Citrus Sinensis ID: 048689

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MAMNNLSAESTVAAAISALVIFLSIFLLISRNGQKRTLKKKQAQQAPEAGGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYKNCISSSSSRKVVSVEMIHWLEGTVLDIILRIIAGKRYTSQSQEVNDWQQQITKFTALSGQFV
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccEEEEcccccEEEEEcHHHHHHHHHHccccccccccHHHHHHHcccccEEEEccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccc
ccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEccHHHHccccccHHHHHHHHHHcccEEEEEEccEEEEEEccHHHHHHHHHHccHHHcccccHHHHHHHEcccccEEEccccHHHHHHHHHHHHHHHcHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccccEcHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccc
MAMNNLSAESTVAAAISALVIFLSIFLLISRNGQKRTLKKKQaqqapeaggawplighlhilrgsepahrvlgnmadkygpifTMKLGVKQALVVSNWEIAKECfttndkafagrpktMATELLGYNFLVIgfapygnywrqSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYKNcisssssrkVVSVEMIHWLEGTVLDIILRIIAgkrytsqsqeVNDWQQQITKFtalsgqfv
MAMNNLSAESTVAAAISALVIFLSIFLLISRNGQKRTLKKKQAQQAPEAGGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYkncisssssrkvVSVEMIHWLEGTVLDIILRIIAGKRYTSQSQEVNDWQQQITKFtalsgqfv
MAMNNLSAESTVAAAisalviflsifllisRNGQKRTLKKKQAQQAPEAGGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYKNCIsssssrkvvsvEMIHWLEGTVLDIILRIIAGKRYTSQSQEVNDWQQQITKFTALSGQFV
***********VAAAISALVIFLSIFLLISR******************GGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYKNCISSSSSRKVVSVEMIHWLEGTVLDIILRIIAGKRYTSQSQEVNDWQQQITKF********
*******AESTVAAAISALVIFLSIFLLISR********************AWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLY**************VEMIHWLEGTVLDIILRIIAGKRYTSQSQEVNDWQQQITKFTALSGQFV
**********TVAAAISALVIFLSIFLLISRNG***************AGGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYKNCISSSSSRKVVSVEMIHWLEGTVLDIILRIIAGKRYTSQSQEVNDWQQQITKFTALSGQFV
****NLSAESTVAAAISALVIFLSIFLLISRNGQKRTLKKKQAQQAPEAGGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYKNCISS*****VVSVEMIHWLEGTVLDIILRIIAGKRYTSQSQEVNDWQQQITKFTALSGQFV
oooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooo
ooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMNNLSAESTVAAAISALVIFLSIFLLISRNGQKRTLKKKQAQQAPEAGGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYKNCISSSSSRKVVSVEMIHWLEGTVLDIILRIIAGKRYTSQSQEVNDWQQQITKFTALSGQFV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query239 2.2.26 [Sep-21-2011]
Q9SZ46 524 Cytochrome P450 82C4 OS=A yes no 0.803 0.366 0.490 2e-51
O49858 527 Cytochrome P450 82A3 OS=G no no 0.907 0.411 0.427 6e-50
Q43068 544 Cytochrome P450 82A1 (Fra N/A no 0.920 0.404 0.415 3e-49
O49859 525 Cytochrome P450 82A4 OS=G no no 0.928 0.422 0.414 5e-49
O49394 523 Cytochrome P450 82C2 OS=A no no 0.803 0.367 0.467 2e-48
O81972 522 Cytochrome P450 82A2 OS=G no no 0.832 0.381 0.455 9e-48
O49396 512 Cytochrome P450 82C3 OS=A no no 0.753 0.351 0.420 2e-37
Q9LSF8 515 Cytochrome P450 82G1 OS=A no no 0.824 0.382 0.400 7e-36
O65790 500 Cytochrome P450 81F1 OS=A no no 0.841 0.402 0.311 2e-29
O22307 490 Cytochrome P450 71D11 (Fr N/A no 0.736 0.359 0.381 3e-28
>sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 Back     alignment and function desciption
 Score =  202 bits (514), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 134/202 (66%), Gaps = 10/202 (4%)

Query: 46  APEAGGAWPLIGHLHILRGSEPA-HRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKEC 104
           AP   GAWP+IGHLH+L G E   +R LG MAD YGP  +++LG  +A VVS++E+AK+C
Sbjct: 32  APAPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGPAMSLQLGSNEAFVVSSFEVAKDC 91

Query: 105 FTTNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVR 164
           FT NDKA A RP T A + +GYNF V GFAPY  +WR+ RKIATIELLSNRRL+ LKHVR
Sbjct: 92  FTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVR 151

Query: 165 ESEVKASIQRLYKNCISSSSSRKVVSVEMIHWLEGTVLDIILRIIAGKRY--------TS 216
            SE+   ++ LY     +  ++ V+ V++  WLE   L++I+R++AGKRY        + 
Sbjct: 152 VSEITMGVKDLYSLWFKNGGTKPVM-VDLKSWLEDMTLNMIVRMVAGKRYFGGGGSVSSE 210

Query: 217 QSQEVNDWQQQITKFTALSGQF 238
            ++E    ++ I KF  L G F
Sbjct: 211 DTEEAMQCKKAIAKFFHLIGIF 232
Can hydroxylates 8-methoxypsoralen to form 5-hydroxy-8-methoxypsoralen in vivo and in vitro. Involved in the early iron deficiency response, possibly through an IDE1-like mediated pathway.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 Back     alignment and function description
>sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 Back     alignment and function description
>sp|O49859|C82A4_SOYBN Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 Back     alignment and function description
>sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 Back     alignment and function description
>sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 Back     alignment and function description
>sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 Back     alignment and function description
>sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 Back     alignment and function description
>sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 Back     alignment and function description
>sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query239
255538496 528 cytochrome P450, putative [Ricinus commu 0.928 0.420 0.531 7e-65
224149471324 cytochrome P450 [Populus trichocarpa] gi 0.933 0.688 0.512 1e-62
255538492 521 cytochrome P450, putative [Ricinus commu 0.928 0.426 0.5 2e-62
255538486 521 cytochrome P450, putative [Ricinus commu 0.928 0.426 0.495 5e-62
302142408 929 unnamed protein product [Vitis vinifera] 0.920 0.236 0.528 1e-61
224112939 528 cytochrome P450 [Populus trichocarpa] gi 0.933 0.422 0.512 1e-61
225458444 554 PREDICTED: cytochrome P450 82A3-like [Vi 0.979 0.422 0.518 2e-61
224149020324 cytochrome P450 [Populus trichocarpa] gi 0.933 0.688 0.504 7e-61
224137290 538 cytochrome P450 [Populus trichocarpa] gi 0.794 0.353 0.579 1e-59
359492645 731 PREDICTED: cytochrome P450 82A3 [Vitis v 0.933 0.305 0.5 1e-59
>gi|255538496|ref|XP_002510313.1| cytochrome P450, putative [Ricinus communis] gi|223551014|gb|EEF52500.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  253 bits (645), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 163/237 (68%), Gaps = 15/237 (6%)

Query: 10  STVAAAISALVIFLSIFLLISRNGQKRTLKKKQAQQAPEAGGAWPLIGHLHILRGSEPAH 69
           + +A A++ L+   S+F +       R++KKK+A  APEAGGAWPLIGHLH+LRG +P+H
Sbjct: 10  NAIATAVAFLIFVCSVFCIT------RSMKKKKA--APEAGGAWPLIGHLHLLRGPQPSH 61

Query: 70  RVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATELLGYNFL 129
            V GNMADKYGPIFT+K+GV   LV SNWE+AKECFTTNDKAFA RP  +A +LLGY   
Sbjct: 62  IVFGNMADKYGPIFTIKMGVHPTLVASNWEMAKECFTTNDKAFANRPNILAMDLLGYGRS 121

Query: 130 VIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYK--NCISSSSSRK 187
           +  F+PYGNYWRQ RKI+T+ELLSN RL+   HVRESEV  +++ LYK      +++S  
Sbjct: 122 MFAFSPYGNYWRQIRKISTLELLSNHRLQMFNHVRESEVGTALKELYKLWEKNKTTNSNN 181

Query: 188 VVSVEMIHWLEGTVLDIILRIIAGK----RYTSQSQEVND-WQQQITKFTALSGQFV 239
            V VEM  W     L+IILRII GK        + +E N+ W+Q +  F  LSG+F+
Sbjct: 182 KVLVEMKRWFGDITLNIILRIIVGKFIGYETADEGKESNEGWKQALRDFFHLSGRFI 238

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224149471|ref|XP_002336813.1| cytochrome P450 [Populus trichocarpa] gi|222836945|gb|EEE75338.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255538492|ref|XP_002510311.1| cytochrome P450, putative [Ricinus communis] gi|223551012|gb|EEF52498.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255538486|ref|XP_002510308.1| cytochrome P450, putative [Ricinus communis] gi|223551009|gb|EEF52495.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|302142408|emb|CBI19611.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224112939|ref|XP_002332682.1| cytochrome P450 [Populus trichocarpa] gi|222838808|gb|EEE77159.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225458444|ref|XP_002282014.1| PREDICTED: cytochrome P450 82A3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224149020|ref|XP_002336744.1| cytochrome P450 [Populus trichocarpa] gi|222836647|gb|EEE75040.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224137290|ref|XP_002327089.1| cytochrome P450 [Populus trichocarpa] gi|222835404|gb|EEE73839.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359492645|ref|XP_002281995.2| PREDICTED: cytochrome P450 82A3 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query239
TAIR|locus:2116607 524 CYP82C4 ""cytochrome P450, fam 0.832 0.379 0.473 1e-45
TAIR|locus:2116652 523 CYP82C2 ""cytochrome P450, fam 0.732 0.334 0.497 3.5e-43
TAIR|locus:2116622 512 CYP82C3 ""cytochrome P450, fam 0.782 0.365 0.401 1.2e-33
TAIR|locus:2090275 515 CYP82G1 "cytochrome P450, fami 0.723 0.335 0.413 1.5e-30
TAIR|locus:2040174 527 CYP82F1 ""cytochrome P450, fam 0.769 0.349 0.356 9.3e-27
TAIR|locus:2058619 515 CYP81D6 ""cytochrome P450, fam 0.732 0.339 0.358 2.3e-26
TAIR|locus:2058657 543 CYP81D7 ""cytochrome P450, fam 0.740 0.325 0.349 8.1e-26
TAIR|locus:2126402 500 CYP91A2 ""cytochrome P450, fam 0.765 0.366 0.308 7.3e-25
TAIR|locus:2158222 507 CYP81G1 ""cytochrome P450, fam 0.820 0.386 0.310 2.8e-24
TAIR|locus:504955640 490 CYP71A22 ""cytochrome P450, fa 0.778 0.379 0.295 6.7e-24
TAIR|locus:2116607 CYP82C4 ""cytochrome P450, family 82, subfamily C, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 480 (174.0 bits), Expect = 1.0e-45, P = 1.0e-45
 Identities = 99/209 (47%), Positives = 133/209 (63%)

Query:    39 KKKQAQQAPEAGGAWPLIGHLHILRGSEPA-HRVLGNMADKYGPIFTMKLGVKQALVVSN 97
             KK +  +AP   GAWP+IGHLH+L G E   +R LG MAD YGP  +++LG  +A VVS+
Sbjct:    25 KKPKYVKAPAPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGPAMSLQLGSNEAFVVSS 84

Query:    98 WEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRL 157
             +E+AK+CFT NDKA A RP T A + +GYNF V GFAPY  +WR+ RKIATIELLSNRRL
Sbjct:    85 FEVAKDCFTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRL 144

Query:   158 EKLKHVRESEVKASIQRLYKNCIXXXXXXXXXXXEMIHWLEGTVLDIILRIIAGKRY--- 214
             + LKHVR SE+   ++ LY +             ++  WLE   L++I+R++AGKRY   
Sbjct:   145 QMLKHVRVSEITMGVKDLY-SLWFKNGGTKPVMVDLKSWLEDMTLNMIVRMVAGKRYFGG 203

Query:   215 -----TSQSQEVNDWQQQITKFTALSGQF 238
                  +  ++E    ++ I KF  L G F
Sbjct:   204 GGSVSSEDTEEAMQCKKAIAKFFHLIGIF 232
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0004497 "monooxygenase activity" evidence=IDA
GO:0071281 "cellular response to iron ion" evidence=IEP
GO:0010043 "response to zinc ion" evidence=RCA
TAIR|locus:2116652 CYP82C2 ""cytochrome P450, family 82, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116622 CYP82C3 ""cytochrome P450, family 82, subfamily C, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090275 CYP82G1 "cytochrome P450, family 82, subfamily G, polypeptide 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040174 CYP82F1 ""cytochrome P450, family 82, subfamily F, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058619 CYP81D6 ""cytochrome P450, family 81, subfamily D, polypeptide 6"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058657 CYP81D7 ""cytochrome P450, family 81, subfamily D, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126402 CYP91A2 ""cytochrome P450, family 91, subfamily A, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158222 CYP81G1 ""cytochrome P450, family 81, subfamily G, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955640 CYP71A22 ""cytochrome P450, family 71, subfamily A, polypeptide 22"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.5894.4.1
annotation not avaliable (355 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query239
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 4e-28
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 1e-25
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 4e-25
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 4e-24
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 4e-24
pfam00067 461 pfam00067, p450, Cytochrome P450 2e-18
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 3e-17
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 5e-17
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 4e-14
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 5e-12
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 2e-11
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 3e-11
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 2e-09
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information 
 Score =  111 bits (278), Expect = 4e-28
 Identities = 55/197 (27%), Positives = 101/197 (51%), Gaps = 10/197 (5%)

Query: 18  ALVIFLSIFLLISRNGQKRTLKKKQAQQAPEAGGAWPLIGHLHILRGSEPAHRVLGNMAD 77
           +L+  + IF ++       +++K  + + P     WP++G+L  L G  P HR L ++  
Sbjct: 7   SLLFSVLIFNVLIWRWLNASMRK--SLRLPPGPPRWPIVGNLLQL-GPLP-HRDLASLCK 62

Query: 78  KYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFAPYG 137
           KYGP+  ++LG   A+   + E+ +E     D  FA RP+T+A   L Y    +  AP G
Sbjct: 63  KYGPLVYLRLGSVDAITTDDPELIREILLRQDDVFASRPRTLAAVHLAYGCGDVALAPLG 122

Query: 138 NYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYKNCISSSSSRKVVSVEMIHWL 197
            +W++ R+I    LL+ +RLE     R  E +  IQ ++     ++ + K V++  +  L
Sbjct: 123 PHWKRMRRICMEHLLTTKRLESFAKHRAEEARHLIQDVW----EAAQTGKPVNLREV--L 176

Query: 198 EGTVLDIILRIIAGKRY 214
               ++ + R++ GK+Y
Sbjct: 177 GAFSMNNVTRMLLGKQY 193

Length = 514
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 239
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN02687 517 flavonoid 3'-monooxygenase 99.97
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.96
PLN03112 514 cytochrome P450 family protein; Provisional 99.96
PLN02971 543 tryptophan N-hydroxylase 99.96
PLN03234 499 cytochrome P450 83B1; Provisional 99.96
PTZ00404 482 cytochrome P450; Provisional 99.96
PLN02966 502 cytochrome P450 83A1 99.95
PLN02183 516 ferulate 5-hydroxylase 99.95
PLN00168 519 Cytochrome P450; Provisional 99.95
PLN02394 503 trans-cinnamate 4-monooxygenase 99.95
PLN02500 490 cytochrome P450 90B1 99.94
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.93
PLN02196 463 abscisic acid 8'-hydroxylase 99.93
PLN02655 466 ent-kaurene oxidase 99.93
PLN03018 534 homomethionine N-hydroxylase 99.93
PLN02290 516 cytokinin trans-hydroxylase 99.93
PLN02302 490 ent-kaurenoic acid oxidase 99.92
PLN02774 463 brassinosteroid-6-oxidase 99.92
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.91
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.91
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.9
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.89
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.88
PLN02936 489 epsilon-ring hydroxylase 99.88
PLN02738 633 carotene beta-ring hydroxylase 99.88
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.87
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.84
PLN02648 480 allene oxide synthase 99.84
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.78
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.7
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.16
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-32  Score=220.92  Aligned_cols=187  Identities=35%  Similarity=0.603  Sum_probs=164.3

Q ss_pred             CCCCCCccccceeeccccCCCCchHHHHHHHHHHhCCeeEEEcCCeeEEEeCCHHHHHHHHHhCCcccCCCCC-chhhhh
Q 048689           45 QAPEAGGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPK-TMATEL  123 (239)
Q Consensus        45 ~~p~~p~~~p~lG~~~~~~~~~~~~~~~~~~~~~yG~i~~~~~~~~~~v~v~~p~~i~~il~~~~~~~~~~~~-~~~~~~  123 (239)
                      +.||+|+++|++||++++.. ..+|..+.+|.++|||++.+++|..++|+|+|+++++|+|++++..|++|+. ......
T Consensus        26 ~lPPGP~~lPiIGnl~~l~~-~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~~~~~  104 (489)
T KOG0156|consen   26 NLPPGPPPLPIIGNLHQLGS-LPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTATLKY  104 (489)
T ss_pred             CCCcCCCCCCccccHHHcCC-CchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCchhhHHH
Confidence            36777789999999999983 2499999999999999999999999999999999999999999999999997 335566


Q ss_pred             hcCCcceEEecCCCchhHHHHHHHHHhhcChhHHHHhHHHHHHHHHHHHHHHHhhcccCCCCCCccccchHHHHHHHHHH
Q 048689          124 LGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYKNCISSSSSRKVVSVEMIHWLEGTVLD  203 (239)
Q Consensus       124 ~~~~~~~~~~~~~g~~w~~~Rk~~~~~~f~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~d~~~~~~~~~~d  203 (239)
                      +.++..+++++.+|+.||.+||+...+.|+...+++......++++.+++++.+      ... ++++|+.+.+..++.+
T Consensus       105 ~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~------~~~-~~~vdl~~~l~~~~~n  177 (489)
T KOG0156|consen  105 LSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSK------SKK-GEPVDLSELLDLLVGN  177 (489)
T ss_pred             hcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHh------cCC-CceeeHHHHHHHHHHH
Confidence            776777899998899999999999998999999999998889999999999943      111 2699999999999999


Q ss_pred             HHHHHHhcccccCC-chhHHHHHHHHHHHHHhcCCCC
Q 048689          204 IILRIIAGKRYTSQ-SQEVNDWQQQITKFTALSGQFV  239 (239)
Q Consensus       204 ii~~~~fG~~~~~~-~~~~~~~~~~~~~~~~~~~~~~  239 (239)
                      ||++++||.++..+ +++..++.+.+.+.++.++.++
T Consensus       178 vI~~~~fG~rf~~~~~~~~~~~~~l~~~~~~~~~~~~  214 (489)
T KOG0156|consen  178 VICRMLFGRRFEEEDEEEFLELKELVEESLELLGSFN  214 (489)
T ss_pred             HHHHHHhCCccccCCchHHHHHHHHHHHHHHHhCCcc
Confidence            99999999999984 4566679999999999888764

>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query239
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 6e-12
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 1e-06
3qz1_A 496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 1e-06
2hi4_A 495 Crystal Structure Of Human Microsomal P450 1a2 In C 2e-06
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 1e-05
3pm0_A 507 Structural Characterization Of The Complex Between 2e-05
3ibd_A 476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 3e-05
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 6e-05
1dt6_A 473 Structure Of Mammalian Cytochrome P450 2c5 Length = 6e-05
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 7e-05
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 1e-04
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 4e-04
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 4e-04
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 4e-04
2pg7_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 4e-04
2pg5_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 4e-04
1pq2_A 476 Crystal Structure Of Human Drug Metabolizing Cytoch 5e-04
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure 
Iteration: 1

 Score = 67.4 bits (163), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 4/127 (3%)
Query: 38  LKKKQAQQAPEAGGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSN 97
           + KK   + P++  + PL+G L  L      H     +  KYGPI+++++G K  ++V +
Sbjct: 1   MAKKTGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGH 60
Query: 98  WEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKI--ATIELL--S 153
            ++AKE      K F+GRP+    ++   N   I FA  G +W+  R++  AT  L    
Sbjct: 61  HQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDG 120
Query: 154 NRRLEKL 160
           +++LEK+
Sbjct: 121 DQKLEKI 127
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query239
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 3e-43
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 4e-39
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 4e-38
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-29
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-28
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 5e-26
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 5e-26
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 3e-25
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 2e-23
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-22
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 5e-22
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 7e-20
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-19
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 2e-18
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 2e-18
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-18
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 3e-16
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 8e-16
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 6e-15
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 3e-12
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 5e-12
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 2e-11
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 1e-10
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-10
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 1e-06
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 4e-04
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
 Score =  151 bits (383), Expect = 3e-43
 Identities = 27/212 (12%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 20  VIFLSIFLLISRNGQKRTLKKKQAQQAPEAGGAWPLIGHLHILRGSEPAHRVLGNMADKY 79
           +   +  +L  R       + ++  + P   G  P +GH     G +   + L  M +K+
Sbjct: 1   MAKKTSSVLYGR-------RTRRRNEPPLDKGMIPWLGHALEF-GKDA-AKFLTRMKEKH 51

Query: 80  GPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFAPYGNY 139
           G IFT++       V+ +      C+       A   +T   ++L      +    +   
Sbjct: 52  GDIFTVRAAGLYITVLLD----SNCYDAVLSDVASLDQTSYAQVLMKRIFNMILPSHNPE 107

Query: 140 WRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYKNCISSSSSRKVVSVEMIHWLEG 199
             + R            L +L +  ++ ++  +                  ++   W + 
Sbjct: 108 SEKKRAEMH---FQGASLTQLSNSMQNNLRLLMTPSEM------------GLKTSEWKKD 152

Query: 200 TVLDIILRIIAGKRYTSQSQEVNDWQQQITKF 231
            + ++   ++    Y +     N+    +T+ 
Sbjct: 153 GLFNLCYSLLFKTGYLTVFGAENNNSAALTQI 184
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query239
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.96
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.95
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.94
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.94
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.94
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.94
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.93
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.93
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.93
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.93
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.93
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.93
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.93
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.92
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.92
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.91
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.91
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.9
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.89
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.89
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.89
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.89
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.86
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.85
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.85
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.84
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.84
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.81
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.8
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.79
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.78
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.77
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.76
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.75
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.73
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.73
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.73
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.72
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.72
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.71
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.7
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.7
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.7
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.69
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.68
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.68
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.68
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.68
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.67
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.67
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.66
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.66
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.65
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.65
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.65
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.64
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.64
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.63
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.62
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.62
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.61
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.59
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.58
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.58
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.57
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.56
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.56
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.55
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.53
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 99.51
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.5
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 99.46
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.4
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.37
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.3
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 98.94
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 98.19
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 90.81
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 82.27
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 81.18
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 80.68
2krb_A81 Eukaryotic translation initiation factor 3 subunit 80.13
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
Probab=99.96  E-value=8e-28  Score=197.22  Aligned_cols=179  Identities=24%  Similarity=0.366  Sum_probs=145.1

Q ss_pred             CCCCCccccceeeccccCCCCchHHHHHHHHHHhCCeeEEEcCCeeEEEeCCHHHHHHHHHhCCcccCCCCCchhhhhhc
Q 048689           46 APEAGGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATELLG  125 (239)
Q Consensus        46 ~p~~p~~~p~lG~~~~~~~~~~~~~~~~~~~~~yG~i~~~~~~~~~~v~v~~p~~i~~il~~~~~~~~~~~~~~~~~~~~  125 (239)
                      .||||.++|++||++++...++++..+.+|+++||+|+++++|+.++++|+||+++++++.++...|.+|+.......++
T Consensus         9 ~PPgP~~lPliGnl~~l~~~~~~~~~~~~~~~kYG~i~~~~~g~~~~vvv~~p~~~k~il~~~~~~f~~rp~~~~~~~~~   88 (494)
T 3swz_A            9 YPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIAS   88 (494)
T ss_dssp             ---CCBCCCEEEEESSCTTSSCHHHHHHHTHHHHCSEEEEEETTEEEEEECSHHHHHHHHTTTTTTTBBCCCCHHHHHHT
T ss_pred             CCCCCCCCCeEcchHHhCCCCchhHHHHHHHHHcCCEEEEEeCCCCEEEECCHHHHHHHHHhCcHhhCCCCCcHHHHHhc
Confidence            56677789999999988643578999999999999999999999999999999999999998888999888776555555


Q ss_pred             CCcceEEecCCCchhHHHHHHHHHhhcCh--hHHHHhHHHHHHHHHHHHHHHHhhcccCCCCCCccccchHHHHHHHHHH
Q 048689          126 YNFLVIGFAPYGNYWRQSRKIATIELLSN--RRLEKLKHVRESEVKASIQRLYKNCISSSSSRKVVSVEMIHWLEGTVLD  203 (239)
Q Consensus       126 ~~~~~~~~~~~g~~w~~~Rk~~~~~~f~~--~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~d~~~~~~~~~~d  203 (239)
                      .+..+++++.+|+.|+++||++.+ .|+.  ..++.+.+.+.+++..+++.+.+      ..  +.++|+...+..+++|
T Consensus        89 ~~~~gl~~~~~g~~wr~~Rr~~~~-~f~~~~~~~~~~~~~i~~~~~~l~~~l~~------~~--~~~vd~~~~~~~~t~d  159 (494)
T 3swz_A           89 NNRKGIAFADSGAHWQLHRRLAMA-TFALFKDGDQKLEKIICQEISTLCDMLAT------HN--GQSIDISFPVFVAVTN  159 (494)
T ss_dssp             TTTCSSSSSCSSHHHHHHHHHHHH-HTTTTSSSTTCHHHHHHHHHHHHHHHHHH------TT--TEEECCHHHHHHHHHH
T ss_pred             cCCCCeEeCCCCHHHHHHHHHHHH-HHHHhcchHHHHHHHHHHHHHHHHHHHHH------cC--CCcccHHHHHHHHHHH
Confidence            444566677679999999999999 7874  45778899999999999998842      22  5689999999999999


Q ss_pred             HHHHHHhcccccCCchhHHHHHHHHHHHHH
Q 048689          204 IILRIIAGKRYTSQSQEVNDWQQQITKFTA  233 (239)
Q Consensus       204 ii~~~~fG~~~~~~~~~~~~~~~~~~~~~~  233 (239)
                      +|+.++||.+++..++....+.+..+.+..
T Consensus       160 vi~~~~fG~~~~~~~~~~~~~~~~~~~~~~  189 (494)
T 3swz_A          160 VISLICFNTSYKNGDPELNVIQNYNEGIID  189 (494)
T ss_dssp             HHHHHHHSCCCCTTCTHHHHHHHHHHHHHH
T ss_pred             HHHHHHcCCcCCCCCHHHHHHHHHHHHHHH
Confidence            999999999987655555444444444433
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 239
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 5e-28
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 7e-28
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 9e-27
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 9e-23
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 6e-21
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 2e-19
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 2e-19
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 4e-15
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 3e-08
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  108 bits (270), Expect = 5e-28
 Identities = 37/188 (19%), Positives = 80/188 (42%), Gaps = 12/188 (6%)

Query: 52  AWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKA 111
             P+IG++  + G +   + L N++  YGP+FT+  G+K  +V+  +E  KE      + 
Sbjct: 10  PLPVIGNILQI-GIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEE 68

Query: 112 FAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEK-LKHVRESEVKA 170
           F+GR      E     F +      G  W++ R+ + + L +    ++ ++   + E + 
Sbjct: 69  FSGRGIFPLAERANRGFGI--VFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARC 126

Query: 171 SIQRLYKNCISSSSSRKVVSVEMIHWLEGTVLDIILRIIAGKRYTSQSQEVNDWQQQITK 230
            ++ L K   S          +    L     ++I  II  KR+  + Q+  +  +++ +
Sbjct: 127 LVEELRKTKAS--------PCDPTFILGCAPCNVICSIIFHKRFDYKDQQFLNLMEKLNE 178

Query: 231 FTALSGQF 238
              +    
Sbjct: 179 NIKILSSP 186
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query239
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.94
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.93
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.91
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.9
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.89
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.88
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.85
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.81
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.66
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.53
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.52
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.48
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.47
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.37
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.26
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.23
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.17
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.17
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 98.99
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 98.95
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 98.72
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 85.26
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 84.94
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 84.68
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 84.19
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 81.26
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome P450 bm-3
species: Bacillus megaterium [TaxId: 1404]

Probab=99.94  E-value=8.4e-26  Score=181.35  Aligned_cols=176  Identities=13%  Similarity=0.121  Sum_probs=137.7

Q ss_pred             CCCCCCccccceeeccccCCCCchHHHHHHHHHHhCCeeEEEcCCeeEEEeCCHHHHHHHHHhCCcccCCCCCc-hhhhh
Q 048689           45 QAPEAGGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKT-MATEL  123 (239)
Q Consensus        45 ~~p~~p~~~p~lG~~~~~~~~~~~~~~~~~~~~~yG~i~~~~~~~~~~v~v~~p~~i~~il~~~~~~~~~~~~~-~~~~~  123 (239)
                      .+|+ |.++|++||++.+.. ++++..+.+|+++|||||++++++.++++++||+++++++.++...+..+... .....
T Consensus         2 ~iPG-P~~~p~lG~l~~l~~-~~~~~~~~~~~~kyG~if~~~~~~~~~vvl~~~~~i~~v~~~~~~~~~~~~~~~~~~~~   79 (453)
T d2ij2a1           2 EMPQ-PKTFGELKNLPLLNT-DKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDF   79 (453)
T ss_dssp             CCCC-CCCCGGGTTGGGGCS-SCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHTCTTTEEECCCHHHHHHHHH
T ss_pred             CCcc-CCCcchhhCHHHhCC-CCHHHHHHHHHHHhCCEEEEEeCCceEEEECCHHHHHHHHhcCCcccccccHhHHHHHh
Confidence            4676 458999999999864 77999999999999999999999999999999999999997655555444332 23334


Q ss_pred             hcCCcceEEe-cCCCchhHHHHHHHHHhhcChhHHHHhHHHHHHHHHHHHHHHHhhcccCCCCCCccccchHHHHHHHHH
Q 048689          124 LGYNFLVIGF-APYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYKNCISSSSSRKVVSVEMIHWLEGTVL  202 (239)
Q Consensus       124 ~~~~~~~~~~-~~~g~~w~~~Rk~~~~~~f~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~d~~~~~~~~~~  202 (239)
                      .|.   +++. ..+|+.|+++|+++.+ .|++++++.+.+.+.+++.++++.|.      ... ++.++|+.+++.++++
T Consensus        80 ~g~---~~~~~~~~g~~wk~~Rk~l~~-~fs~~~l~~~~~~i~~~~~~li~~l~------~~~-~~~~idl~~~~~~~~~  148 (453)
T d2ij2a1          80 AGD---GLFTSWTHEKNWKKAHNILLP-SFSQQAMKGYHAMMVDIAVQLVQKWE------RLN-ADEHIEVPEDMTRLTL  148 (453)
T ss_dssp             HTT---SGGGSCTTSHHHHHHHHHHGG-GGSTTTHHHHHHHHHHHHHHHHHHHH------TCC-TTCCEEHHHHHHHHHH
T ss_pred             cCC---cEEecCCChHHHHHHHHHHHH-HhhhhhhhhhhhhHHHHHHHHHHHhh------hcC-CCCccchHHHHHHHhh
Confidence            442   2332 3469999999999998 89999999999999999999999993      222 2568999999999999


Q ss_pred             HHHHHHHhcccccC-----CchhHHHHHHHHHHHHH
Q 048689          203 DIILRIIAGKRYTS-----QSQEVNDWQQQITKFTA  233 (239)
Q Consensus       203 dii~~~~fG~~~~~-----~~~~~~~~~~~~~~~~~  233 (239)
                      |++++++||.+++.     .++....+.+.+...+.
T Consensus       149 ~~i~~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~  184 (453)
T d2ij2a1         149 DTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMN  184 (453)
T ss_dssp             HHHHHHHHSCCCCGGGCSSCCHHHHHHHHHHHHHHH
T ss_pred             hcchhcccccccchhhhccchHHHHhhhhccchhhh
Confidence            99999999998753     22234445555544443
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure