Citrus Sinensis ID: 048758

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------
VFRISKSILNSVAKDQSNNDDDLNSLQVKLKERLSGKKFLLVLDDLWNENYNSWCTLSCPFGAGASGSKIVVTHRNQDVAATMRAVSGKTLKELSDDDCLRVLIQHSLGARYFNIPQSLKEVAEKIAKKCKGLPLAAKTLGGLLSGKDDLNDWEFVLNTNIWDLREDKCDILPTLRVSYHFLPPQLKRCFAYCSLFPKDYEFEEEEIILLWTAEGFLDQEYSGRKMEDLGREFVQELHSRSLFQLSSKDTSRFVMHDLINDLARWAAGEQYFRMEDTLAGENRQKFSQSLRHFSYIRGQYDGDTRLEFICDVQHLRTFLPMKLSDFGDNYLAWSALQMLLNHLPRLRVFSLRGYCNIFNLPNEIGNLKHLRCLNLSRTRIQILPESINSLYNLHTILLEDCWKLKKLCKDMGNLTKLRHLKNSNVHSLEEMPKGFGKLTSLLTLGRFVVGKDSGSGLRQLKSLAHLQGRLKISKLENVKDVGDASEAQLNNKVNLEALILEWSARSERCEFETQVLSMLKPHRDVQELTITGYSGTKFPIWLGDSSFSKLVQLKLEGCGKCTSLPSVGQLPFLKELLISGMDGVKIVGLEFYGNICSVPFPSLEALSFSDMTEWEEWIPCGAGTLPRRLLLLETLDITSCDQLLVTIQCLPALSELQIDGCKRVVFSSPHLVHAVNVREQAYFWRSETRLPQDIRSLNRLQISRCPQLLSLVTEEEHDQQQPELPCRLQFLELRNCEGLTRLPQALLTLSSLTEMRIYGCTSLVSFPEVALPSQLRT
cHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHccccccccEEEEEcccHHHHHHcccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHcccccccccccccHHHHccccccccccHHHcccccccccccEEcHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccEEccccccEEEcHHHHHHHHHHHHccEEEEEccccccccccccccEEEEEEEEccccccccccccccccccEEEccccccccccccccHHHHHHHHcccccccEEEccccccccccccccccccccccccccccccccccHHHHHcHHHHHccccccccccccHHccccccccccEEcccccccccccccccccccccccccEEEcccccccHHHHccccccccEEEEccccccccccccccccccccccccEEEEEEcccccccHHHHHHHHcccccccccEEEEEccccccccccccccccccEEEEEEEccccccccccccccccccEEEEccccccEEEcccccccccccccccccEEEEcccccccccccccccccccccccccEEEEEccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccEEEEEEccccccccccccccccccEEEEEccccccccccccccccccc
ccHHHHHHHHHHccccccccccHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHcHHHcccccccccHHHHHEcHHccccHHHHHHHEEEcccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEHHHHHHHHHHHHccccEEEHHHcccccccccccccccEcEEEccccccccccccHccHHHHcccccccHccccccccccHHHHHHcccccccEEEEEccccccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccccccccccccEEEEcccccHccccccccccccccEEEEEEccccccccHHHccccHccccEEEEccccccccHHHHHHccccccccccEEEEEccccccccccHHHHHHHccccccccEEEEEcccccccccHcccccccccEEEEEcccccccccccccccccccEEEEcccccccEccHHHcccccccccccccEEEEcccccHHHcccccccccccccccccEEEEcccHHHHccccccccccEEEEcccccccccccccccHHHHHHHHccccHHHccccccccccEEEEcccccccccccccccccccccccccccEEEEcccccHHcccccccccccHcEEEEcccccccccccccccccccc
VFRISKSILNSVakdqsnndddLNSLQVKLKERLSGKKFLLVLDDLWNenynswctlscpfgagasgsKIVVTHRNQDVAATMRAVSGktlkelsdddCLRVLIQHSlgaryfnipQSLKEVAEKIAKKCKGLPLAAKTlggllsgkddlndWEFVLNTNiwdlredkcdilptlrvsyhflppqlkrCFAYcslfpkdyefeEEEIILLWTAEgfldqeysgrkmEDLGREFVQELHSrslfqlsskdtsRFVMHDLINDLARWAAGEQYFRMEDTLAGENRQKFSQSLRHFSYIrgqydgdtrleFICDVqhlrtflpmklsdfgdnYLAWSALQMLLNHlprlrvfslrgycnifnlpneignlkhlrclnlsrtRIQILPESINSLYNLHTILLEDCWKLKKLCKDmgnltklrhlknsnvhsleempkgfgKLTSLLTLGrfvvgkdsgsglRQLKSLAHLQGrlkisklenvkdvgdaseaqLNNKVNLEALILEWSARSERCEFETQVLSMlkphrdvqeltitgysgtkfpiwlgdssFSKLVQLKlegcgkctslpsvgqlpfLKELLISGMDGVKIVGLEFygnicsvpfpslealsfsdmteweewipcgagtlpRRLLLLETLDITSCDQLLVTIQclpalselqidgckrvvfssphlvhAVNVREQAYfwrsetrlpqdirslnrlqisrcpqllslvteeehdqqqpelpcrlqflelrncegltrlPQALLTLSsltemriygctslvsfpevalpsqlrt
vfrisksilnsvakdqsnndddLNSLQVKLKERLSGKKFLLVLDDLWNENYNSWCTLSCPFGAGASGSKIVVTHRNQDVAATMRAVSgktlkelsdddCLRVLIQHSLGARYFNIPQSLKEVAEKIAKKCKGLPLAAKTLGGllsgkddlnDWEFVLNTNIWDLREDKCDILPTLRVSYHFLPPQLKRCFAYCSLFPKDYEFEEEEIILLWTAEGFLDQEYSGRKMEDLGREFVQELHSRSlfqlsskdtsRFVMHDLINDLARWAAGEQYFRMEDTLAGENRQKFSQSLRHFSYIRGQYDGDTRLEFICDVQHLRTFLPMKLSDFGDNYLAWSALQMLLNHLPRLRVFSLRGYCNIFNLPNEIGNLKHLRCLNLSRTRIQILPESINSLYNLHTILLEDCWKLKKLCKDMGNLTKLRHLKNSNVHSLEEMPKGFGKLTSLLTLGRFVVGKDSGSGLRQLKSLAHLqgrlkisklenvkdvgdaseaqlnnkVNLEALILEWSARSERCEFETQVlsmlkphrdVQELTITGYSGTKFPIWLGDSSFSKLVQLKLEGCGKCTSLPSVGQLPFLKELLISGMDGVKIVGLEFYGNICSVPFPSLEALSFSDMTEWEEWIPCGAGTLPRRLLLLETLDITSCDQLLVTIQCLPALSELQIDGCKRVVFSSPHLVHAVNVREQAYFWRSETRLPQDIRSLNRLQISRCPQLLSLVTEEEHDQQQPELPCRLQFLELRNCEGLTRLPQALLTLSSLTEMRIYGCTslvsfpevalpsqlrt
VFRISKSILNSVAKdqsnndddlnslqVKLKERLSGKKFLLVLDDLWNENYNSWCTLSCPFGAGASGSKIVVTHRNQDVAATMRAVSGKTLKELSDDDCLRVLIQHSLGARYFNIPQSLKEVAEKIAKKCKGLPLAAKTLGGLLSGKDDLNDWEFVLNTNIWDLREDKCDILPTLRVSYHFLPPQLKRCFAYCSLFPKDYEFEEEEIILLWTAEGFLDQEYSGRKMEDLGREFVQELHSRSLFQLSSKDTSRFVMHDLINDLARWAAGEQYFRMEDTLAGENRQKFSQSLRHFSYIRGQYDGDTRLEFICDVQHLRTFLPMKLSDFGDNYLAWSALQMLLNHLPRLRVFSLRGYCNIFNLPNEIGNLKHLRCLNLSRTRIQILPESINSLYNLHTILLEDCWKLKKLCKDMGNLTKLRHLKNSNVHSLEEMPKGFGKLTSLLTLGRFVVGKDSGSGLRQLKSLAHLQGRLKISKLENVKDVGDASEAQLNNKVNLEALILEWSARSERCEFETQVLSMLKPHRDVQELTITGYSGTKFPIWLGDSSFSKLVQLKLEGCGKCTSLPSVGQLPFLKELLISGMDGVKIVGLEFYGNICSVPFPSLEALSFSDMTEWEEWIPCGAGtlprrlllletlDITSCDQLLVTIQCLPALSELQIDGCKRVVFSSPHLVHAVNVREQAYFWRSETRLPQDIRSLNRLQISRCPQLLSLVTEEEHDQQQPELPCRLQFLELRNCEGLTRLPQALLTLSSLTEMRIYGCTSLVSFPEVALPSQLRT
*******************************ERLSGKKFLLVLDDLWNENYNSWCTLSCPFGAGASGSKIVVTHRNQDVAATMRAVSGKTLKELSDDDCLRVLIQHSLGARYFNIPQSLKEVAEKIAKKCKGLPLAAKTLGGLLSGKDDLNDWEFVLNTNIWDLREDKCDILPTLRVSYHFLPPQLKRCFAYCSLFPKDYEFEEEEIILLWTAEGFLDQEYSGRKMEDLGREFVQELHSRSLFQLSSKDTSRFVMHDLINDLARWAAGEQYFRMEDTLAGENRQKFSQSLRHFSYIRGQYDGDTRLEFICDVQHLRTFLPMKLSDFGDNYLAWSALQMLLNHLPRLRVFSLRGYCNIFNLPNEIGNLKHLRCLNLSRTRIQILPESINSLYNLHTILLEDCWKLKKLCKDMGNLTKLRHLKNSNVHSLEEMPKGFGKLTSLLTLGRFVVGKDSGSGLRQLKSLAHLQGRLKISKLENVKDV*****AQLNNKVNLEALILEWSARSERCEFETQVLSMLKPHRDVQELTITGYSGTKFPIWLGDSSFSKLVQLKLEGCGKCTSLPSVGQLPFLKELLISGMDGVKIVGLEFYGNICSVPFPSLEALSFSDMTEWEEWIPCGAGTLPRRLLLLETLDITSCDQLLVTIQCLPALSELQIDGCKRVVFSSPHLVHAVNVREQAYFWRSETRLPQDIRSLNRLQISRCPQLLSLVT**********LPCRLQFLELRNCEGLTRLPQALLTLSSLTEMRIYGCTSLVSFPEV********
VFRISKSILNSVAKD*S**DDDLNSLQVKLKERLSGKKFLLVLDDLWNENYNSWCTLSCPFGAGASGSKIVVTHRNQDVAATMRAVSGKTLKELSDDDCLRVLIQHSLG********SLKEVAEKIAKKCKGLPLAAKTLGGLLSGKDDLNDWEFVLNTNIWDLREDKCDILPTLRVSYHFLPPQLKRCFAYCSLFPKDYEFEEEEIILLWTAEGFLDQEYSGRKMEDLGREFVQELHSRSLFQLSSKDTSRFVMHDLINDLARWAAGEQYFRMEDTLA****QKFSQSLRHFSYIRGQYDGDTRLEFICDVQHLRTFLPMKLSDFGDNYLAWSALQMLLNHLPRLRVFSLRGYCNIFNLPNEIGNLKHLRCLNLSRTRIQILPESINSLYNLHTILLEDCWKLKKLCKDMGNLTKLRHLKNSNVHSLEEMPKGFGKLTSLLTLGRFVVGKDSGSGLRQLKSLAHLQGRLKISKLENVKDVGDASEAQLNNKVNLEALILEWSARSE**EFETQVLSMLKPHRDVQELTITGYSGTKFPIWLGDSSFSKLVQLKLEGCGKCTSLPSVGQLPFLKELLISGMDGVKIVGLEFYGNICSVPFPSLEALSFSDMTEWEEWIPCGAGTLPRRLLLLETLDITSCDQLLVTIQCLPALSELQIDGCKRVVFSSPHLVHAVNVREQAYFWRSETRLPQDIRSLNRLQISRCPQLLSLVTEEEHDQQQPELPCRLQFLELRNCEGLTRLPQALLTLSSLTEMRIYGCTSLVSFPEVALPSQL**
VFRISKSILNSVAKDQSNNDDDLNSLQVKLKERLSGKKFLLVLDDLWNENYNSWCTLSCPFGAGASGSKIVVTHRNQDVAATMRAVSGKTLKELSDDDCLRVLIQHSLGARYFNIPQSLKEVAEKIAKKCKGLPLAAKTLGGLLSGKDDLNDWEFVLNTNIWDLREDKCDILPTLRVSYHFLPPQLKRCFAYCSLFPKDYEFEEEEIILLWTAEGFLDQEYSGRKMEDLGREFVQELHSRSLFQLSSKDTSRFVMHDLINDLARWAAGEQYFRMEDTLAGENRQKFSQSLRHFSYIRGQYDGDTRLEFICDVQHLRTFLPMKLSDFGDNYLAWSALQMLLNHLPRLRVFSLRGYCNIFNLPNEIGNLKHLRCLNLSRTRIQILPESINSLYNLHTILLEDCWKLKKLCKDMGNLTKLRHLKNSNVHSLEEMPKGFGKLTSLLTLGRFVVGKDSGSGLRQLKSLAHLQGRLKISKLENVKDVGDASEAQLNNKVNLEALILEWSARSERCEFETQVLSMLKPHRDVQELTITGYSGTKFPIWLGDSSFSKLVQLKLEGCGKCTSLPSVGQLPFLKELLISGMDGVKIVGLEFYGNICSVPFPSLEALSFSDMTEWEEWIPCGAGTLPRRLLLLETLDITSCDQLLVTIQCLPALSELQIDGCKRVVFSSPHLVHAVNVREQAYFWRSETRLPQDIRSLNRLQISRCPQLLSLV**********ELPCRLQFLELRNCEGLTRLPQALLTLSSLTEMRIYGCTSLVSFPEVALPSQLRT
VFRISKSILNSVAKDQSNNDDDLNSLQVKLKERLSGKKFLLVLDDLWNENYNSWCTLSCPFGAGASGSKIVVTHRNQDVAATMRAVSGKTLKELSDDDCLRVLIQHSLGARYFNIPQSLKEVAEKIAKKCKGLPLAAKTLGGLLSGKDDLNDWEFVLNTNIWDLREDKCDILPTLRVSYHFLPPQLKRCFAYCSLFPKDYEFEEEEIILLWTAEGFLDQEYSGRKMEDLGREFVQELHSRSLFQLSSKDTSRFVMHDLINDLARWAAGEQYFRMEDTLAGENRQKFSQSLRHFSYIRGQYDGDTRLEFICDVQHLRTFLPMKLSDFGDNYLAWSALQMLLNHLPRLRVFSLRGYCNIFNLPNEIGNLKHLRCLNLSRTRIQILPESINSLYNLHTILLEDCWKLKKLCKDMGNLTKLRHLKNSNVHSLEEMPKGFGKLTSLLTLGRFVVGKDSGSGLRQLKSLAHLQGRLKISKLENVKDVGDASEAQLNNKVNLEALILEWSARSERCEFETQVLSMLKPHRDVQELTITGYSGTKFPIWLGDSSFSKLVQLKLEGCGKCTSLPSVGQLPFLKELLISGMDGVKIVGLEFYGNICSVPFPSLEALSFSDMTEWEEWIPCGAGTLPRRLLLLETLDITSCDQLLVTIQCLPALSELQIDGCKRVVFSSPHLVHAVNVREQAYFWRSETRLPQDIRSLNRLQISRCPQLLSLVTEEEHDQQQPELPCRLQFLELRNCEGLTRLPQALLTLSSLTEMRIYGCTSLVSFPEVA*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VFRISKSILNSVAKDQSNNDDDLNSLQVKLKERLSGKKFLLVLDDLWNENYNSWCTLSCPFGAGASGSKIVVTHRNQDVAATMRAVSGKTLKELSDDDCLRVLIQHSLGARYFNIPQSLKEVAEKIAKKCKGLPLAAKTLGGLLSGKDDLNDWEFVLNTNIWDLREDKCDILPTLRVSYHFLPPQLKRCFAYCSLFPKDYEFEEEEIILLWTAEGFLDQEYSGRKMEDLGREFVQELHSRSLFQLSSKDTSRFVMHDLINDLARWAAGEQYFRMEDTLAGENRQKFSQSLRHFSYIRGQYDGDTRLEFICDVQHLRTFLPMKLSDFGDNYLAWSALQMLLNHLPRLRVFSLRGYCNIFNLPNEIGNLKHLRCLNLSRTRIQILPESINSLYNLHTILLEDCWKLKKLCKDMGNLTKLRHLKNSNVHSLEEMPKGFGKLTSLLTLGRFVVGKDSGSGLRQLKSLAHLQGRLKISKLENVKDVGDASEAQLNNKVNLEALILEWSARSERCEFETQVLSMLKPHRDVQELTITGYSGTKFPIWLGDSSFSKLVQLKLEGCGKCTSLPSVGQLPFLKELLISGMDGVKIVGLEFYGNICSVPFPSLEALSFSDMTEWEEWIPCGAGTLPRRLLLLETLDITSCDQLLVTIQCLPALSELQIDGCKRVVFSSPHLVHAVNVREQAYFWRSETRLPQDIRSLNRLQISRCPQLLSLVTEEEHDQQQPELPCRLQFLELRNCEGLTRLPQALLTLSSLTEMRIYGCTSLVSFPEVALPSQLRT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query777 2.2.26 [Sep-21-2011]
Q9LRR41054 Putative disease resistan yes no 0.936 0.690 0.413 1e-145
Q9LRR5 1424 Putative disease resistan no no 0.870 0.474 0.387 1e-124
Q7XBQ9970 Disease resistance protei N/A no 0.902 0.722 0.344 3e-94
Q7XA42979 Putative disease resistan N/A no 0.888 0.704 0.337 4e-94
Q7XA39988 Putative disease resistan N/A no 0.915 0.719 0.339 2e-90
Q7XA40992 Putative disease resistan N/A no 0.924 0.723 0.332 2e-90
Q38834852 Disease resistance RPP13- no no 0.649 0.592 0.284 2e-38
O81825919 Probable disease resistan no no 0.487 0.412 0.295 3e-34
Q8W3K3910 Putative disease resistan no no 0.737 0.629 0.270 1e-33
Q8RXS5888 Probable disease resistan no no 0.483 0.423 0.287 3e-32
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function desciption
 Score =  516 bits (1329), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 318/769 (41%), Positives = 450/769 (58%), Gaps = 41/769 (5%)

Query: 1   VFRISKSILNSVAKDQSNNDDDLNSLQVKLKERLSGK--KFLLVLDDLWNENYNSWCTLS 58
           VF+I+K +  SV   +     DL+ LQVKLKERL+G    FLLVLDDLWNEN+  W  L 
Sbjct: 240 VFKITKKVYESVT-SRPCEFTDLDVLQVKLKERLTGTGLPFLLVLDDLWNENFADWDLLR 298

Query: 59  CPFGAGASGSKIVVTHRNQDVAATMRAVSGKTLKELSDDDCLRVLIQHSLGARYFNIPQS 118
            PF   A GS+I+VT R+Q VA+ M AV    L+ LSD DC  + ++   G +   + + 
Sbjct: 299 QPFIHAAQGSQILVTTRSQRVASIMCAVHVHNLQPLSDGDCWSLFMKTVFGNQEPCLNRE 358

Query: 119 LKEVAEKIAKKCKGLPLAAKTLGGLLSGKDDLNDWEFVLNTNIWDLREDKCDILPTLRVS 178
           + ++AE+I  KC+GLPLA KTLGG+L  +  + +WE VL++ IWDL  DK ++LP LRVS
Sbjct: 359 IGDLAERIVHKCRGLPLAVKTLGGVLRFEGKVIEWERVLSSRIWDLPADKSNLLPVLRVS 418

Query: 179 YHFLPPQLKRCFAYCSLFPKDYEFEEEEIILLWTAEGFLDQEYSGRKMEDLGREFVQELH 238
           Y++LP  LKRCFAYCS+FPK + FE+++++LLW AEGFL Q  S + +E+LG E+  EL 
Sbjct: 419 YYYLPAHLKRCFAYCSIFPKGHAFEKDKVVLLWMAEGFLQQTRSSKNLEELGNEYFSELE 478

Query: 239 SRSLFQLSSKDTSRFVMHDLINDLARWAAGEQYFRMEDTLAGENRQKFSQSLRHFSYIRG 298
           SRSL Q   K  +R++MHD IN+LA++A+GE   + ED      + + S+  R+ SY+R 
Sbjct: 479 SRSLLQ---KTKTRYIMHDFINELAQFASGEFSSKFEDGC----KLQVSERTRYLSYLRD 531

Query: 299 QYDGDTRLEFICDVQHLRTFLPMKLSDFGDN-YLAWSALQMLLNHLPRLRVFSLRGYCNI 357
            Y      E + +V+ LRTFLP+ L++   +  L     + LL  L RLRV SL  Y   
Sbjct: 532 NYAEPMEFEALREVKFLRTFLPLSLTNSSRSCCLDQMVSEKLLPTLTRLRVLSLSHYKIA 591

Query: 358 FNLPNEIGNLKHLRCLNLSRTRIQILPESINSLYNLHTILLEDCWKLKKLCKDMGNLTKL 417
              P+   N+ H R L+LSRT ++ LP+S+  +YNL T+LL  C  LK+L  D+ NL  L
Sbjct: 592 RLPPDFFKNISHARFLDLSRTELEKLPKSLCYMYNLQTLLLSYCSSLKELPTDISNLINL 651

Query: 418 RHLKNSNVHSLEEMPKGFGKLTSLLTLGRFVVGKDSGSGLRQLKSLAHLQGRLKISKLEN 477
           R+L       L +MP+ FG+L SL TL  F V    GS + +L  L  L G+LKI +L+ 
Sbjct: 652 RYLDLIGT-KLRQMPRRFGRLKSLQTLTTFFVSASDGSRISELGGLHDLHGKLKIVELQR 710

Query: 478 VKDVGDASEAQLNNKVNLEALILEW---SARSE------RCEFETQVLSMLKPHRDVQEL 528
           V DV DA+EA LN+K +L  +   W   S+ SE      R + E +V   L+PHR +++L
Sbjct: 711 VVDVADAAEANLNSKKHLREIDFVWRTGSSSSENNTNPHRTQNEAEVFEKLRPHRHIEKL 770

Query: 529 TITGYSGTKFPIWLGDSSFSKLVQLKLEGCGKCTSLPSVGQLPFLKELLISGMDGVKIVG 588
            I  Y G +FP WL D SFS++V ++L  C  CTSLPS+GQLP LKEL ISGM G++ +G
Sbjct: 771 AIERYKGRRFPDWLSDPSFSRIVCIRLRECQYCTSLPSLGQLPCLKELHISGMVGLQSIG 830

Query: 589 LEFYGN------ICSVPFPSLEALSFSDMTEWEEWIPCGAGTLPRRLLLLETLDITSCDQ 642
            +FY +          PF SLE L F ++ +W+EW+     T       L+ L I  C +
Sbjct: 831 RKFYFSDQQLRDQDQQPFRSLETLRFDNLPDWQEWLDVRV-TRGDLFPSLKKLFILRCPE 889

Query: 643 LLVTIQC-LPALSELQIDGCKRVVFSSPHLVHAVNVRE-QAYFWRSE----TRLP-QDIR 695
           L  T+   LP+L  L I  C  + F   H  H  + R  Q    +S      + P     
Sbjct: 890 LTGTLPTFLPSLISLHIYKCGLLDFQPDH--HEYSYRNLQTLSIKSSCDTLVKFPLNHFA 947

Query: 696 SLNRLQISRCPQLLSLVTEEEHDQQQPELPCRLQFLELRNCEGLTRLPQ 744
           +L++L++ +C  L SL    EH +     P  L+ L + +C+ L  LP+
Sbjct: 948 NLDKLEVDQCTSLYSLELSNEHLRG----PNALRNLRINDCQNLQLLPK 992
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q8W3K3|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query777
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.957 0.522 0.454 1e-178
147819724 1481 hypothetical protein VITISV_007111 [Viti 0.983 0.515 0.435 1e-175
225450019 1394 PREDICTED: putative disease resistance p 0.983 0.548 0.435 1e-175
225449649 1418 PREDICTED: putative disease resistance p 0.981 0.538 0.431 1e-175
225450023 1396 PREDICTED: putative disease resistance p 0.989 0.550 0.432 1e-172
359495024 1390 PREDICTED: putative disease resistance p 0.980 0.548 0.419 1e-171
147833325 1048 hypothetical protein VITISV_015656 [Viti 0.969 0.718 0.451 1e-171
400131587 1388 FB_MR5 [Malus x robusta] 0.987 0.552 0.445 1e-171
147860511 1406 hypothetical protein VITISV_014536 [Viti 0.980 0.541 0.419 1e-171
359487416 1472 PREDICTED: putative disease resistance p 0.989 0.522 0.425 1e-171
>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
 Score =  630 bits (1625), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 366/806 (45%), Positives = 475/806 (58%), Gaps = 62/806 (7%)

Query: 1    VFRISKSILNSVAKDQSNNDDDLNSLQVKLKERLSGKKFLLVLDDLWNENYNSWCTLSCP 60
            V  ++K++L SV   Q  +  +LN +QVKL   L GKKFLLVLDDLWNENY  W  L  P
Sbjct: 239  VMMVTKALLESVT-SQPCHLKELNEVQVKLASELEGKKFLLVLDDLWNENYGLWEALLPP 297

Query: 61   FGAGASGSKIVVTHRNQDVAATMRAVSGKTLKELSDDDCLRVLIQHSLGARYFNIPQSLK 120
            F AGA+GS+I+VT RN  V   M AV    L  +S++DC  + +QHSL    F  P +  
Sbjct: 298  FRAGAAGSRIIVTTRNASVGKVMGAVQSYNLDFISNNDCWAIFVQHSLMNENFGRPGNSG 357

Query: 121  EVAEKIAKKCKGLPLAAKTLGGLLSGKDDLNDWEFVLNTNIWDLREDKCDILPTLRVSYH 180
             + E+I ++C+GLPLAA+TLGGL  GK+ L++WE ++N+ +W       DI P LR+SYH
Sbjct: 358  LIRERILERCRGLPLAARTLGGLFRGKE-LDEWEDIMNSKLWSSSNMGSDIFPILRLSYH 416

Query: 181  FLPPQLKRCFAYCSLFPKDYEFEEEEIILLWTAEGFLDQEYSGRKMEDLGREFVQELHSR 240
             LP  LKRCFAYCSLFP+DYEFEE+++ILLW AEG + Q    + MEDLG E+ ++L SR
Sbjct: 417  HLPHHLKRCFAYCSLFPRDYEFEEKQLILLWMAEGLIYQAEGDKPMEDLGGEYFRDLLSR 476

Query: 241  SLFQLSSKDTSRFVMHDLINDLARWAAGEQYFRMEDTLAGENRQKFSQSLRHFSYIRGQY 300
            S FQ SS + SRFVMHDLI DLA+W AG  YFR+E  L G  + K S   RH S++  +Y
Sbjct: 477  SFFQQSSSNKSRFVMHDLITDLAQWVAGISYFRLETKLKGNEQSKVSSKARHLSFVGSRY 536

Query: 301  DGDTRLEFICDVQHLRTFLPMKLSDFGDNYLAWSALQMLLNHLPRLRVFSLRGYCNIFNL 360
            DG  + E I + +HLRTFLP+     G +YL++  +  LL  L  LRV SL GY  I  L
Sbjct: 537  DGAKKFEAISEFKHLRTFLPLMAPYVGYSYLSYHIINQLLPKLQNLRVLSLSGY-RIVYL 595

Query: 361  PNEIGNLKHLRCLNLSRTRIQILPESINSLYNLHTILLEDCWKLKKLCKDMGNLTKLRHL 420
            P  IG+LKHLR L+LS T+++ LP SI++LYNL T+LLE+C  LK L  D G L  LRHL
Sbjct: 596  PQTIGDLKHLRYLDLSCTQLRSLPTSISTLYNLQTLLLENCTSLKFLPPDFGKLFNLRHL 655

Query: 421  KNSNVHSLEEMPKGFGKLTSLLTLGRFVVGK-DSGSGLRQLKSLAHLQGRLKISKLENVK 479
                 + LE MP   G L+SL TL  FVVGK DS   +R+L  L HL+G L ISKLENV 
Sbjct: 656  NIFGSNLLEGMPLSIGNLSSLQTLSNFVVGKADSFCVIRELGPLVHLRGTLCISKLENVT 715

Query: 480  DVGDASEAQLNNKVNLEALILEWSA---RSERCEFETQVLSMLKPHRDVQELTITGYSGT 536
               +A ++ L  K +L  +++EWS+    S+  E + +VL+ML+P+  ++ELT+  Y GT
Sbjct: 716  KAQEARDSYLYGKQDLNEVVMEWSSNLNESQDEETQLEVLNMLQPNVKLKELTVKCYGGT 775

Query: 537  KFPIWLGDSSFSKLVQLKLEGCGKCTSLPSVGQLPFLKELLISGMDGVKIVGLEFYGNIC 596
            KFP W+GD SFS LV L+ E C  C SLP VGQLPFLK+LLI GM GVK VG EFYG  C
Sbjct: 776  KFPTWIGDPSFSNLVLLRFENCDNCNSLPPVGQLPFLKDLLIKGMAGVKSVGREFYGESC 835

Query: 597  SVPFPSLEALSFSDMTEWEEWIPCGAG-------------------TLPRRLLLLETLDI 637
            S PF SLE L F DM  W  WIP G                      LP  L  L+ L I
Sbjct: 836  SRPFQSLETLHFEDMPRWVNWIPLGVNEAFACLHKLSIIRCHNLVRKLPDHLPSLKKLVI 895

Query: 638  TSCDQLLVTIQCLPALSELQIDGCKRVV------FSSPHLVHAVNVREQAYFWRSETRLP 691
              C  ++V++  LP L  L I+GCKRV       F SP+ +    + E   F  +   L 
Sbjct: 896  HGCWNMVVSVSNLPMLCVLVIEGCKRVECESSVGFGSPYSMAFSKISE---FGNATAGLM 952

Query: 692  QDIRSLNRLQISRCPQLLSLVTEEEHDQQQPELPCRLQFLELRNCEGLTRLPQALLTLSS 751
              +  +  L+I    +L +L                             ++P+ L  L  
Sbjct: 953  HGVSKVEYLKIVDSEKLTTL---------------------------WEKIPEGLHRLKF 985

Query: 752  LTEMRIYGCTSLVSFPEVALPSQLRT 777
            L E+ I  C +LVSFP    PS L+ 
Sbjct: 986  LRELSIEDCPTLVSFPASGFPSMLKV 1011

Source: Quercus suber

Species: Quercus suber

Genus: Quercus

Family: Fagaceae

Order: Fagales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147819724|emb|CAN69227.1| hypothetical protein VITISV_007111 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225450019|ref|XP_002272632.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] gi|451798996|gb|AGF69196.1| disease resistance protein At3g14460-like protein 3 [Vitis labrusca] Back     alignment and taxonomy information
>gi|225449649|ref|XP_002262753.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225450023|ref|XP_002272823.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] gi|451798994|gb|AGF69195.1| disease resistance protein At3g14460-like protein 2 [Vitis labrusca] Back     alignment and taxonomy information
>gi|359495024|ref|XP_002267933.2| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147833325|emb|CAN61989.1| hypothetical protein VITISV_015656 [Vitis vinifera] Back     alignment and taxonomy information
>gi|400131587|emb|CCH50986.1| FB_MR5 [Malus x robusta] Back     alignment and taxonomy information
>gi|147860511|emb|CAN79726.1| hypothetical protein VITISV_014536 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487416|ref|XP_002272889.2| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query777
TAIR|locus:20916721054 AT3G14470 [Arabidopsis thalian 0.961 0.708 0.401 3.3e-134
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.871 0.475 0.378 1.1e-120
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.633 0.273 0.296 3.3e-57
TAIR|locus:2078012852 ZAR1 "HOPZ-ACTIVATED RESISTANC 0.624 0.569 0.289 5.8e-38
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.555 0.486 0.284 2.5e-34
TAIR|locus:2037639907 AT1G58390 "AT1G58390" [Arabido 0.705 0.604 0.273 2.3e-32
TAIR|locus:504956186 1138 AT1G58602 [Arabidopsis thalian 0.701 0.478 0.271 2.7e-32
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.489 0.425 0.292 3.6e-32
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.507 0.428 0.304 1.3e-31
TAIR|locus:2037623899 AT1G58410 [Arabidopsis thalian 0.440 0.380 0.296 2.3e-31
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1315 (468.0 bits), Expect = 3.3e-134, P = 3.3e-134
 Identities = 316/787 (40%), Positives = 453/787 (57%)

Query:     1 VFRISKSILNSVAKXXXXXXXXXXXXXVKLKERLSGK--KFLLVLDDLWNENYNSWCTLS 58
             VF+I+K +  SV               VKLKERL+G    FLLVLDDLWNEN+  W  L 
Sbjct:   240 VFKITKKVYESVTSRPCEFTDLDVLQ-VKLKERLTGTGLPFLLVLDDLWNENFADWDLLR 298

Query:    59 CPFGAGASGSKIVVTHRNQDVAATMRAVSGKTLKELSDDDCLRVLIQHSLGARYFNIPQS 118
              PF   A GS+I+VT R+Q VA+ M AV    L+ LSD DC  + ++   G +   + + 
Sbjct:   299 QPFIHAAQGSQILVTTRSQRVASIMCAVHVHNLQPLSDGDCWSLFMKTVFGNQEPCLNRE 358

Query:   119 LKEVAEKIAKKCKGLPLAAKTLGGLLSGKDDLNDWEFVLNTNIWDLREDKCDILPTLRVS 178
             + ++AE+I  KC+GLPLA KTLGG+L  +  + +WE VL++ IWDL  DK ++LP LRVS
Sbjct:   359 IGDLAERIVHKCRGLPLAVKTLGGVLRFEGKVIEWERVLSSRIWDLPADKSNLLPVLRVS 418

Query:   179 YHFLPPQLKRCFAYCSLFPKDYEFEEEEIILLWTAEGFLDQEYSGRKMEDLGREFVQELH 238
             Y++LP  LKRCFAYCS+FPK + FE+++++LLW AEGFL Q  S + +E+LG E+  EL 
Sbjct:   419 YYYLPAHLKRCFAYCSIFPKGHAFEKDKVVLLWMAEGFLQQTRSSKNLEELGNEYFSELE 478

Query:   239 SRSLFQLSSKDTSRFVMHDLINDLARWAAGEQYFRMEDTLAGENRQKFSQSLRHFSYIRG 298
             SRSL Q   K  +R++MHD IN+LA++A+GE   + ED      + + S+  R+ SY+R 
Sbjct:   479 SRSLLQ---KTKTRYIMHDFINELAQFASGEFSSKFEDGC----KLQVSERTRYLSYLRD 531

Query:   299 QYDGDTRLEFICDVQHLRTFLPMKLSDFGDNY-LAWSALQMLLNHLPRLRVFSLRGYCNI 357
              Y      E + +V+ LRTFLP+ L++   +  L     + LL  L RLRV SL  Y  I
Sbjct:   532 NYAEPMEFEALREVKFLRTFLPLSLTNSSRSCCLDQMVSEKLLPTLTRLRVLSLSHY-KI 590

Query:   358 FNLPNEI-GNLKHLRCLNLSRTRIQILPESINSLYNLHTILLEDCWKLKKLCKDMGNLTK 416
               LP +   N+ H R L+LSRT ++ LP+S+  +YNL T+LL  C  LK+L  D+ NL  
Sbjct:   591 ARLPPDFFKNISHARFLDLSRTELEKLPKSLCYMYNLQTLLLSYCSSLKELPTDISNLIN 650

Query:   417 LRHLKNSNVHSLEEMPKGFGKLTSLLTLGRFVVGKDSGSGLRQLKSLAHLQGRLKISKLE 476
             LR+L       L +MP+ FG+L SL TL  F V    GS + +L  L  L G+LKI +L+
Sbjct:   651 LRYLDLIGT-KLRQMPRRFGRLKSLQTLTTFFVSASDGSRISELGGLHDLHGKLKIVELQ 709

Query:   477 NVKDVGDASEAQLNNKVNLEALILEW---SARSE------RCEFETQVLSMLKPHRDVQE 527
              V DV DA+EA LN+K +L  +   W   S+ SE      R + E +V   L+PHR +++
Sbjct:   710 RVVDVADAAEANLNSKKHLREIDFVWRTGSSSSENNTNPHRTQNEAEVFEKLRPHRHIEK 769

Query:   528 LTITGYSGTKFPIWLGDSSFSKLVQLKLEGCGKCTSLPSVGQLPFLKELLISGMDGVKIV 587
             L I  Y G +FP WL D SFS++V ++L  C  CTSLPS+GQLP LKEL ISGM G++ +
Sbjct:   770 LAIERYKGRRFPDWLSDPSFSRIVCIRLRECQYCTSLPSLGQLPCLKELHISGMVGLQSI 829

Query:   588 GLEFYGNICSV------PFPSLEALSFSDMTEWEEWIPCGAGXXXXXXXXXXXXDITSCD 641
             G +FY +   +      PF SLE L F ++ +W+EW+                  I  C 
Sbjct:   830 GRKFYFSDQQLRDQDQQPFRSLETLRFDNLPDWQEWLDVRVTRGDLFPSLKKLF-ILRCP 888

Query:   642 QLLVTIQC-LPALSELQIDGCKRVVFSSPHLVHAV-NVREQAYFWRSET--RLPQD-IRS 696
             +L  T+   LP+L  L I  C  + F   H  ++  N++  +     +T  + P +   +
Sbjct:   889 ELTGTLPTFLPSLISLHIYKCGLLDFQPDHHEYSYRNLQTLSIKSSCDTLVKFPLNHFAN 948

Query:   697 LNRLQISRCPQLLSLVTEEEHDQQQPELPCRLQFLELRNCEGLTRLPQALLTLSSLTEMR 756
             L++L++ +C  L SL    EH +     P  L+ L + +C+ L  LP+ L  L    ++ 
Sbjct:   949 LDKLEVDQCTSLYSLELSNEHLRG----PNALRNLRINDCQNLQLLPK-LNALPQNLQVT 1003

Query:   757 IYGCTSL 763
             I  C  L
Sbjct:  1004 ITNCRYL 1010
GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037623 AT1G58410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query777
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 3e-51
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-06
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.003
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  180 bits (459), Expect = 3e-51
 Identities = 88/223 (39%), Positives = 128/223 (57%), Gaps = 7/223 (3%)

Query: 2   FRISKSILNSVAKDQSN-NDDDLNSLQVKLKERLSGKKFLLVLDDLWNENYNSWCTLSCP 60
           FR+ K IL  +  D S+  + + + L VK+KE L  K+FLLVLDD+W +N   W  +  P
Sbjct: 64  FRLQKDILQELGLDDSDWVEKNESELAVKIKEALLRKRFLLVLDDVWEKN--DWDKIGVP 121

Query: 61  FGAGASGSKIVVTHRNQDVAATMRAVSGK-TLKELSDDDCLRVLIQHSLGARYFNIPQSL 119
           F  G +GS+++VT R++ VA  M   S    ++ L  ++    L  + +  +       L
Sbjct: 122 FPDGENGSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESW-ELFSNKVFEKELPPCPEL 180

Query: 120 KEVAEKIAKKCKGLPLAAKTLGGLLSGKDDLNDWEFVLNTNIWDLREDKCD--ILPTLRV 177
           +EVA++I +KCKGLPLA K LGGLL+ K  + +WE VL     +L        +L  L +
Sbjct: 181 EEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRDGLNEVLSILSL 240

Query: 178 SYHFLPPQLKRCFAYCSLFPKDYEFEEEEIILLWTAEGFLDQE 220
           SY  LP  LKRCF Y +LFP+DY   +E++I LW AEGF+   
Sbjct: 241 SYDNLPMHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVIPS 283

Length = 285
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 777
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.85
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.82
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.8
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.73
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.71
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.59
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.48
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.45
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.44
KOG4237498 consensus Extracellular matrix protein slit, conta 99.37
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.29
KOG0617264 consensus Ras suppressor protein (contains leucine 99.28
KOG4237498 consensus Extracellular matrix protein slit, conta 99.21
KOG0617264 consensus Ras suppressor protein (contains leucine 99.18
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.03
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.96
KOG4341483 consensus F-box protein containing LRR [General fu 98.71
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.66
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.61
KOG4341483 consensus F-box protein containing LRR [General fu 98.61
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.6
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.54
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.5
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.47
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.39
PRK15386 426 type III secretion protein GogB; Provisional 98.39
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.3
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.3
PRK15386 426 type III secretion protein GogB; Provisional 98.27
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.24
PLN03150623 hypothetical protein; Provisional 98.19
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.18
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.14
PLN03150623 hypothetical protein; Provisional 98.05
PRK04841903 transcriptional regulator MalT; Provisional 98.04
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.0
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.99
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.95
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.94
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.84
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.78
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.75
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.69
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.49
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.49
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.24
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.17
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.05
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.04
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.99
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.92
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.86
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.83
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.66
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.61
COG3903414 Predicted ATPase [General function prediction only 96.39
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 96.38
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.26
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.22
TIGR02928365 orc1/cdc6 family replication initiation protein. M 96.02
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.01
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.01
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.01
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.36
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.09
PF05729166 NACHT: NACHT domain 94.99
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.8
PRK06893229 DNA replication initiation factor; Validated 94.79
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.71
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 94.51
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.39
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 94.2
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.87
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.85
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 93.77
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.41
PRK07471365 DNA polymerase III subunit delta'; Validated 91.18
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.03
COG3899849 Predicted ATPase [General function prediction only 89.49
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.21
smart0037026 LRR Leucine-rich repeats, outliers. 89.21
PF13173128 AAA_14: AAA domain 89.21
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 88.68
PRK05564313 DNA polymerase III subunit delta'; Validated 88.38
PTZ001121164 origin recognition complex 1 protein; Provisional 88.18
PRK09087226 hypothetical protein; Validated 87.47
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 87.36
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 83.82
PRK09112351 DNA polymerase III subunit delta'; Validated 83.63
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 83.47
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 82.98
smart0037026 LRR Leucine-rich repeats, outliers. 82.98
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 82.19
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 81.84
KOG0473326 consensus Leucine-rich repeat protein [Function un 81.52
PRK08727233 hypothetical protein; Validated 81.46
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 80.65
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-64  Score=568.41  Aligned_cols=607  Identities=30%  Similarity=0.470  Sum_probs=447.5

Q ss_pred             hhHHHHHHHhhcCCCCC-CCCCHHHHHHHHHHHhCCCeEEEEEeCCCccchhchhhhccccCCCCCCcEEEEEeecHHHH
Q 048758            2 FRISKSILNSVAKDQSN-NDDDLNSLQVKLKERLSGKKFLLVLDDLWNENYNSWCTLSCPFGAGASGSKIVVTHRNQDVA   80 (777)
Q Consensus         2 ~~l~~~il~~l~~~~~~-~~~~~~~~~~~l~~~L~~~~~LlvLDdv~~~~~~~~~~~~~~~~~~~~gs~iiiTTR~~~v~   80 (777)
                      .++|++|+..++..+.. .....++.+..|.+.|++|||+|||||||+.  .+|+.++.++|....||||++|||++.|+
T Consensus       225 ~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~--~dw~~I~~~~p~~~~g~KvvlTTRs~~V~  302 (889)
T KOG4658|consen  225 RKIQQTILERLGLLDEEWEDKEEDELASKLLNLLEGKRFLLVLDDIWEE--VDWDKIGVPFPSRENGSKVVLTTRSEEVC  302 (889)
T ss_pred             HhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhccCceEEEEeccccc--ccHHhcCCCCCCccCCeEEEEEeccHhhh
Confidence            57999999999875542 2223479999999999999999999999998  67999999999998999999999999999


Q ss_pred             hh-cccCCccccCCCChHhHHHHHHHhhcCCCCCCCChhHHHHHHHHHHHcCCchhHHHHHHhhcCCCCChhHHHHHHhc
Q 048758           81 AT-MRAVSGKTLKELSDDDCLRVLIQHSLGARYFNIPQSLKEVAEKIAKKCKGLPLAAKTLGGLLSGKDDLNDWEFVLNT  159 (777)
Q Consensus        81 ~~-~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~~~~i~~~c~glPlal~~~~~~l~~~~~~~~w~~~~~~  159 (777)
                      .. +++...++++.|+.+|||+||++.||.... ...+.++++|++|+++|+|+|||+.++|+.|+.|...++|+++.+.
T Consensus       303 ~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~-~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~  381 (889)
T KOG4658|consen  303 GRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTL-GSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNV  381 (889)
T ss_pred             hccccCCccccccccCccccHHHHHHhhccccc-cccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHcc
Confidence            99 788889999999999999999999987643 2334489999999999999999999999999999999999999987


Q ss_pred             ccccccc----CccCchhhHhhcccCCChhhHHHHhHhcCCCCCceeCHHHHHHHHHHCCCccCcCCCCcHHHHHHHHHH
Q 048758          160 NIWDLRE----DKCDILPTLRVSYHFLPPQLKRCFAYCSLFPKDYEFEEEEIILLWTAEGFLDQEYSGRKMEDLGREFVQ  235 (777)
Q Consensus       160 ~~~~~~~----~~~~~~~~l~~sy~~L~~~~k~~fl~~~~f~~~~~i~~~~l~~~w~~~g~i~~~~~~~~~~d~~~~~l~  235 (777)
                      ..+....    ..+.++.++++|||.||++.|.||+|||+||+|+.|+++.++.+|+|+||+.+...+..+++.|+++++
T Consensus       382 l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~  461 (889)
T KOG4658|consen  382 LKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIE  461 (889)
T ss_pred             ccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHH
Confidence            7554222    246899999999999998899999999999999999999999999999999987778899999999999


Q ss_pred             HHhhCcccccccC--CCCcEEecHHHHHHHHHhhc-----cceEEeec--ccccccccccCccceEEEEEeCcCCCCcch
Q 048758          236 ELHSRSLFQLSSK--DTSRFVMHDLINDLARWAAG-----EQYFRMED--TLAGENRQKFSQSLRHFSYIRGQYDGDTRL  306 (777)
Q Consensus       236 ~L~~~sLl~~~~~--~~~~~~mhd~i~~~~~~~~~-----~~~~~~~~--~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~  306 (777)
                      +|++++|+.....  ...+|.|||++|++|.++++     .+......  .....+....+..+|+++++.+.....   
T Consensus       462 ~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~---  538 (889)
T KOG4658|consen  462 ELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHI---  538 (889)
T ss_pred             HHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhc---
Confidence            9999999988762  45789999999999999999     44433332  222234455678889999988764433   


Q ss_pred             hhhccCCCccEEeeCcccCCCCchhhHHHHHHHHccCCceeEEeecCccCccccCccccCcCccCeeeccCCcccccchh
Q 048758          307 EFICDVQHLRTFLPMKLSDFGDNYLAWSALQMLLNHLPRLRVFSLRGYCNIFNLPNEIGNLKHLRCLNLSRTRIQILPES  386 (777)
Q Consensus       307 ~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~L~~~~~l~~lp~~i~~l~~L~~L~L~~~~i~~lp~~  386 (777)
                      .....++++++|......+     ........+|..++.|+||||++|..+..+|++|++|.+||||+++++.+..+|..
T Consensus       539 ~~~~~~~~L~tLll~~n~~-----~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~  613 (889)
T KOG4658|consen  539 AGSSENPKLRTLLLQRNSD-----WLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSG  613 (889)
T ss_pred             cCCCCCCccceEEEeecch-----hhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchH
Confidence            2334677899998877532     12445666799999999999999999999999999999999999999999999999


Q ss_pred             hhccccCcEEeeCCCcCccccchhccccCcccEEecCCcccccccCcccccccCCcccCcEEecCCCCCCcccccccccc
Q 048758          387 INSLYNLHTILLEDCWKLKKLCKDMGNLTKLRHLKNSNVHSLEEMPKGFGKLTSLLTLGRFVVGKDSGSGLRQLKSLAHL  466 (777)
Q Consensus       387 i~~L~~L~~L~l~~~~~l~~lp~~~~~L~~L~~L~l~~~~~~~~~p~~~~~l~~L~~L~~~~~~~~~~~~~~~l~~L~~L  466 (777)
                      +.+|++|.+|++..+..+..+|.....|++|++|.+.... ...-...++.+.+|++|........+...+..+..+..|
T Consensus       614 l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~-~~~~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~~~~~L  692 (889)
T KOG4658|consen  614 LGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSA-LSNDKLLLKELENLEHLENLSITISSVLLLEDLLGMTRL  692 (889)
T ss_pred             HHHHHhhheeccccccccccccchhhhcccccEEEeeccc-cccchhhHHhhhcccchhhheeecchhHhHhhhhhhHHH
Confidence            9999999999999997777777767779999999987754 121122345555666665444433222111111111111


Q ss_pred             CCcEEEccccccCCcccchhhccCcccccccceEeeccCCCccchHHHhcccCCCCCCCCeEEEeecCCCCCCc-ccCC-
Q 048758          467 QGRLKISKLENVKDVGDASEAQLNNKVNLEALILEWSARSERCEFETQVLSMLKPHRDVQELTITGYSGTKFPI-WLGD-  544 (777)
Q Consensus       467 ~~~l~i~~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~p~-~~~~-  544 (777)
                      . +.                        ...+.+..       .........+..+.+|+.|.+.++.+.+... |... 
T Consensus       693 ~-~~------------------------~~~l~~~~-------~~~~~~~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~  740 (889)
T KOG4658|consen  693 R-SL------------------------LQSLSIEG-------CSKRTLISSLGSLGNLEELSILDCGISEIVIEWEESL  740 (889)
T ss_pred             H-HH------------------------hHhhhhcc-------cccceeecccccccCcceEEEEcCCCchhhccccccc
Confidence            1 00                        00000000       0011223344556667777777766643221 2111 


Q ss_pred             --C-CCCCeeEEEEeCCCCCCCCCCCCCCCCcceeeecCCCCceEeCcccccC--C--CCCCCCCCcee-eccCccchhh
Q 048758          545 --S-SFSKLVQLKLEGCGKCTSLPSVGQLPFLKELLISGMDGVKIVGLEFYGN--I--CSVPFPSLEAL-SFSDMTEWEE  616 (777)
Q Consensus       545 --~-~l~~L~~L~L~~~~~~~~l~~~~~l~~L~~L~L~~~~~l~~~~~~~~~~--~--~~~~~~~L~~L-~l~~~~~l~~  616 (777)
                        . .|+++.++.+.+|.....+.+....|+|+.|.+.+|..++.+.......  .  ...+|.+++.+ .+.+.+.++.
T Consensus       741 ~~~~~f~~l~~~~~~~~~~~r~l~~~~f~~~L~~l~l~~~~~~e~~i~~~k~~~~l~~~i~~f~~~~~l~~~~~l~~l~~  820 (889)
T KOG4658|consen  741 IVLLCFPNLSKVSILNCHMLRDLTWLLFAPHLTSLSLVSCRLLEDIIPKLKALLELKELILPFNKLEGLRMLCSLGGLPQ  820 (889)
T ss_pred             chhhhHHHHHHHHhhccccccccchhhccCcccEEEEecccccccCCCHHHHhhhcccEEecccccccceeeecCCCCce
Confidence              0 1556777777777777766666667888888888877666553221111  0  11345556656 4555554444


Q ss_pred             hhccccCCCCCCCCCccEEEEecCCCcccccCCCCCccEEEEcCC
Q 048758          617 WIPCGAGTLPRRLLLLETLDITSCDQLLVTIQCLPALSELQIDGC  661 (777)
Q Consensus       617 ~~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~l~~L~~L~l~~~  661 (777)
                      +.     ..|-.++.|+.+.++.|+++    ..+|.+..+.+.+|
T Consensus       821 i~-----~~~l~~~~l~~~~ve~~p~l----~~~P~~~~~~i~~~  856 (889)
T KOG4658|consen  821 LY-----WLPLSFLKLEELIVEECPKL----GKLPLLSTLTIVGC  856 (889)
T ss_pred             eE-----ecccCccchhheehhcCccc----ccCccccccceecc
Confidence            31     12233455777777777654    45677777777775

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query777
1z6t_A591 Structure Of The Apoptotic Protease-activating Fact 1e-06
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 3e-06
>pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591 Back     alignment and structure 
Iteration: 1

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 103/234 (44%), Gaps = 39/234 (16%)
Query: 40  LLVLDDLWNENYNSWCTLSCPFGAGASGSKIVVTHRNQDVAATMRAVSGKTLKE--LSDD 97
           LL+LDD+W+    SW        A  S  +I++T R++ V  ++         E  L  +
Sbjct: 239 LLILDDVWD----SWV-----LKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKE 289
Query: 98  DCLRVLIQHSLGARYFNIPQS-LKEVAEKIAKKCKGLPLAAKTLGGLLSGKDDLNDWEFV 156
             L +L      + + N+ ++ L E A  I K+CKG PL    +G LL  +D  N WE+ 
Sbjct: 290 KGLEIL------SLFVNMKKADLPEQAHSIIKECKGSPLVVSLIGALL--RDFPNRWEYY 341
Query: 157 L----NTNIWDLRE----DKCDILPTLRVSYHFLPPQLKRCFAYCSLFPKDYEFEEEEII 208
           L    N     +R+    D   +   + +S   L   +K  +   S+  KD +   + + 
Sbjct: 342 LKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLC 401
Query: 209 LLWTAEGFLDQEYSGRKMEDLGREFVQELHSRSLFQLSSKDTSRFVMHDLINDL 262
           +LW  E          ++ED+ +EFV   +   LF   +  + R+ +HDL  D 
Sbjct: 402 ILWDME--------TEEVEDILQEFV---NKSLLFCDRNGKSFRYYLHDLQVDF 444

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query777
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 1e-78
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 3e-59
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-43
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-05
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 4e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 9e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 6e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  263 bits (673), Expect = 1e-78
 Identities = 65/405 (16%), Positives = 137/405 (33%), Gaps = 59/405 (14%)

Query: 1   VFRISKSILNSVAKDQS---NNDDDLNSLQVKLKERLSGK--KFLLVLDDLWNENYNSWC 55
           +    +++   + +D+S       ++   + +L+  +  K  + LL+LDD+W+       
Sbjct: 195 LLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLLILDDVWDSWVLKA- 253

Query: 56  TLSCPFGAGASGSKIVVTHRNQDVAATMRAVSGKT--LKELSDDDCLRVLIQHSLGARYF 113
                     S  +I++T R++ V  ++            L  +  L +L          
Sbjct: 254 --------FDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLF-----VN 300

Query: 114 NIPQSLKEVAEKIAKKCKGLPLAAKTLGGLLSGKDD-LNDWEFVLNTNIW-----DLRED 167
                L E A  I K+CKG PL    +G LL    +    +   L    +         D
Sbjct: 301 MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYD 360

Query: 168 KCDILPTLRVSYHFLPPQLKRCFAYCSLFPKDYEFEEEEIILLWTAEGFLDQEYSGRKME 227
              +   + +S   L   +K  +   S+  KD +   + + +LW  E             
Sbjct: 361 YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDME------------T 408

Query: 228 DLGREFVQELHSRSLFQLSSKD-TSRFVMHDLINDLARWAAGEQYFRMEDTLAGENRQKF 286
           +   + +QE  ++SL        + R+ +HDL  D        Q       L   +++  
Sbjct: 409 EEVEDILQEFVNKSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQ-------LQDLHKKII 461

Query: 287 SQSLRHFSYIRGQYDGDTRLEFICD-VQHLRTF-----LPMKLSDFGDNYLAWSALQMLL 340
           +Q  R+        D +  + +      H+ +      L   +     +++      +  
Sbjct: 462 TQFQRYHQPHTLSPDQEDCMYWYNFLAYHMASAKMHKELCALMFSL--DWIKAKTELVGP 519

Query: 341 NHLPRLRVFSLRGYCNIFNLPNEIGNLKHLRCLNLSRTRIQILPE 385
            HL    +     Y +I +  +   +      L+L+   +   P 
Sbjct: 520 AHL----IHEFVEYRHILDEKDCAVSENFQEFLSLNGHLLGRQPF 560
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query777
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.98
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.92
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.92
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.9
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.9
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.88
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.88
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.88
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.87
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.87
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.86
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.86
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.81
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.77
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.77
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.76
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.75
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.75
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.72
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.72
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.71
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.71
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.71
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.71
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.7
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.7
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.69
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.69
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.66
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.66
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.64
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.64
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.63
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.62
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.62
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.61
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.61
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.58
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.58
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.57
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.57
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.54
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.53
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.53
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.52
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.52
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.52
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.52
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.51
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.49
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.49
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.48
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.48
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.42
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.42
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.42
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.41
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.38
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.38
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.35
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.35
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.34
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.33
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.31
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.31
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.3
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.26
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.25
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.25
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.25
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.24
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.24
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.23
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.23
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.22
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.19
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.18
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.17
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.17
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.12
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.12
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.1
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.1
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.1
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.03
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.0
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.98
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.98
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.95
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.92
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 98.92
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.9
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.88
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.88
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.88
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.87
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.85
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.83
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.78
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.78
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.74
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.74
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.43
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.39
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.38
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.32
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.3
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.29
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.28
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.22
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.09
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.04
2fna_A357 Conserved hypothetical protein; structural genomic 98.04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.97
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.92
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.82
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.72
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.68
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.64
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.59
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 97.46
2v1u_A387 Cell division control protein 6 homolog; DNA repli 97.36
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.33
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.24
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.24
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.15
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 96.8
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 96.73
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 96.72
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 96.11
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.93
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.77
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 95.05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.94
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.75
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.06
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 90.72
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 88.9
2chq_A319 Replication factor C small subunit; DNA-binding pr 87.61
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 86.85
3bos_A242 Putative DNA replication factor; P-loop containing 83.68
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 83.3
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 81.83
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=99.98  E-value=3.1e-32  Score=303.01  Aligned_cols=250  Identities=16%  Similarity=0.222  Sum_probs=194.3

Q ss_pred             hhHHHHHHHhhcCCCC------CCCCCHHHHHHHHHHHhCCC-eEEEEEeCCCccchhchhhhccccCCCCCCcEEEEEe
Q 048758            2 FRISKSILNSVAKDQS------NNDDDLNSLQVKLKERLSGK-KFLLVLDDLWNENYNSWCTLSCPFGAGASGSKIVVTH   74 (777)
Q Consensus         2 ~~l~~~il~~l~~~~~------~~~~~~~~~~~~l~~~L~~~-~~LlvLDdv~~~~~~~~~~~~~~~~~~~~gs~iiiTT   74 (777)
                      .+++++|+..+.....      .+..+.+..+..+++.|+++ ||||||||||+.....|..        .+||+|||||
T Consensus       201 ~~~~~~il~~l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~~~~~--------~~gs~ilvTT  272 (549)
T 2a5y_B          201 FDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ--------ELRLRCLVTT  272 (549)
T ss_dssp             HHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH--------HTTCEEEEEE
T ss_pred             HHHHHHHHHHHhcCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEECCCCchhhcccc--------cCCCEEEEEc
Confidence            4688899999876521      12234567789999999996 9999999999964333332        2799999999


Q ss_pred             ecHHHHhhcc-cCCccccCCCChHhHHHHHHHhhcCCCCCCCChhHHHHHHHHHHHcCCchhHHHHHHhhcCCCCChhHH
Q 048758           75 RNQDVAATMR-AVSGKTLKELSDDDCLRVLIQHSLGARYFNIPQSLKEVAEKIAKKCKGLPLAAKTLGGLLSGKDDLNDW  153 (777)
Q Consensus        75 R~~~v~~~~~-~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~~~~i~~~c~glPlal~~~~~~l~~~~~~~~w  153 (777)
                      |++.++..++ ....|+|++|+.+|||+||..+||...   ..+.+.+++.+|+++|+|+||||+++|+.++.+ .. .|
T Consensus       273 R~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~---~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~-~w-~~  347 (549)
T 2a5y_B          273 RDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMP---VGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-TF-EK  347 (549)
T ss_dssp             SBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC-----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-SH-HH
T ss_pred             CCHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCC---CchhHHHHHHHHHHHhCCChHHHHHHHHHhccc-hH-HH
Confidence            9999998876 346799999999999999999998643   246788899999999999999999999999876 32 23


Q ss_pred             HHHHhccccccccCccCchhhHhhcccCCChhhHHHHh-----------HhcCCCCCceeCHHHHHHHHHHC--CCccCc
Q 048758          154 EFVLNTNIWDLREDKCDILPTLRVSYHFLPPQLKRCFA-----------YCSLFPKDYEFEEEEIILLWTAE--GFLDQE  220 (777)
Q Consensus       154 ~~~~~~~~~~~~~~~~~~~~~l~~sy~~L~~~~k~~fl-----------~~~~f~~~~~i~~~~l~~~w~~~--g~i~~~  220 (777)
                      ...+....+..  ....+..++.+||+.||+..|.||+           |||+||+++.|+    ++.|+++  |++...
T Consensus       348 ~~~l~~~l~~~--~~~~i~~~l~~Sy~~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~w~a~~~G~i~~~  421 (549)
T 2a5y_B          348 MAQLNNKLESR--GLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKLWSCVIPVDICSN  421 (549)
T ss_dssp             HHHHHHHHHHH--CSSTTCCCSSSSSSSHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHHHHHHSCC-----
T ss_pred             HHHhHHHhhcc--cHHHHHHHHhcccccccHHHHHHHhccchhhhhHhhheeeeCCCCeee----eeeeeeeccceeccC
Confidence            23333222111  3456889999999999999999999           999999999999    7899999  999876


Q ss_pred             CCCCcHHHHHHHHHHHHhhCcccccccC-CCCcEEecHHHHHHHHHhhccce
Q 048758          221 YSGRKMEDLGREFVQELHSRSLFQLSSK-DTSRFVMHDLINDLARWAAGEQY  271 (777)
Q Consensus       221 ~~~~~~~d~~~~~l~~L~~~sLl~~~~~-~~~~~~mhd~i~~~~~~~~~~~~  271 (777)
                      ......++.+. ++++|+++||++.... ...+|.|||++|++|+.++..+.
T Consensus       422 ~~~~~~~~~~~-~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~~~  472 (549)
T 2a5y_B          422 EEEQLDDEVAD-RLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQT  472 (549)
T ss_dssp             --CCCTHHHHH-HHHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTTSCTHH
T ss_pred             CCCCCHHHHHH-HHHHHHHcCCeeEecCCCceEEEeChHHHHHHHHHHHHHH
Confidence            54566777777 9999999999997653 34679999999999998876643
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 777
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 4e-26
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-04
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  106 bits (265), Expect = 4e-26
 Identities = 27/175 (15%), Positives = 52/175 (29%), Gaps = 16/175 (9%)

Query: 19  NDDDLNSLQVKLKERLSGKKFLLVLDDLWNENYNSWCTLSCPFGAGASGSKIVVTHRNQD 78
           +   +   ++     +     L V DD+  E    W        A     + +VT R+ +
Sbjct: 117 HVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRW--------AQELRLRCLVTTRDVE 168

Query: 79  VAATMRAVSGK-TLKELSDDDCLRVLIQHSLGARYFNIPQSLKEVAEKIAKKCKGLPLAA 137
           ++           +  L  D+C   L  + +      + +  ++V  K  +   G P   
Sbjct: 169 ISNAASQTCEFIEVTSLEIDECYDFLEAYGMPM---PVGEKEEDVLNKTIELSSGNPATL 225

Query: 138 KTLGGLLSGKDDLNDWEFVLNTNIWDLREDKCDILPTLRVSYHFLPPQLKRCFAY 192
                    K     +E +   N          +      SY  L   L+RC   
Sbjct: 226 MMFFKSCEPK----TFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEV 276
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query777
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.89
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.74
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.73
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.69
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.66
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.64
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.57
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.54
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.44
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.44
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.43
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.43
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.41
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.39
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.33
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.32
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.32
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.3
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.29
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.23
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.22
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.16
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.12
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.1
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.09
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.04
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.94
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.81
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.76
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.76
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.7
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.6
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.5
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.36
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.95
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.63
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.5
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.48
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.29
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.94
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.32
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.03
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 89.48
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.89  E-value=9.4e-24  Score=209.53  Aligned_cols=155  Identities=15%  Similarity=0.136  Sum_probs=126.4

Q ss_pred             HHHHHHHHHHhCCCeEEEEEeCCCccchhchhhhccccCCCCCCcEEEEEeecHHHHhhcccC-CccccCCCChHhHHHH
Q 048758           24 NSLQVKLKERLSGKKFLLVLDDLWNENYNSWCTLSCPFGAGASGSKIVVTHRNQDVAATMRAV-SGKTLKELSDDDCLRV  102 (777)
Q Consensus        24 ~~~~~~l~~~L~~~~~LlvLDdv~~~~~~~~~~~~~~~~~~~~gs~iiiTTR~~~v~~~~~~~-~~~~l~~L~~~ea~~L  102 (777)
                      ......+.+.+.++|+|+||||||+..  +|..+.      ..|||||||||++.++..+... ..|+|++|+.+|||+|
T Consensus       122 ~~~~~~~~~~L~~kr~LlVLDDv~~~~--~~~~~~------~~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~L  193 (277)
T d2a5yb3         122 VLKRMICNALIDRPNTLFVFDDVVQEE--TIRWAQ------ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDF  193 (277)
T ss_dssp             HHHHHHHHHHTTSTTEEEEEEEECCHH--HHHHHH------HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHH
T ss_pred             HHHHHHHHHHhccCCeeEecchhhHHh--hhhhhc------ccCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHH
Confidence            344556888899999999999999874  444332      2479999999999999887655 6799999999999999


Q ss_pred             HHHhhcCCCCCCCChhHHHHHHHHHHHcCCchhHHHHHHhhcCCCCChhHHHHHHhccccccccCccCchhhHhhcccCC
Q 048758          103 LIQHSLGARYFNIPQSLKEVAEKIAKKCKGLPLAAKTLGGLLSGKDDLNDWEFVLNTNIWDLREDKCDILPTLRVSYHFL  182 (777)
Q Consensus       103 f~~~~~~~~~~~~~~~~~~~~~~i~~~c~glPlal~~~~~~l~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~l~~sy~~L  182 (777)
                      |+.++|...   ..+..++++++|+++|+|+||||+++|+.|+.+ ..+.|....+.+..   .+..++..++.+||++|
T Consensus       194 f~~~~~~~~---~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k-~~~~~~~~~~~L~~---~~~~~v~~il~~sY~~L  266 (277)
T d2a5yb3         194 LEAYGMPMP---VGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-TFEKMAQLNNKLES---RGLVGVECITPYSYKSL  266 (277)
T ss_dssp             HHHTSCCCC-----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-SHHHHHHHHHHHHH---HCSSTTCCCSSSSSSSH
T ss_pred             HHHHhCCcc---CchhhHHHHHHHHHHhCCCHHHHHHHHHHhccC-CHHHHHHHHHHHhc---CcHHHHHHHHHHHHhcc
Confidence            999988643   234567899999999999999999999999887 46788776665532   23467999999999999


Q ss_pred             ChhhHHHHhHh
Q 048758          183 PPQLKRCFAYC  193 (777)
Q Consensus       183 ~~~~k~~fl~~  193 (777)
                      |++.|.||.++
T Consensus       267 ~~~lk~c~~~l  277 (277)
T d2a5yb3         267 AMALQRCVEVL  277 (277)
T ss_dssp             HHHHHHHHHTS
T ss_pred             cHHHHHHHHhC
Confidence            99999999763
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure