Citrus Sinensis ID: 048752

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----

ISVIGDLKKLEILCLRGSDIKQLPIEVGQLTWLTLLDLRECRKLEVIPPNVLSNLSHLEELCISRRSFQKWEVEVEGAKNASLEELKHLPNLTSLELDIHDVNTLPRGLFLEKLGKYRIRIGDWYWESTNIWRSEFRLRLNNKICLKDWLIVQLQGIEDLELRKLQEQDVIYFANELVKVGSSQLKFLRIHGCSDALNPPAESKV

cccccccccccEEEccccccccccHHHHccccccEEccccccccccccHHHHccccccHHcccccccccccHHHHcccccccHHHHcccccccEEEccccccccccccHHHHHccccccccccccccccccccccHHHHcccccccHHHHHHHcccccEEEEEEcccccccccccccccccccccEEEEEEcccccccccccccc

ccHHHHHHHcEEEEcccccHHHccHHHHHHHccEEEEccccccccEccHHHHHHHHHHHHHEccccccccccccccccccccHHHHHccccccEEEEEcccccccccccHHHHccEEEEEEccccEcccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccEEEEccHcccccccccEEEEEcccHHcccccccccc

ISVIGDLKKLEILCLrgsdikqlpievgQLTWLTLLdlrecrklevippnvlsnlSHLEELCISRRSFQKWEVEVEGaknasleelkhlpnltsleldihdvntlprglFLEKLGKYRIRIGDWYWESTNIWRSEFRLRLNNKICLKDWLIVQLQGIEDLELRKLQEQDVIYFANELVKVGSSQLKFLRIhgcsdalnppaeskv

isvigdlkKLEILCLRgsdikqlpievGQLTWLTLLDLRECRKLEvippnvlsnlsHLEELCISRRSFQKWEVEVEGAKnasleelkhlpnltsleldihdvntlprglfLEKLGKYRIRIGDWYWESTNIWRSEFRLRLNNKICLKDWLIVQLQGIEDLELRKLQEQDVIYFANELVKVGSSQLKFLRIhgcsdalnppaeskv

***IGDLKKLEILCLRGSDIKQLPIEVGQLTWLTLLDLRECRKLEVIPPNVLSNLSHLEELCISRRSFQKWEVEVEGAKNASLEELKHLPNLTSLELDIHDVNTLPRGLFLEKLGKYRIRIGDWYWESTNIWRSEFRLRLNNKICLKDWLIVQLQGIEDLELRKLQEQDVIYFANELVKVGSSQLKFLRIHGCS***********

ISVIGDLKKLEILCLRGSDIKQLPIEVGQLTWLTLLDLRECRKLEVIPPNVLSNLSHLEELCISRRSFQKWEVEVEGAKNASLEELKHLPNLTSLELDIHDVNTLPRGLFLEKLGKYRIRIGDWYWE*********RLRLNNKICLKDWLIVQLQGIEDLELRKLQEQDVIYFANELVKVGSSQLKFLRIHGCSDALNPPA****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		205	2.2.26 [Sep-21-2011]
Q9T048		985	Disease resistance protei	yes	no	0.575	0.119	0.344	2e-06
Q42484		909	Disease resistance protei	no	no	0.492	0.111	0.342	0.0002

>sp\|Q9T048\|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1	Back alignment and function desciption

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 65/122 (53%), Gaps = 4/122 (3%)

Query: 7   LKKLEILCLRGSDIKQLPIEVGQLTWLTLLDLRECRKLEVIPPNVLSNLSHLEELCISRR 66
           L KLE+L L G+ I + P  + +L     LDL     LE IP  V+S LS LE L ++  
Sbjct: 596 LAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMT-S 654

Query: 67  SFQKWEVEVEGAKN-ASLEELKHLPNLTSLELDIHDVNTL--PRGLFLEKLGKYRIRIGD 123
           S  +W V+ E  K  A++EE+  L  L  L + +H    L   R  ++++L K+++ +G 
Sbjct: 655 SHYRWSVQGETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLVVGS 714

Query: 124 WY 125
            Y
Sbjct: 715 RY 716

Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q42484\|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		205
224110992		2359	cc-nbs-lrr resistance protein [Populus t	0.897	0.077	0.468	2e-31
224083434		1144	cc-nbs-lrr resistance protein [Populus t	0.926	0.166	0.426	3e-30
359488027		1520	PREDICTED: disease resistance protein At	0.902	0.121	0.442	2e-29
296087872		1152	unnamed protein product [Vitis vinifera]	0.902	0.160	0.442	2e-29
224111296		1315	cc-nbs-lrr resistance protein [Populus t	0.926	0.144	0.414	2e-28
359488108		1436	PREDICTED: disease resistance protein At	0.790	0.112	0.467	7e-28
255542484		2460	phosphoprotein phosphatase, putative [Ri	0.926	0.077	0.462	9e-28
147777048		1460	hypothetical protein VITISV_009359 [Viti	0.780	0.109	0.473	2e-27
255574526		1232	Disease resistance protein RFL1, putativ	0.936	0.155	0.436	2e-27
449515209		1612	PREDICTED: LOW QUALITY PROTEIN: disease	0.912	0.116	0.432	3e-27

>gi\|224110992\|ref\|XP_002332999.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222834484\|gb\|EEE72961.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  141 bits (356), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 90/192 (46%), Positives = 122/192 (63%), Gaps = 8/192 (4%)

Query: 1   ISVIGDLKKLEILCLRGSDIKQLPIEVGQLTWLTLLDLRECRKLEVIPPNVLSNLSHLEE 60
           IS IGDLK+LEIL    S+IKQLP E+ QLT L LLDL +C +LEVIPP+V S LS LEE
Sbjct: 578 ISAIGDLKRLEILSFFQSNIKQLPREIAQLTKLRLLDLSDCFELEVIPPDVFSKLSMLEE 637

Query: 61  LCISRRSFQKWEVEVEGAKNASLEELKHLPNLTSLELDIHDVNTLPRGLFLEKLGKYRIR 120
           L + R SF +W  + EG  NASL EL++L +LT+ E+ I D   LP G+  E+L KYR+ 
Sbjct: 638 LYM-RNSFHQW--DAEGKNNASLAELENLSHLTNAEIHIQDSQVLPYGIIFERLKKYRVC 694

Query: 121 IG-DWYWESTNIWRSEFRLRLNNKICLKDWLI-VQLQGIEDLELRKLQEQDVIYFANELV 178
           IG DW W+         +L+LN KI  +++ I + L   EDL L +++  ++I    EL 
Sbjct: 695 IGDDWDWDGAYEMLRTAKLKLNTKIDHRNYGIRMLLNRTEDLYLFEIEGVNII---QELD 751

Query: 179 KVGSSQLKFLRI 190
           + G   LK L++
Sbjct: 752 REGFPHLKHLQL 763

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224083434\|ref\|XP_002307025.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222856474\|gb\|EEE94021.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359488027\|ref\|XP_002269288.2\| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296087872\|emb\|CBI35155.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224111296\|ref\|XP_002332952.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222834264\|gb\|EEE72741.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359488108\|ref\|XP_003633701.1\| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255542484\|ref\|XP_002512305.1\| phosphoprotein phosphatase, putative [Ricinus communis] gi\|223548266\|gb\|EEF49757.1\| phosphoprotein phosphatase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|147777048\|emb\|CAN65562.1\| hypothetical protein VITISV_009359 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255574526\|ref\|XP_002528174.1\| Disease resistance protein RFL1, putative [Ricinus communis] gi\|223532386\|gb\|EEF34181.1\| Disease resistance protein RFL1, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|449515209\|ref\|XP_004164642.1\| PREDICTED: LOW QUALITY PROTEIN: disease resistance protein At4g27190-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		205
TAIR\|locus:2136447		985	AT4G27190 [Arabidopsis thalian	0.575	0.119	0.344	5.3e-07
TAIR\|locus:2174920		1017	AT5G40100 [Arabidopsis thalian	0.517	0.104	0.35	3.7e-05
TAIR\|locus:2005517		909	RPS2 "RESISTANT TO P. SYRINGAE	0.497	0.112	0.345	0.00017
ZFIN\|ZDB-GENE-080327-22		684	flrt1a "fibronectin leucine ri	0.595	0.178	0.286	0.00021
TAIR\|locus:2170333		1197	CSA1 "constitutive shade-avoid	0.287	0.049	0.451	0.00032
ZFIN\|ZDB-GENE-040718-372		238	lrrc57 "leucine rich repeat co	0.473	0.407	0.336	0.00042
TAIR\|locus:2175009		415	AT5G66890 "AT5G66890" [Arabido	0.443	0.219	0.315	0.00055
TAIR\|locus:2145407		613	AT5G10290 [Arabidopsis thalian	0.497	0.166	0.336	0.00055

TAIR\|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 139 (54.0 bits), Expect = 5.3e-07, P = 5.3e-07
 Identities = 42/122 (34%), Positives = 65/122 (53%)

Query:     7 LKKLEILCLRGSDIKQLPIEVGQLTWLTLLDLRECRKLEVIPPNVLSNLSHLEELCISRR 66
             L KLE+L L G+ I + P  + +L     LDL     LE IP  V+S LS LE L ++  
Sbjct:   596 LAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTS- 654

Query:    67 SFQKWEVEVEGAKN-ASLEELKHLPNLTSLELDIHDVNTL--PRGLFLEKLGKYRIRIGD 123
             S  +W V+ E  K  A++EE+  L  L  L + +H    L   R  ++++L K+++ +G 
Sbjct:   655 SHYRWSVQGETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLVVGS 714

Query:   124 WY 125
              Y
Sbjct:   715 RY 716

GO:0000166 "nucleotide binding" evidence=IEA

GO:0005739 "mitochondrion" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2174920 AT5G40100 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-080327-22 flrt1a "fibronectin leucine rich transmembrane 1a" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

TAIR\|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040718-372 lrrc57 "leucine rich repeat containing 57" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

TAIR\|locus:2175009 AT5G66890 "AT5G66890" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2145407 AT5G10290 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		205
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.74
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.69
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.68
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.62
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.62
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.61
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.61
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.58
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.57
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.54
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.54
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.47
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.42
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.38
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.34
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.34
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.32
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.31
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.25
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.24
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	99.23
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.16
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	99.15
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	99.14
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.1
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	99.09
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.08
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	99.05
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.0
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.99
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.92
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.75
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.69
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.63
PLN03150		623	hypothetical protein; Provisional	98.56
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.56
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.56
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.54
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.5
PRK15386		426	type III secretion protein GogB; Provisional	98.47
PLN03150		623	hypothetical protein; Provisional	98.45
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.42
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.37
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.36
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.34
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.23
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.22
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	98.2
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	98.13
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.08
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.97
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.88
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.85
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.77
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.75
KOG2123		388	consensus Uncharacterized conserved protein [Funct	97.64
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.51
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	97.49
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	97.37
PRK15386		426	type III secretion protein GogB; Provisional	97.28
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.21
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.01
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.96
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	96.72
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.71
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	96.57
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	96.55
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	96.51
KOG4341		483	consensus F-box protein containing LRR [General fu	96.17
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.93
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	95.65
KOG4341		483	consensus F-box protein containing LRR [General fu	95.27
smart00370		26	LRR Leucine-rich repeats, outliers.	95.26
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	95.26
KOG0473		326	consensus Leucine-rich repeat protein [Function un	95.09
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	94.98
smart00370		26	LRR Leucine-rich repeats, outliers.	94.98
KOG1947		482	consensus Leucine rich repeat proteins, some prote	94.64
KOG3864		221	consensus Uncharacterized conserved protein [Funct	93.43
KOG3864		221	consensus Uncharacterized conserved protein [Funct	92.49
smart00364		26	LRR_BAC Leucine-rich repeats, bacterial type.	91.96
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	91.4
KOG0473		326	consensus Leucine-rich repeat protein [Function un	90.95
KOG1947		482	consensus Leucine rich repeat proteins, some prote	90.37
smart00365		26	LRR_SD22 Leucine-rich repeat, SDS22-like subfamily	88.42
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	87.09

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

Probab=99.74  E-value=4.1e-20  Score=130.95  Aligned_cols=156  Identities=20%  Similarity=0.319  Sum_probs=112.0

Q ss_pred             cccCcccceeEeecCCCccccchhhccccccceEeccCCCCCcccChHHhhcccccceeecCCCccchhhhhhhcccccc
Q 048752            3 VIGDLKKLEILCLRGSDIKQLPIEVGQLTWLTLLDLRECRKLEVIPPNVLSNLSHLEELCISRRSFQKWEVEVEGAKNAS   82 (205)
Q Consensus         3 ~i~~l~~L~~L~l~~~~i~~lp~~i~~l~~L~~L~l~~c~~l~~lp~~~~~~l~~L~~L~l~~~~~~~~~~~i~~~~~~~   82 (205)
                      .+-.+.+.+.|.+++|+++.+|+.|..+.+|++|++++ ++++.+|.+ ++.|+.|++|+++.|++..+|.         
T Consensus        28 gLf~~s~ITrLtLSHNKl~~vppnia~l~nlevln~~n-nqie~lp~~-issl~klr~lnvgmnrl~~lpr---------   96 (264)
T KOG0617|consen   28 GLFNMSNITRLTLSHNKLTVVPPNIAELKNLEVLNLSN-NQIEELPTS-ISSLPKLRILNVGMNRLNILPR---------   96 (264)
T ss_pred             cccchhhhhhhhcccCceeecCCcHHHhhhhhhhhccc-chhhhcChh-hhhchhhhheecchhhhhcCcc---------
Confidence            34456778899999999999999999999999999999 899999998 9999999999999999988876         


Q ss_pred             HHhhcCCCCccEEEEEeeCCee--ccCCcCcccccceEEe-eccccccC-CC---CCCCcceEEecCc--ccchhhHHHh
Q 048752           83 LEELKHLPNLTSLELDIHDVNT--LPRGLFLEKLGKYRIR-IGDWYWES-TN---IWRSEFRLRLNNK--ICLKDWLIVQ  153 (205)
Q Consensus        83 ~~~l~~l~~L~~L~l~~~~~~~--~~~~~~~~~L~~L~~~-~~~~~~~~-~~---~~~~L~~L~l~~~--~~~~~~~~~~  153 (205)
                        +++.++.|+.|++++|.+..  +|.  .|-.++.|+-+ +++++++. |.   .+.+|+.|.+..+  ...++.++ .
T Consensus        97 --gfgs~p~levldltynnl~e~~lpg--nff~m~tlralyl~dndfe~lp~dvg~lt~lqil~lrdndll~lpkeig-~  171 (264)
T KOG0617|consen   97 --GFGSFPALEVLDLTYNNLNENSLPG--NFFYMTTLRALYLGDNDFEILPPDVGKLTNLQILSLRDNDLLSLPKEIG-D  171 (264)
T ss_pred             --ccCCCchhhhhhccccccccccCCc--chhHHHHHHHHHhcCCCcccCChhhhhhcceeEEeeccCchhhCcHHHH-H
Confidence              99999999999999997654  444  34556666655 67777665 22   3333333333211  23344444 3


Q ss_pred             cCCccEEEeccCchhhHHhHHHHh
Q 048752          154 LQGIEDLELRKLQEQDVIYFANEL  177 (205)
Q Consensus       154 ~~~L~~L~l~~~~~~~~~~~~~~l  177 (205)
                      +++|+.|.+.+|.   ++-+|.++
T Consensus       172 lt~lrelhiqgnr---l~vlppel  192 (264)
T KOG0617|consen  172 LTRLRELHIQGNR---LTVLPPEL  192 (264)
T ss_pred             HHHHHHHhcccce---eeecChhh
Confidence            4455555554443   34444443

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00364 LRR_BAC Leucine-rich repeats, bacterial type	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		205
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-10
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-10
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-10
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-06
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-04
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	4e-10
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	7e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-05
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	4e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-09
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	6e-05
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	9e-05
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-04
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-08
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-08
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-07
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-07
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	7e-06
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-08
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-07
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	4e-06
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-07
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-06
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	8e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	9e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-04
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	2e-07
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	8e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-06
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-06
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	9e-06
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-05
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	3e-07
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	8e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-07
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	6e-07
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	7e-07
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	7e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-04
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	9e-07
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	5e-04
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-06
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	7e-05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-04
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	3e-04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-06
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	4e-04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	9e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	1e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-05
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-06
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	6e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	7e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-06
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	4e-05
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	4e-05
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	9e-04
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-06
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	8e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-06
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	4e-06
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	7e-05
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	4e-06
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	4e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	8e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-04
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	7e-04
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	5e-06
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-06
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-04
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	7e-06
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	7e-06
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	7e-06
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-04
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	8e-06
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	9e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-04
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-05
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	3e-04
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	3e-05
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	3e-05
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	9e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	7e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	5e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	5e-05
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	9e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-04
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-04
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	2e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-04
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	3e-04
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	3e-04
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	6e-04
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-04
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	4e-04
3m19_A		251	Variable lymphocyte receptor A diversity region; a	4e-04
3m19_A		251	Variable lymphocyte receptor A diversity region; a	7e-04
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	5e-04

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

 Score = 57.6 bits (140), Expect = 2e-10
 Identities = 26/103 (25%), Positives = 46/103 (44%), Gaps = 3/103 (2%)

Query: 4   IGDLKKLEILCLRGSDIKQLPIEVGQLTWLTLLDLRECRKLEVIPPNVLSNLSHLEELCI 63
              L  L+ + +  + + +LP  + Q   L  L L     L  +P + +++L+ L EL I
Sbjct: 100 AFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARN-PLRALPAS-IASLNRLRELSI 157

Query: 64  SRRSFQKWEVEVEGAKNASLEELKHLPNLTSLELDIHDVNTLP 106
                +  E+    A   +  E + L NL SL L+   + +LP
Sbjct: 158 RACP-ELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLP 199

PyMOL of 4fcg

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		205
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.87
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.84
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.82
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.82
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.81
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.81
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.8
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.79
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.79
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.79
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.78
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.78
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.78
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.78
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.78
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.78
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.77
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.77
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.77
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.77
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.76
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.76
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.76
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.75
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.75
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.75
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.75
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.75
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.75
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.74
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.74
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.74
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.74
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.74
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.73
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.73
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.72
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.72
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.72
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.72
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.72
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.72
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.72
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.72
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.71
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.71
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.71
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.71
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.71
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.71
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.71
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.71
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.7
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.7
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.7
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.7
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.7
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.7
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.7
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.69
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.69
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.69
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.68
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.68
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.68
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.67
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.67
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.66
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.66
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.66
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.66
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.65
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.65
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.65
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.65
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.64
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.64
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.64
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.64
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.64
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.63
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.63
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.63
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.62
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.62
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.61
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.61
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.6
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.6
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.6
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.6
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.6
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.6
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.59
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.58
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.58
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.58
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.57
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.57
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.57
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.57
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.56
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.56
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.56
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.55
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.55
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.54
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.54
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.54
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.53
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.53
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.53
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.53
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.52
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.52
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.5
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.49
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.47
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.44
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.44
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.4
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.4
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.39
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.39
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.38
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.38
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.38
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.38
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.35
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.35
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.34
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.33
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.31
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.27
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	99.24
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.22
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.22
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	99.19
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.15
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.09
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.05
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.98
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	98.94
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.88
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.78
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.67
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.64
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.59
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.32
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.21
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.1
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.02
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.99
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.88
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	97.5
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.45
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	97.3
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	97.28
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.03
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.0
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	96.95
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.19
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	95.0
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	90.85

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

Probab=99.87  E-value=1.4e-22  Score=161.18  Aligned_cols=189  Identities=19%  Similarity=0.240  Sum_probs=124.6

Q ss_pred             ccCcccceeEeecCCCccccchhhccccccceEeccCCCCCcccChHHhhcccccceeecCCCccch-hhhhhhcccccc
Q 048752            4 IGDLKKLEILCLRGSDIKQLPIEVGQLTWLTLLDLRECRKLEVIPPNVLSNLSHLEELCISRRSFQK-WEVEVEGAKNAS   82 (205)
Q Consensus         4 i~~l~~L~~L~l~~~~i~~lp~~i~~l~~L~~L~l~~c~~l~~lp~~~~~~l~~L~~L~l~~~~~~~-~~~~i~~~~~~~   82 (205)
                      ++++++|++|++++|.++.+|..++.+++|++|++++ +.+..+|.. +..+++|++|++++|.... +|..+..  ...
T Consensus       100 l~~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~-n~l~~lp~~-l~~l~~L~~L~L~~n~~~~~~p~~~~~--~~~  175 (328)
T 4fcg_A          100 AFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLAR-NPLRALPAS-IASLNRLRELSIRACPELTELPEPLAS--TDA  175 (328)
T ss_dssp             GGGGTTCSEEEEESSCCCCCCSCGGGGTTCSEEEEES-CCCCCCCGG-GGGCTTCCEEEEEEETTCCCCCSCSEE--EC-
T ss_pred             hhhCCCCCEEECCCCCccchhHHHhccCCCCEEECCC-CccccCcHH-HhcCcCCCEEECCCCCCccccChhHhh--ccc
Confidence            4456667777777776666666666677777777766 455566665 6666777777776654332 3321110  000


Q ss_pred             HHhhcCCCCccEEEEEeeCCeeccCCcCcccccceEEe-eccccccC-CC---CCCCcceEEecCcc---cchhhHHHhc
Q 048752           83 LEELKHLPNLTSLELDIHDVNTLPRGLFLEKLGKYRIR-IGDWYWES-TN---IWRSEFRLRLNNKI---CLKDWLIVQL  154 (205)
Q Consensus        83 ~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~L~~L~~~-~~~~~~~~-~~---~~~~L~~L~l~~~~---~~~~~~~~~~  154 (205)
                      ...++.+++|++|++++|.++.+|..+  .+++.|+.+ +.++.+.. |.   .+++|++|+++.+.   ..+.++. .+
T Consensus       176 ~~~~~~l~~L~~L~L~~n~l~~lp~~l--~~l~~L~~L~L~~N~l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~-~l  252 (328)
T 4fcg_A          176 SGEHQGLVNLQSLRLEWTGIRSLPASI--ANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFG-GR  252 (328)
T ss_dssp             CCCEEESTTCCEEEEEEECCCCCCGGG--GGCTTCCEEEEESSCCCCCCGGGGGCTTCCEEECTTCTTCCBCCCCTT-CC
T ss_pred             hhhhccCCCCCEEECcCCCcCcchHhh--cCCCCCCEEEccCCCCCcCchhhccCCCCCEEECcCCcchhhhHHHhc-CC
Confidence            112345888888888888888776543  566666665 55555544 32   56788888885532   2344455 57


Q ss_pred             CCccEEEeccCchhhHHhHHHHhhhcCCCCccEEeecCCCCCCCCCCCC
Q 048752          155 QGIEDLELRKLQEQDVIYFANELVKVGSSQLKFLRIHGCSDALNPPAES  203 (205)
Q Consensus       155 ~~L~~L~l~~~~~~~~~~~~~~l~~~~~~~L~~L~l~~~~~l~~lp~~~  203 (205)
                      ++|+.|++++|.  ..+.+|..+  ..+++|++|++++|+.++.+|..+
T Consensus       253 ~~L~~L~L~~n~--~~~~~p~~~--~~l~~L~~L~L~~n~~~~~iP~~l  297 (328)
T 4fcg_A          253 APLKRLILKDCS--NLLTLPLDI--HRLTQLEKLDLRGCVNLSRLPSLI  297 (328)
T ss_dssp             CCCCEEECTTCT--TCCBCCTTG--GGCTTCCEEECTTCTTCCCCCGGG
T ss_pred             CCCCEEECCCCC--chhhcchhh--hcCCCCCEEeCCCCCchhhccHHH
Confidence            889999999888  777888777  588999999999998888888754

PyMOL of 4fcg

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		205
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	2e-04
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-04

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 29/173 (16%), Positives = 48/173 (27%), Gaps = 18/173 (10%)

Query: 31  TWLTLLDLRECRKLEVIPPNVLSNLSHLEELCISRRSFQKWEVEVEGAKNASLEELKHLP 90
               LLDL+   K+  I      NL +L  L +      K                  L 
Sbjct: 31  PDTALLDLQNN-KITEIKDGDFKNLKNLHTLILINNKISKISPGA----------FAPLV 79

Query: 91  NLTSLELDIHDVNTLPRGL--FLEKLGKYRIRIGDWYWESTNIWRSEFRLRLNNKIC-LK 147
            L  L L  + +  LP  +   L++L  +   I        N       + L        
Sbjct: 80  KLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSS 139

Query: 148 DWLIVQLQGIEDLELRKLQEQDVIYFANELVKVGSSQLKFLRIHGCSDALNPP 200
                  QG++ L   ++ + ++      L       L  L + G        
Sbjct: 140 GIENGAFQGMKKLSYIRIADTNITTIPQGL----PPSLTELHLDGNKITKVDA 188

PyMOL of d1xkua_

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		205
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.77
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.74
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.74
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.72
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.7
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.69
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.69
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.68
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.63
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.63
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.62
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.62
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.59
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.59
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.59
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.59
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.57
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.56
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.56
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.56
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.54
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.46
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.43
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.39
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.39
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.37
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.3
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.29
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.18
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.17
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.12
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.11
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.74
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.7
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.41
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.26
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	97.96
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	97.91
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.39
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.72
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.14
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.97

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.77  E-value=5.2e-19  Score=134.74  Aligned_cols=167  Identities=24%  Similarity=0.276  Sum_probs=122.8

Q ss_pred             ccceeEeecCCCccccchh-hccccccceEeccCCCCCcccChHHhhcccccceeecCCCccchhhhhhhccccccHHhh
Q 048752            8 KKLEILCLRGSDIKQLPIE-VGQLTWLTLLDLRECRKLEVIPPNVLSNLSHLEELCISRRSFQKWEVEVEGAKNASLEEL   86 (205)
Q Consensus         8 ~~L~~L~l~~~~i~~lp~~-i~~l~~L~~L~l~~c~~l~~lp~~~~~~l~~L~~L~l~~~~~~~~~~~i~~~~~~~~~~l   86 (205)
                      +++++|+|++|+|+.+|.. +.++++|++|++++ +.++.+|.  +..+++|++|++++|++...+.           .+
T Consensus        31 ~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~-N~l~~l~~--~~~l~~L~~L~Ls~N~l~~~~~-----------~~   96 (266)
T d1p9ag_          31 KDTTILHLSENLLYTFSLATLMPYTRLTQLNLDR-AELTKLQV--DGTLPVLGTLDLSHNQLQSLPL-----------LG   96 (266)
T ss_dssp             TTCCEEECTTSCCSEEEGGGGTTCTTCCEEECTT-SCCCEEEC--CSCCTTCCEEECCSSCCSSCCC-----------CT
T ss_pred             cCCCEEECcCCcCCCcCHHHhhcccccccccccc-cccccccc--cccccccccccccccccccccc-----------cc
Confidence            4688888888888888754 78888888888888 57777775  5678888888888888876655           67


Q ss_pred             cCCCCccEEEEEeeCCeeccCCcCcccccceEEe-eccccccC-C----CCCCCcceEEecCccc--ch-hhHHHhcCCc
Q 048752           87 KHLPNLTSLELDIHDVNTLPRGLFLEKLGKYRIR-IGDWYWES-T----NIWRSEFRLRLNNKIC--LK-DWLIVQLQGI  157 (205)
Q Consensus        87 ~~l~~L~~L~l~~~~~~~~~~~~~~~~L~~L~~~-~~~~~~~~-~----~~~~~L~~L~l~~~~~--~~-~~~~~~~~~L  157 (205)
                      ..+++|+.|+++++.+..++.. .+..+..+... +.++.+.. +    ..++.++.++++.+..  .+ ..+. .+++|
T Consensus        97 ~~l~~L~~L~l~~~~~~~~~~~-~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N~l~~~~~~~~~-~l~~L  174 (266)
T d1p9ag_          97 QTLPALTVLDVSFNRLTSLPLG-ALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLN-GLENL  174 (266)
T ss_dssp             TTCTTCCEEECCSSCCCCCCSS-TTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTSCCSCCCTTTTT-TCTTC
T ss_pred             ccccccccccccccccceeecc-ccccccccccccccccccceeccccccccccchhcccccccccccCccccc-ccccc
Confidence            7888888888888888777666 55666666655 55544433 2    2566788888854422  22 2344 57888


Q ss_pred             cEEEeccCchhhHHhHHHHhhhcCCCCccEEeecCCCC
Q 048752          158 EDLELRKLQEQDVIYFANELVKVGSSQLKFLRIHGCSD  195 (205)
Q Consensus       158 ~~L~l~~~~~~~~~~~~~~l~~~~~~~L~~L~l~~~~~  195 (205)
                      ++|++++|.   ++.+|..+.  .+++|+.|++++|+.
T Consensus       175 ~~L~Ls~N~---L~~lp~~~~--~~~~L~~L~L~~Np~  207 (266)
T d1p9ag_         175 DTLLLQENS---LYTIPKGFF--GSHLLPFAFLHGNPW  207 (266)
T ss_dssp             CEEECCSSC---CCCCCTTTT--TTCCCSEEECCSCCB
T ss_pred             ceeecccCC---CcccChhHC--CCCCCCEEEecCCCC
Confidence            999998886   678887773  788899999988873

PyMOL of d1p9ag_

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure