 8e-28
255584279 309 2-deoxyglucose-6-phosphate phosphatase, 0.893 0.216 0.895 2e-27
356525461 323 PREDICTED: protein CbbY, chromosomal-lik 0.893 0.207 0.880 6e-27
356512689 310 PREDICTED: protein CbbY, chromosomal-lik 0.893 0.216 0.880 6e-27
255639539 310 unknown [Glycine max] 0.893 0.216 0.880 6e-27
224093744 261 predicted protein [Populus trichocarpa] 0.853 0.245 0.906 1e-25
449451423 309 PREDICTED: protein CbbY-like [Cucumis sa 0.893 0.216 0.805 2e-24
>gi|296085644|emb|CBI29443.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  128 bits (321), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 62/67 (92%), Positives = 66/67 (98%)

Query: 1   RLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDL 60
           RLG+SEKDCLVVEDSVIGLQAAT AGM+CVITYTSSTA+QDFKDAIAIYPDLSNVRLKDL
Sbjct: 122 RLGVSEKDCLVVEDSVIGLQAATGAGMSCVITYTSSTADQDFKDAIAIYPDLSNVRLKDL 181

Query: 61  ELLLQNL 67
           ELLLQN+
Sbjct: 182 ELLLQNV 188




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359496438|ref|XP_003635236.1| PREDICTED: protein CbbY, chromosomal-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496682|ref|XP_003635299.1| PREDICTED: protein CbbY-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296088888|emb|CBI38432.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255584279|ref|XP_002532876.1| 2-deoxyglucose-6-phosphate phosphatase, putative [Ricinus communis] gi|223527361|gb|EEF29505.1| 2-deoxyglucose-6-phosphate phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356525461|ref|XP_003531343.1| PREDICTED: protein CbbY, chromosomal-like [Glycine max] Back     alignment and taxonomy information
>gi|356512689|ref|XP_003525049.1| PREDICTED: protein CbbY, chromosomal-like [Glycine max] Back     alignment and taxonomy information
>gi|255639539|gb|ACU20064.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224093744|ref|XP_002309972.1| predicted protein [Populus trichocarpa] gi|222852875|gb|EEE90422.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449451423|ref|XP_004143461.1| PREDICTED: protein CbbY-like [Cucumis sativus] gi|449520016|ref|XP_004167030.1| PREDICTED: protein CbbY-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query75
TAIR|locus:2140050316 AT4G39970 [Arabidopsis thalian 0.786 0.186 0.813 5.5e-22
TAIR|locus:2101165319 AT3G48420 [Arabidopsis thalian 0.64 0.150 0.5 2.5e-08
TIGR_CMR|DET_0395456 DET_0395 "glycoprotease family 0.773 0.127 0.389 0.00011
TAIR|locus:2010728 1055 AT1G56500 [Arabidopsis thalian 0.76 0.054 0.366 0.0004
TAIR|locus:2140050 AT4G39970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 256 (95.2 bits), Expect = 5.5e-22, P = 5.5e-22
 Identities = 48/59 (81%), Positives = 57/59 (96%)

Query:     1 RLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKD 59
             +LG+S KDCLVVEDSVIGLQAAT+AGM+CVITYTSST++Q+F DAIA+YPDLSNV+LKD
Sbjct:   246 KLGVSVKDCLVVEDSVIGLQAATKAGMSCVITYTSSTSDQNFNDAIAVYPDLSNVKLKD 304




GO:0003824 "catalytic activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016787 "hydrolase activity" evidence=IEA;ISS
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
TAIR|locus:2101165 AT3G48420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0395 DET_0395 "glycoprotease family protein/hydrolase, beta-phosphoglucomutase family" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TAIR|locus:2010728 AT1G56500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.VII.1749.1
haloacid dehalogenase-like hydrolase family protein (EC-2.7.7.2) (261 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.XIX.851.1
hypothetical protein (317 aa)
     0.475

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
PLN02779286 PLN02779, PLN02779, haloacid dehalogenase-like hyd 5e-33
COG0637221 COG0637, COG0637, Predicted phosphatase/phosphohex 1e-10
PLN02919 1057 PLN02919, PLN02919, haloacid dehalogenase-like hyd 7e-08
PRK10725188 PRK10725, PRK10725, fructose-1-P/6-phosphogluconat 3e-05
pfam1324274 pfam13242, Hydrolase_like, HAD-hyrolase-like 5e-05
PLN02940 382 PLN02940, PLN02940, riboflavin kinase 1e-04
TIGR02009185 TIGR02009, PGMB-YQAB-SF, beta-phosphoglucomutase f 4e-04
PRK11587218 PRK11587, PRK11587, putative phosphatase; Provisio 5e-04
TIGR01509177 TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase sup 5e-04
>gnl|CDD|215416 PLN02779, PLN02779, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
 Score =  114 bits (286), Expect = 5e-33
 Identities = 33/66 (50%), Positives = 45/66 (68%)

Query: 1   RLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDL 60
            LG+    C+VVEDSVIGLQAA  AGM C++T +S TA++DF  A A++  L +V L+D 
Sbjct: 214 TLGVDPSRCVVVEDSVIGLQAAKAAGMRCIVTKSSYTADEDFSGADAVFDCLGDVPLEDF 273

Query: 61  ELLLQN 66
           +LL   
Sbjct: 274 DLLFCE 279


Length = 286

>gnl|CDD|223710 COG0637, COG0637, Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>gnl|CDD|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>gnl|CDD|182679 PRK10725, PRK10725, fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222003 pfam13242, Hydrolase_like, HAD-hyrolase-like Back     alignment and domain information
>gnl|CDD|178528 PLN02940, PLN02940, riboflavin kinase Back     alignment and domain information
>gnl|CDD|213673 TIGR02009, PGMB-YQAB-SF, beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>gnl|CDD|183215 PRK11587, PRK11587, putative phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|233443 TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 75
PF1324275 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY 99.54
PLN02779286 haloacid dehalogenase-like hydrolase family protei 99.52
PLN02575381 haloacid dehalogenase-like hydrolase 99.42
PLN02770248 haloacid dehalogenase-like hydrolase family protei 99.41
PRK13225273 phosphoglycolate phosphatase; Provisional 99.41
PRK11587218 putative phosphatase; Provisional 99.4
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 99.39
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 99.39
PLN02811220 hydrolase 99.39
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 99.39
COG0546220 Gph Predicted phosphatases [General function predi 99.38
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 99.38
COG0637221 Predicted phosphatase/phosphohexomutase [General f 99.37
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 99.37
PRK13288214 pyrophosphatase PpaX; Provisional 99.36
PRK13226229 phosphoglycolate phosphatase; Provisional 99.34
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 99.33
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 99.31
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 99.3
PRK06769173 hypothetical protein; Validated 99.29
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 99.29
PLN02940 382 riboflavin kinase 99.29
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 99.26
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 99.25
PRK10563221 6-phosphogluconate phosphatase; Provisional 99.24
PRK13222226 phosphoglycolate phosphatase; Provisional 99.21
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 99.21
PLN02645311 phosphoglycolate phosphatase 99.2
PRK13223272 phosphoglycolate phosphatase; Provisional 99.2
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 99.2
PRK10444248 UMP phosphatase; Provisional 99.19
PRK09449224 dUMP phosphatase; Provisional 99.16
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.16
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 99.14
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 99.12
PRK14988224 GMP/IMP nucleotidase; Provisional 99.1
PHA02597197 30.2 hypothetical protein; Provisional 99.08
PRK10748238 flavin mononucleotide phosphatase; Provisional 99.08
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 99.07
KOG2914222 consensus Predicted haloacid-halidohydrolase and r 99.07
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 99.05
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 99.02
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 98.99
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 98.97
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 98.96
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 98.96
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 98.96
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 98.9
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 98.9
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 98.9
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 98.88
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 98.88
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 98.87
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 98.85
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 98.75
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 98.75
PHA02530300 pseT polynucleotide kinase; Provisional 98.73
TIGR01456321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 98.64
COG0647269 NagD Predicted sugar phosphatases of the HAD super 98.63
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 98.63
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 98.62
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 98.6
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 98.58
PLN02954224 phosphoserine phosphatase 98.57
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 98.55
PRK13582205 thrH phosphoserine phosphatase; Provisional 98.53
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 98.5
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 98.5
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 98.49
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 98.47
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 98.46
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 98.43
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 98.41
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 98.38
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 98.31
KOG2882306 consensus p-Nitrophenyl phosphatase [Inorganic ion 98.3
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 98.28
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 98.25
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 98.19
PRK11133322 serB phosphoserine phosphatase; Provisional 98.17
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 98.15
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 98.1
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 98.09
KOG3040262 consensus Predicted sugar phosphatase (HAD superfa 98.07
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 98.04
COG0241181 HisB Histidinol phosphatase and related phosphatas 97.91
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 97.85
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 97.83
PRK01158230 phosphoglycolate phosphatase; Provisional 97.81
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 97.77
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 97.76
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 97.76
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 97.75
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 97.69
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 97.68
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 97.68
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 97.67
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 97.58
PTZ00445219 p36-lilke protein; Provisional 97.56
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 97.55
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 97.55
PRK10671834 copA copper exporting ATPase; Provisional 97.48
TIGR02244343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 97.44
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 97.41
PRK10513270 sugar phosphate phosphatase; Provisional 97.41
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 97.38
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 97.22
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 97.19
PRK10976266 putative hydrolase; Provisional 97.15
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 97.15
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 97.09
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 97.02
COG4229229 Predicted enolase-phosphatase [Energy production a 97.02
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 96.96
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 96.88
PLN02887580 hydrolase family protein 96.87
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 96.78
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 96.73
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 96.73
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 96.67
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 96.62
PRK08238 479 hypothetical protein; Validated 96.56
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 96.51
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 96.41
PLN02382 413 probable sucrose-phosphatase 96.3
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 96.24
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 96.18
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 95.85
COG4087152 Soluble P-type ATPase [General function prediction 95.79
TIGR01522 884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 95.48
COG3700237 AphA Acid phosphatase (class B) [General function 95.42
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 95.41
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 95.36
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 94.96
TIGR01116 917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 94.42
KOG2961190 consensus Predicted hydrolase (HAD superfamily) [G 94.01
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 93.7
PLN02423245 phosphomannomutase 92.87
PLN02205854 alpha,alpha-trehalose-phosphate synthase [UDP-form 92.4
PF05761448 5_nucleotid: 5' nucleotidase family; InterPro: IPR 92.12
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 91.8
COG5663194 Uncharacterized conserved protein [Function unknow 91.69
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 91.57
KOG2630254 consensus Enolase-phosphatase E-1 [Amino acid tran 91.53
COG4359220 Uncharacterized conserved protein [Function unknow 91.41
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 91.27
PLN02580384 trehalose-phosphatase 90.45
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 88.96
PTZ00174247 phosphomannomutase; Provisional 87.59
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 86.69
COG4030315 Uncharacterized protein conserved in archaea [Func 85.03
PF02350346 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; 83.16
PF04230286 PS_pyruv_trans: Polysaccharide pyruvyl transferase 81.28
PLN03190 1178 aminophospholipid translocase; Provisional 80.96
>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B Back     alignment and domain information
Probab=99.54  E-value=7.4e-15  Score=78.00  Aligned_cols=54  Identities=26%  Similarity=0.473  Sum_probs=46.4

Q ss_pred             CCCCCCcEEEEecC-HHhHHHHHHcCCeEEEEcCCCCchhhh----hccceeeCCCCCC
Q 048682            2 LGISEKDCLVVEDS-VIGLQAATRAGMACVITYTSSTAEQDF----KDAIAIYPDLSNV   55 (75)
Q Consensus         2 l~~~p~~~l~igDs-~~di~aA~~AG~~~i~v~~~~~~~~~~----~~~~~~~~~~~~l   55 (75)
                      ++++|++|+||||+ .+||++|+++|+.+|+|.+|....+..    ..++++++++.|+
T Consensus        17 ~~~~~~~~~~VGD~~~~Di~~a~~~G~~~ilV~tG~~~~~~~~~~~~~pd~vv~~l~e~   75 (75)
T PF13242_consen   17 LGVDPSRCVMVGDSLETDIEAAKAAGIDTILVLTGVYSPEDLEKAEHKPDYVVDDLKEA   75 (75)
T ss_dssp             HTSGGGGEEEEESSTTTHHHHHHHTTSEEEEESSSSSCCCGHHHSSSTTSEEESSGGGH
T ss_pred             cCCCHHHEEEEcCCcHhHHHHHHHcCCcEEEECCCCCCHHHHhccCCCCCEEECCHHhC
Confidence            57889999999999 899999999999999999988665443    4789999998763



...

>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>COG4229 Predicted enolase-phosphatase [Energy production and conversion] Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>COG5663 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>KOG2630 consensus Enolase-phosphatase E-1 [Amino acid transport and metabolism] Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>COG4030 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>PF04230 PS_pyruv_trans: Polysaccharide pyruvyl transferase; InterPro: IPR007345 Pyruvyl-transferases are involved in peptidoglycan-associated polymer biosynthesis Back     alignment and domain information
>PLN03190 aminophospholipid translocase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
1te2_A226 Putative phosphatase; structural genomics, phospha 6e-15
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 1e-13
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 2e-13
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 6e-13
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 9e-13
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 1e-12
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 1e-12
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 3e-12
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 4e-12
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 5e-12
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 1e-11
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 2e-11
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 9e-10
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 8e-08
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 7e-06
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 9e-06
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 4e-05
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 5e-05
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 1e-04
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 3e-04
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 3e-04
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 3e-04
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 8e-04
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Length = 226 Back     alignment and structure
 Score = 65.0 bits (159), Expect = 6e-15
 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 1   RLGISEKDCLVVEDSVIGLQAATRAGMACV-ITYTSSTAEQDFKDAIAIYPDLSNVRLKD 59
           +LG+    C+ +EDSV G+ A+  A M  + +    +  +  F  A      L+ +  KD
Sbjct: 162 KLGVDPLTCVALEDSVNGMIASKAARMRSIVVPAPEAQNDPRFVLANVKLSSLTELTAKD 221

Query: 60  L 60
           L
Sbjct: 222 L 222


>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Length = 247 Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Length = 243 Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Length = 221 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Length = 250 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Length = 214 Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Length = 243 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Length = 233 Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Length = 233 Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Length = 275 Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Length = 229 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Length = 259 Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} Length = 277 Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Length = 267 Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Length = 196 Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Length = 137 Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Length = 282 Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Length = 231 Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Length = 384 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Length = 190 Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Length = 209 Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Length = 205 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query75
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 99.63
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 99.58
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 99.49
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 99.48
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 99.47
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.45
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 99.44
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 99.44
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 99.42
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 99.41
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.4
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 99.4
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 99.4
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 99.4
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 99.39
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 99.37
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 99.37
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 99.36
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 99.36
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 99.34
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 99.34
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 99.34
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 99.33
3sd7_A240 Putative phosphatase; structural genomics, haloaci 99.33
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 99.33
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 99.33
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 99.32
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 99.31
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 99.31
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 99.31
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 99.31
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 99.3
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 99.3
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 99.29
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 99.29
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 99.29
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 99.29
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 99.29
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 99.28
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 99.28
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 99.28
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 99.28
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 99.28
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 99.27
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 99.26
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 99.26
1te2_A226 Putative phosphatase; structural genomics, phospha 99.25
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 99.25
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 99.24
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 99.24
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 99.24
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 99.23
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 99.23
3ib6_A189 Uncharacterized protein; structural genomics, unkn 99.23
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 99.23
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 99.22
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 99.22
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 99.22
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 99.21
2o2x_A218 Hypothetical protein; structural genomics, joint c 99.21
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 99.21
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 99.21
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 99.2
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 99.2
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 99.2
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 99.2
2hsz_A243 Novel predicted phosphatase; structural genomics, 99.19
2p11_A231 Hypothetical protein; putative haloacid dehalogena 99.16
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 99.14
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 99.12
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 99.04
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 99.0
3kc2_A352 Uncharacterized protein YKR070W; HAD-like, mitocho 98.99
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 98.99
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 98.97
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 98.93
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 98.92
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 98.91
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 98.9
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 98.87
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 98.86
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 98.86
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 98.83
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 98.81
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 98.8
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 98.79
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 98.77
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 98.75
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 98.73
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 98.72
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 98.66
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 98.65
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 98.65
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 98.63
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 98.63
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 98.63
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 98.63
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 98.05
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 98.62
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 98.61
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 98.59
3mn1_A189 Probable YRBI family phosphatase; structural genom 98.57
3mmz_A176 Putative HAD family hydrolase; structural genomics 98.56
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.55
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 98.55
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 98.54
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 98.53
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 98.53
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 98.51
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 98.5
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 98.5
2zg6_A220 Putative uncharacterized protein ST2620, probable 98.5
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 98.47
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 98.44
3fvv_A232 Uncharacterized protein; unknown function, structu 98.44
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 98.39
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 98.39
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.39
3dao_A283 Putative phosphatse; structural genomics, joint ce 98.35
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 98.33
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 98.31
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 98.29
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 98.25
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 98.25
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 98.2
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 98.14
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 98.1
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 98.06
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 97.99
1l6r_A227 Hypothetical protein TA0175; structural genomics, 97.96
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 97.88
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 97.84
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 97.8
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 97.49
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 97.47
1y8a_A332 Hypothetical protein AF1437; structural genomics, 97.47
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 97.45
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 97.23
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 96.86
2jc9_A 555 Cytosolic purine 5'-nucleotidase; cytosolic 5-prim 96.18
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 96.11
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 96.11
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 95.81
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 95.27
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 92.86
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 92.64
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 91.82
4g63_A 470 Cytosolic IMP-GMP specific 5'-nucleotidase; struct 90.9
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 90.21
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 86.83
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 84.11
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 82.94
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 82.62
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 81.21
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
Probab=99.63  E-value=8.6e-16  Score=94.84  Aligned_cols=62  Identities=18%  Similarity=0.316  Sum_probs=53.6

Q ss_pred             CCCCCCcEEEEecCHHhHHHHHHcCCeEEEEcCCCCchhhhhccceeeCCCCCCCHHHHHHHHHHH
Q 048682            2 LGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQNL   67 (75)
Q Consensus         2 l~~~p~~~l~igDs~~di~aA~~AG~~~i~v~~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~   67 (75)
                      +|++|++|+|||||.+|+++|++|||++|+|.+..    .+..++++++++.++.++.|.+.+.++
T Consensus       183 lg~~p~e~l~VGDs~~Di~aA~~aG~~~i~v~~~~----~~~~ad~vi~~l~eL~~~~i~~~~n~~  244 (250)
T 4gib_A          183 LNVNPQNCIGIEDASAGIDAINSANMFSVGVGNYE----NLKKANLVVDSTNQLKFEYIQEKYNEY  244 (250)
T ss_dssp             HTCCGGGEEEEESSHHHHHHHHHTTCEEEEESCTT----TTTTSSEEESSGGGCCHHHHHHHHHHH
T ss_pred             hCCChHHeEEECCCHHHHHHHHHcCCEEEEECChh----HhccCCEEECChHhCCHHHHHHHHHHH
Confidence            68999999999999999999999999999996532    345689999999999988888766554



>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Back     alignment and structure
>4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 75
d1o08a_221 c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcu 8e-13
d1te2a_218 c.108.1.6 (A:) Phosphatase YniC {Escherichia coli 3e-10
d1qq5a_245 c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xan 9e-08
d2go7a1204 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {S 2e-07
d2hdoa1207 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase { 2e-07
d2fdra1222 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 { 2e-07
d1cr6a1222 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal 7e-07
d1zs9a1253 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapien 9e-07
d2fi1a1187 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Str 2e-06
d2b0ca1197 c.108.1.2 (A:8-204) Putative phosphatase YihX {Esc 1e-05
d1zrna_220 c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pse 1e-05
d1qyia_380 c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 1e-05
d1u7pa_164 c.108.1.17 (A:) Magnesium-dependent phosphatase-1, 3e-05
d2o2xa1209 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 3e-05
d1swva_257 c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Ba 3e-05
d1zd3a1225 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal 8e-05
d2hcfa1228 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {C 1e-04
d2ah5a1210 c.108.1.6 (A:1-210) predicted phosphatase SP0104 { 2e-04
d2g80a1225 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast 4e-04
d2hsza1224 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase G 0.002
d2gfha1247 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatas 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Length = 221 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: beta-Phosphoglucomutase-like
domain: beta-Phosphoglucomutase
species: Lactococcus lactis [TaxId: 1358]
 Score = 58.3 bits (139), Expect = 8e-13
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 5/67 (7%)

Query: 1   RLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDL 60
            +G++  + + +EDS  G+QA   +G   +         +D  D I I PD S+  L+ L
Sbjct: 157 AVGVAPSESIGLEDSQAGIQAIKDSGALPIGV----GRPEDLGDDIVIVPDTSHYTLEFL 212

Query: 61  -ELLLQN 66
            E+ LQ 
Sbjct: 213 KEVWLQK 219


>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Length = 218 Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Length = 245 Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Length = 204 Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Length = 207 Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Length = 222 Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 222 Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Length = 253 Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Length = 187 Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Length = 197 Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Length = 220 Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Length = 209 Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Length = 257 Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 225 Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Length = 228 Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Length = 210 Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 225 Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Length = 224 Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Length = 247 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query75
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 99.57
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 99.55
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 99.51
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 99.49
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 99.48
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 99.48
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 99.46
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 99.46
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 99.46
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 99.45
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 99.45
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 99.44
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 99.44
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 99.43
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 99.42
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 99.42
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 99.41
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 99.38
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 99.26
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 99.24
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 99.23
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 99.21
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 99.18
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 99.18
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 99.16
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 99.09
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 99.03
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 98.78
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 98.7
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 98.48
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 98.45
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 98.33
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 97.99
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 97.83
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 97.73
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 97.72
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 97.47
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 97.33
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 97.31
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 97.18
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 97.17
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 96.95
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 96.8
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 96.78
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 96.72
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 96.5
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 96.37
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 95.9
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 95.64
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 95.61
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 93.85
d2bdea1458 Cytosolic IMP-GMP specific 5'-nucleotidase {Legion 90.64
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 89.2
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 86.1
d2r7ka1123 5-formaminoimidazole-4-carboxamide ribonucleotide 84.65
d1y8aa1308 Hypothetical protein AF1437 {Archaeon Archaeoglobu 84.63
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 82.25
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: beta-Phosphoglucomutase-like
domain: Hypothetical protein CT1708
species: Chlorobium tepidum [TaxId: 1097]
Probab=99.57  E-value=5e-15  Score=88.45  Aligned_cols=62  Identities=10%  Similarity=0.192  Sum_probs=52.8

Q ss_pred             CCCCCCcEEEEecCHHhHHHHHHcCCeEEEEcCCCCchhhh--hccceeeCCCCCCCHHHHHHHH
Q 048682            2 LGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDF--KDAIAIYPDLSNVRLKDLELLL   64 (75)
Q Consensus         2 l~~~p~~~l~igDs~~di~aA~~AG~~~i~v~~~~~~~~~~--~~~~~~~~~~~~l~~~~l~~~~   64 (75)
                      .+++|++|+||||+.+|+++|++|||++|+|.++....+.+  ..++++++++.++ .+.|..++
T Consensus       164 ~~~~p~~~l~VGD~~~Di~aA~~aG~~~i~v~~g~~~~~~l~~~~ad~vi~~~~el-~~~l~~l~  227 (228)
T d2hcfa1         164 ANYSPSQIVIIGDTEHDIRCARELDARSIAVATGNFTMEELARHKPGTLFKNFAET-DEVLASIL  227 (228)
T ss_dssp             CCCCGGGEEEEESSHHHHHHHHTTTCEEEEECCSSSCHHHHHTTCCSEEESCSCCH-HHHHHHHH
T ss_pred             cCCChhHheeecCChHHHHHHHHcCCEEEEEcCCCCCHHHHhhCCCCEEECCHHHH-HHHHHHHh
Confidence            47899999999999999999999999999999887665544  3689999999999 67766553



>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2r7ka1 c.30.1.8 (A:1-123) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure