Citrus Sinensis ID: 048810


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580--
MNSQKEIQIDVLSKEEALQLFKKIVGDSMKTSAFQSIAVEIVGRCGGLPVALITLAKALKNESLDTWKDVLRQLRSSYAKEIDGMEKNVYLSIKLSYDFLRSEEAKSLFLLCGLFSEGHAIPVPYLLRYGMGMGYFKEVYTVEEARSRVHTLIGKLKSLCLLLDGDAEDEVKMHDVIRVVAVSIAEDEHMFNIPNVADLEKKMEETIRKDPIAISLPYRGDQVLPQRMRCPRLGLFLLHTIGLCSIQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLDRLINLQTLCLDGCRLKDIAKVGQLKKLEVLSFRDSDIEQLPLEIGQLRRLQLLDLSNCWTLEVIAPNVISKLSRLEELYMGNSFKRWEKVEGGSNASLVELNGLSKLTTLEIHVRYAEILPQDLVSVELQRYKMFIGEARGRWFVKSETSRLMKLERLKSVSILLRNPGMRMLLQRTEDLWLETLEGVPSVVHELDDGEGFPRLKHLYVESCSEILHIVGSVRRVGCEVFPLLETLYLIGLANLETICCSQLREDQSFSNLRIIEVEHCNKLKHLFSFSMAKNLLWLQKVGVEECDELKMIIGKC
ccccccEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccEEcccccEEEEcHHHHHHHHHHHHcccEEEEcccccccccccccEEEcEEEEEcccccccccccccccccEEEEEEEccccccccccHHHHcccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEcccccccccccHHHcccccccEEEcccccccccccccccccccccccccccccccccEEEEccccccHHHHcccccccEEEEEEEcccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccEEEEEcccccEEEccccccccccccccccEEEEEccccccEEcccccccccccccccEEEEEcccccccccccccccccccccEEEEEcccccccccccc
ccccccEEcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHcccccccccHHHHHccHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEHHHHHHHHHHHHHccccEEEEEcccccccccccccccEEEEEEEcccccccccccccccccEEEEEEccccccccccHHHHHHccccEEEEEcccccccccccHcccccccEEEccccccccccccccccccEEEEEccccccHccHHHcccccccEEEEccccccccccccHccccccccEEEEEcccccccccccccHHHHHHHHccccccEEEccccccccccccccHHHccccEEEccccccccccccccccHHHHHHHcccccccccccccccccccccEEEEccccccccccccccccccccccEEEEccccccEEcccccccccccccccccEEEEcccHcHHHHccccccccccccccEEEEEcccccHccccccccHcccccccEEEEcccHHHHHHHccc
MNSQKEIQIDVLSKEEALQLFKKIVGDSMKTSAFQSIAVEIVGRCGGLPVALITLAKALKNESLDTWKDVLRQLRSSYAKEIDGMEKNVYLSIKLSYDFLRSEEAKSLFLLCglfseghaipvpyllrygmgmgyFKEVYTVEEARSRVHTLIGKLKSLCLlldgdaedevkmHDVIRVVAVSIaedehmfnipnvADLEKKMEETIrkdpiaislpyrgdqvlpqrmrcprlgLFLLHTIGlcsiqvsdhffegmeglkvlqfpgigssslpsSLDRLINLQTlcldgcrlkdiakvgqlkklevlsfrdsdieqlplEIGQLRRLQlldlsncwtleviapnvISKLSRLEELYMGNSFkrwekveggsnaslvelnglsklttLEIHVRYAEILPQDLVSVELQRYKMFIGEARGRWFVKSETSRLMKLERLKSVSILLRNPGMRMLLQRTEDLWLEtlegvpsvvhelddgegfprlkHLYVESCSEILHIVGSVrrvgcevfpLLETLYLIGLANLETICCSQlredqsfsnlRIIEVEHCNKLKHLFSFSMAKNLLWLQKVGVEECDELKMIIGKC
mnsqkeiqidvlsKEEALQLFKKIVGDSMKTSAFQSIAVEIVGRCGGLPVALITLAKALKNESLDTWKDVLRQLRSSYAkeidgmeknVYLSIKLSYDFLRSEEAKSLFLLCGLFSEGHAIPVPYLLRYGMGMGYFKEVYTVEEARSRVHTLIGKLKSLCLLLDGDAEDEVKMHDVIRVVAvsiaedehmfnipNVADLEKKMEETIrkdpiaislpyrgdqvlPQRMRCPRLGLFLLHTIGLCSIQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLDRLINLQTLCLDGCRLKDIAKVGQLKKLEVLSFRDSDIEQLPLEIGQLRRLQLLDLSNCWTLEVIAPNVISKLSRLEELYMGNSFKRWEKVEGGSNASLVELNGLSKLTTLEIHVRYAEILPQDLVSVELQRYKMFigeargrwfvksetsrlmklerLKSVsillrnpgmrMLLQRTEDLWLETLEGVPSVVHELDDGEGFPRLKHLYVESCSEILHIVGSVRRVGCEVFPLLETLYLIGLANLETICCSQLREDQSFSNLRIIEVEHCNKLKHLFSFSMAKNLLWLQKVGVEECDELKMIIGKC
MNSQKEIQIDVLSKEEALQLFKKIVGDSMKTSAFQSIAVEIVGRCGGLPVALITLAKALKNESLDTWKDVLRQLRSSYAKEIDGMEKNVYLSIKLSYDFLRSEEAKSLFLLCGLFSEGHAIPVPYLLRYGMGMGYFKEVYTVEEARSRVHTligklkslcllldgdAEDEVKMHDVIRVVAVSIAEDEHMFNIPNVADLEKKMEETIRKDPIAISLPYRGDQVLPQRMRCPRLGLFLLHTIGLCSIQVSDHFFEGMEGLKVLQFpgigssslpsslDRLINLQTLCLDGCRLKDIAKVGQLKKLEVLSFRDSDIEQLPLEIGQLRRLQLLDLSNCWTLEVIAPNVISKLSRLEELYMGNSFKRWEKVEGGSNASLVELNGLSKLTTLEIHVRYAEILPQDLVSVELQRYKMFIGEARGRWFVKSETSRLMKLERLKSVSILLRNPGMRMLLQRTEDLWLETLEGVPSVVHELDDGEGFPRLKHLYVESCSEILHIVGSVRRVGCEVFPLLETLYLIGLANLETICCSQLREDQSFSNLRIIEVEHCNKLKHLFSFSMAKNLLWLQKVGVEECDELKMIIGKC
**********VLSKEEALQLFKKIVGDSMKTSAFQSIAVEIVGRCGGLPVALITLAKALKNESLDTWKDVLRQLRSSYAKEIDGMEKNVYLSIKLSYDFLRSEEAKSLFLLCGLFSEGHAIPVPYLLRYGMGMGYFKEVYTVEEARSRVHTLIGKLKSLCLLLDGDAEDEVKMHDVIRVVAVSIAEDEHMFNIPNVADLEKKMEETIRKDPIAISLPYRGDQVLPQRMRCPRLGLFLLHTIGLCSIQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLDRLINLQTLCLDGCRLKDIAKVGQLKKLEVLSFRDSDIEQLPLEIGQLRRLQLLDLSNCWTLEVIAPNVISKLSRLEELYMGNSFKRWEKVEGGSNASLVELNGLSKLTTLEIHVRYAEILPQDLVSVELQRYKMFIGEARGRWFVKSETSRLMKLERLKSVSILLRNPGMRMLLQRTEDLWLETLEGVPSVVHELDDGEGFPRLKHLYVESCSEILHIVGSVRRVGCEVFPLLETLYLIGLANLETICCSQLREDQSFSNLRIIEVEHCNKLKHLFSFSMAKNLLWLQKVGVEECDELKMII***
***QKEIQIDVLSKEEALQLFKKIVGDSMKTSAFQSIAVEIVGRCGGLPVALITLAKALKNESLDTWKDVLRQLRS**********KNVYLSIKLSYDFLRSEEAKSLFLLCGLFSEGHAIPVPYLLRYGMGMGYFKEVYTVEEARSRVHTLIGKLKSLCLLLDGDAEDEVKMHDVIRVVAVSIAEDEHMFNIPNVADLEKKMEETIRKDPIAISLPYRGDQVLPQRMRCPRLGLFLLHTIGLCSIQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLDRLINLQTLCLDGCRLKDIAKVGQLKKLEVLSFRDSDIEQLPLEIGQLRRLQLLDLSNCWTLEVIAP**ISKLSRLEELYMGNSFKRWEKVEGGSNASLVELNGLSKLTTLEIHVRYAEILPQDLVSVELQRYKMFIGEARGRWFVKSETSRLMKLERLKSVSILLRNPGMRMLLQRTEDLWLETLEGVPSVVHELDDGEGFPRLKHLYVESCSEILHIVGSVRRVGCEVFPLLETLYLIGLANLETICCSQLREDQSFSNLRIIEVEHCNKLKHLFSFSMAKNLLWLQKVGVEECDELKMIIGKC
MNSQKEIQIDVLSKEEALQLFKKIVGDSMKTSAFQSIAVEIVGRCGGLPVALITLAKALKNESLDTWKDVLRQLRSSYAKEIDGMEKNVYLSIKLSYDFLRSEEAKSLFLLCGLFSEGHAIPVPYLLRYGMGMGYFKEVYTVEEARSRVHTLIGKLKSLCLLLDGDAEDEVKMHDVIRVVAVSIAEDEHMFNIPNVADLEKKMEETIRKDPIAISLPYRGDQVLPQRMRCPRLGLFLLHTIGLCSIQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLDRLINLQTLCLDGCRLKDIAKVGQLKKLEVLSFRDSDIEQLPLEIGQLRRLQLLDLSNCWTLEVIAPNVISKLSRLEELYMGNSFKRWEKVEGGSNASLVELNGLSKLTTLEIHVRYAEILPQDLVSVELQRYKMFIGEARGRWFVKSETSRLMKLERLKSVSILLRNPGMRMLLQRTEDLWLETLEGVPSVVHELDDGEGFPRLKHLYVESCSEILHIVGSVRRVGCEVFPLLETLYLIGLANLETICCSQLREDQSFSNLRIIEVEHCNKLKHLFSFSMAKNLLWLQKVGVEECDELKMIIGKC
****KEIQIDVLSKEEALQLFKKIVGDSMKTSAFQSIAVEIVGRCGGLPVALITLAKALKNESLDTWKDVLRQLRSSYAKEIDGMEKNVYLSIKLSYDFLRSEEAKSLFLLCGLFSEGHAIPVPYLLRYGMGMGYFKEVYTVEEARSRVHTLIGKLKSLCLLLDGDAEDEVKMHDVIRVVAVSIAEDEHMFNIPNVADLEKKMEETIRKDPIAISLPYRGDQVLPQRMRCPRLGLFLLHTIGLCSIQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLDRLINLQTLCLDGCRLKDIAKVGQLKKLEVLSFRDSDIEQLPLEIGQLRRLQLLDLSNCWTLEVIAPNVISKLSRLEELYMGNSFKRWEKVEGGSNASLVELNGLSKLTTLEIHVRYAEILPQDLVSVELQRYKMFIGEARGRWFVKSETSRLMKLERLKSVSILLRNPGMRMLLQRTEDLWLETLEGVPSVVHELDDGEGFPRLKHLYVESCSEILHIVGSVRRVGCEVFPLLETLYLIGLANLETICCSQLREDQSFSNLRIIEVEHCNKLKHLFSFSMAKNLLWLQKVGVEECDELKMIIGKC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSQKEIQIDVLSKEEALQLFKKIVGDSMKTSAFQSIAVEIVGRCGGLPVALITLAKALKNESLDTWKDVLRQLRSSYAKEIDGMEKNVYLSIKLSYDFLRSEEAKSLFLLCGLFSEGHAIPVPYLLRYGMGMGYFKEVYTVEEARSRVHTLIGKLKSLCLLLDGDAEDEVKMHDVIRVVAVSIAEDEHMFNIPNVADLEKKMEETIRKDPIAISLPYRGDQVLPQRMRCPRLGLFLLHTIGLCSIQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLDRLINLQTLCLDGCRLKDIAKVGQLKKLEVLSFRDSDIEQLPLEIGQLRRLQLLDLSNCWTLEVIAPNVISKLSRLEELYMGNSFKRWEKVEGGSNASLVELNGLSKLTTLEIHVRYAEILPQDLVSVELQRYKMFIGEARGRWFVKSETSRLMKLERLKSVSILLRNPGMRMLLQRTEDLWLETLEGVPSVVHELDDGEGFPRLKHLYVESCSEILHIVGSVRRVGCEVFPLLETLYLIGLANLETICCSQLREDQSFSNLRIIEVEHCNKLKHLFSFSMAKNLLWLQKVGVEECDELKMIIGKC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query582 2.2.26 [Sep-21-2011]
Q9T048 985 Disease resistance protei yes no 0.955 0.564 0.298 2e-52
Q42484909 Disease resistance protei no no 0.865 0.554 0.273 3e-41
O81825919 Probable disease resistan no no 0.920 0.583 0.292 4e-41
Q9FG90862 Probable disease resistan no no 0.512 0.345 0.288 2e-24
P60838894 Probable disease resistan no no 0.505 0.328 0.302 2e-22
Q9FG91848 Probable disease resistan no no 0.585 0.402 0.302 2e-22
Q9LVT4843 Probable disease resistan no no 0.561 0.387 0.294 2e-22
Q9LMP6851 Probable disease resistan no no 0.319 0.218 0.352 2e-22
O22727967 Probable disease resistan no no 0.850 0.511 0.256 3e-22
Q9C8K0854 Probable disease resistan no no 0.508 0.346 0.291 6e-22
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function desciption
 Score =  207 bits (528), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 181/606 (29%), Positives = 301/606 (49%), Gaps = 50/606 (8%)

Query: 1   MNSQKEIQIDVLSKEEALQLFKKIVGDSMKTSAFQSIAVEIVGRCGGLPVALITLAKALK 60
           M +  ++++D L +E+A +LF K  GD +++   + IA  +   CGGLP+A+IT+  A++
Sbjct: 291 MKTDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMR 350

Query: 61  -NESLDTWKDVLRQLRSSYAKEIDGMEKNVYLSIKLSYDFLRSEEAKSLFLLCGLFSEGH 119
             +++  W  VL +L  S    I  +E+ ++  +KLSYDFL  ++AK  FLLC LF E +
Sbjct: 351 GKKNVKLWNHVLSKLSKSVPW-IKSIEEKIFQPLKLSYDFL-EDKAKFCFLLCALFPEDY 408

Query: 120 AIPVPYLLRYGMGMGYFKEVYTVEEARSRVHTLIGKLKSLCLLLDGDAEDEVKMHDVIRV 179
           +I V  ++RY M  G+ +E+ + E++ +   T +  LK  CLL DGD  D VKMHDV+R 
Sbjct: 409 SIEVTEVVRYWMAEGFMEELGSQEDSMNEGITTVESLKDYCLLEDGDRRDTVKMHDVVRD 468

Query: 180 VAVSI----AEDEHMFNIPNVADLEKKMEETIRKDPIA-----ISLPYRGDQVLPQRMR- 229
            A+ I     +D H   +           + IR+D +A     +SL     + LP  +  
Sbjct: 469 FAIWIMSSSQDDSHSLVMSGTG------LQDIRQDKLAPSLRRVSLMNNKLESLPDLVEE 522

Query: 230 -CPRLGLFLLHTIGLCSIQVSDHFFEGMEGLKVLQFPGIGSSSLPS-SLDRLINLQTLCL 287
            C +  + LL    L   +V   F +    L++L   G    S PS SL RL +L +L L
Sbjct: 523 FCVKTSVLLLQGNFLLK-EVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFL 581

Query: 288 DGC-RLKDIAKVGQLKKLEVLSFRDSDIEQLPLEIGQLRRLQLLDLSNCWTLEVIAPNVI 346
             C +L  +  +  L KLE+L    + I + P  + +L+R + LDLS    LE I   V+
Sbjct: 582 RDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVV 641

Query: 347 SKLSRLEELYMGNSFKRWEKVEGGS---NASLVELNGLSKLTTLEIHVRYAEIL--PQDL 401
           S+LS LE L M +S  RW  V+G +    A++ E+  L +L  L I +  +  L   ++ 
Sbjct: 642 SRLSSLETLDMTSSHYRW-SVQGETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNT 700

Query: 402 VSVELQRYKMFIGEARGRWFVKSETSRLMKLERLKSVSILLRNPGMRMLLQRTEDLWLET 461
               L+++++ +G    R+ +++   +     RL    + +    +  LL  T  L L  
Sbjct: 701 WIKRLKKFQLVVG---SRYILRTRHDK----RRLTISHLNVSQVSIGWLLAYTTSLALNH 753

Query: 462 LEGVPSVVHEL-DDGEGFPRLKHLYVESCSEILHIVGSVRRVGC----------EVFPLL 510
            +G+ +++ +L  D +GF  LK L +E+   I++    V  V            ++ P L
Sbjct: 754 CQGIEAMMKKLVSDNKGFKNLKSLTIENV--IINTNSWVEMVSTNTSKQSSDILDLLPNL 811

Query: 511 ETLYLIGLANLETICCSQLREDQSFSNLRIIEVEHCNKLKHLFSFSMAKNLLWLQKVGVE 570
           E L+L    +LET    Q         L+IIE+  C KL+ L        +  L+++ + 
Sbjct: 812 EELHL-RRVDLETFSELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIPNLEEIEIS 870

Query: 571 ECDELK 576
            CD L+
Sbjct: 871 YCDSLQ 876




Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG90|DRL33_ARATH Probable disease resistance protein At5g43740 OS=Arabidopsis thaliana GN=At5g43740 PE=2 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|Q9FG91|DRL32_ARATH Probable disease resistance protein At5g43730 OS=Arabidopsis thaliana GN=At5g43730 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1 Back     alignment and function description
>sp|Q9LMP6|DRL3_ARATH Probable disease resistance protein At1g15890 OS=Arabidopsis thaliana GN=At1g15890 PE=3 SV=2 Back     alignment and function description
>sp|O22727|DRL16_ARATH Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=3 SV=1 Back     alignment and function description
>sp|Q9C8K0|DRL5_ARATH Probable disease resistance protein At1g51480 OS=Arabidopsis thaliana GN=At1g51480 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query582
255563252 1603 Disease resistance protein RPS5, putativ 0.974 0.353 0.468 1e-125
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.974 0.431 0.448 1e-122
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.958 0.226 0.465 1e-120
224125154 949 cc-nbs-lrr resistance protein [Populus t 0.974 0.597 0.452 1e-119
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.974 0.423 0.459 1e-118
147865073 1694 hypothetical protein VITISV_021876 [Viti 0.981 0.337 0.441 1e-118
298204947 774 unnamed protein product [Vitis vinifera] 0.972 0.731 0.432 1e-114
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.974 0.424 0.448 1e-114
359488103 1530 PREDICTED: disease resistance protein At 0.981 0.373 0.429 1e-114
359487926 2087 PREDICTED: uncharacterized protein LOC10 0.972 0.271 0.432 1e-114
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  456 bits (1173), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 274/585 (46%), Positives = 384/585 (65%), Gaps = 18/585 (3%)

Query: 1   MNSQKEIQIDVLSKEEALQLFKKIVGDSMKTSAFQSIAVEIVGRCGGLPVALITLAKALK 60
           M  QK  +++VL +EEAL LF+ +VGD +K   FQS A E+  +C GLPV ++T+A+ALK
Sbjct: 299 MGVQKVFRLEVLQEEEALSLFEMMVGD-VKGGEFQSAASEVTKKCAGLPVLIVTIARALK 357

Query: 61  NESLDTWKDVLRQLRSSYAKEIDGMEKNVYLSIKLSYDFLRSEEAKSLFLLCGLFSEGHA 120
           N+ L  WKD ++QL     +EI   ++ VY +++LSY+ L   E KSLFLLCGL  +   
Sbjct: 358 NKDLYVWKDAVKQLSRCDNEEI---QEKVYSALELSYNHLIGAEVKSLFLLCGLLGKSD- 413

Query: 121 IPVPYLLRYGMGMGYFKEVYTVEEARSRVHTLIGKLKSLCLLLDGDAEDEVKMHDVIRVV 180
           I +  LL Y  G+G FK + T+ +AR+RVH LI  LK+ CLLLD D +  VK+HDV+R V
Sbjct: 414 IAILDLLMYSTGLGLFKGIDTLGDARNRVHKLISDLKAACLLLDSDIKGRVKIHDVVRDV 473

Query: 181 AVSIAED-EHMFNIPNVADLEKKMEETIRKDPIAISLPYRGDQVLPQRMRCPRLGLFLLH 239
           A+SIA   +H+F + N A L++   + + K    ISLPY     LP+ + CP L LFLL 
Sbjct: 474 AISIASRMQHLFTVRNGALLKEWPNKDVCKSCTRISLPYNDIHGLPEVLECPELELFLLF 533

Query: 240 TIGLCSIQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLDRLINLQTLCLDGCRLKDIAKVG 299
           T  + S++V D  FE  + L+VL F G+  SSLP SL  L NL TLCLD C L+D+A +G
Sbjct: 534 TQDI-SLKVPDLCFELTKNLRVLNFTGMHFSSLPPSLGFLKNLFTLCLDWCALRDVAIIG 592

Query: 300 QLKKLEVLSFRDSDIEQLPLEIGQLRRLQLLDLSNCWTLEVIAPNVISKLSRLEELYMGN 359
           +L  L +LSF+ SDI +LP EI QL +L+ LDLS+C  L+VI   +IS+L++LEELYM N
Sbjct: 593 ELTGLTILSFKHSDIVELPREIRQLTKLKFLDLSHCLKLKVIPAKIISELTQLEELYMNN 652

Query: 360 SFKRW--EKVEGGSNASLVELNGLSKLTTLEIHVRYAEILPQDLVSVELQRYKMFIGEAR 417
           SF  W  + +    NASL EL  L  LTTLEI V  A+ILP+DL   +L+R+++FIG+  
Sbjct: 653 SFDLWDVQGINNQRNASLAELECLPYLTTLEICVLDAKILPKDLFFRKLERFRIFIGDV- 711

Query: 418 GRWFVKSE--TSRLMKLERLKSVSILLRNPGMRMLLQRTEDLWLETLEGVPSVVHELDDG 475
             W    +  TSR +KL +L + SI L + G+ +LL+ TEDL+L  ++G+ SV+++L D 
Sbjct: 712 --WSGTGDYGTSRTLKL-KLNTSSIHLEH-GLSILLEVTEDLYLAEVKGIKSVLYDL-DS 766

Query: 476 EGFPRLKHLYVESCSEILHIVGSVRRVGCEVFPLLETLYLIGLANLETICCSQLREDQSF 535
           +GF +LKHL V++  EI +I+   RR  C  FP+LE+LYL  L +LE ICC +L    SF
Sbjct: 767 QGFTQLKHLDVQNDPEIQYIIDPNRRSPCNAFPILESLYLDNLMSLEKICCGKLTTG-SF 825

Query: 536 SNLRIIEVEHCNKLKHLFSFSMAKNLLWLQKVGVEECDELKMIIG 580
           S LR + V  C++LK+LFSFSM + LL LQ++ V +C  L+ I+ 
Sbjct: 826 SKLRSLTVVKCDRLKNLFSFSMMRCLLQLQQMKVVDCANLEEIVA 870




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224125154|ref|XP_002319513.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857889|gb|EEE95436.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information
>gi|298204947|emb|CBI34254.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488103|ref|XP_002263579.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487926|ref|XP_002270338.2| PREDICTED: uncharacterized protein LOC100248775 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query582
TAIR|locus:2136447 985 AT4G27190 [Arabidopsis thalian 0.963 0.569 0.271 4e-46
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.953 0.603 0.261 3.4e-33
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.663 0.424 0.258 8.3e-31
TAIR|locus:2171579843 AT5G47250 [Arabidopsis thalian 0.884 0.610 0.262 8.2e-21
TAIR|locus:2170902862 AT5G43740 [Arabidopsis thalian 0.907 0.612 0.248 1.8e-19
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.895 0.582 0.263 4.1e-19
TAIR|locus:2170892848 AT5G43730 [Arabidopsis thalian 0.594 0.408 0.284 4.4e-19
TAIR|locus:2036214851 AT1G15890 [Arabidopsis thalian 0.594 0.406 0.276 2.8e-18
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.599 0.458 0.269 3.6e-18
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.594 0.389 0.276 6.1e-17
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 493 (178.6 bits), Expect = 4.0e-46, P = 4.0e-46
 Identities = 163/601 (27%), Positives = 289/601 (48%)

Query:     1 MNSQKEIQIDVLSKEEALQLFKKIVGDSMKTSAFQSIAVEIVGRCGGLPVALITLAKALK 60
             M +  ++++D L +E+A +LF K  GD +++   + IA  +   CGGLP+A+IT+  A++
Sbjct:   291 MKTDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMR 350

Query:    61 NE-SLDTWKDVLRQLRSSYAKEIDGMEKNVYLSIKLSYDFLRSEEAKSLFLLCGLFSEGH 119
              + ++  W  VL +L  S    I  +E+ ++  +KLSYDFL  ++AK  FLLC LF E +
Sbjct:   351 GKKNVKLWNHVLSKLSKS-VPWIKSIEEKIFQPLKLSYDFLE-DKAKFCFLLCALFPEDY 408

Query:   120 AIPVPYLLRYGMGMGYFKEVYTVEEARSRVHTXXXXXXXXXXXXXXXAEDEVKMHDVIRV 179
             +I V  ++RY M  G+ +E+ + E++ +   T                 D VKMHDV+R 
Sbjct:   409 SIEVTEVVRYWMAEGFMEELGSQEDSMNEGITTVESLKDYCLLEDGDRRDTVKMHDVVRD 468

Query:   180 VAV----SIAEDEH--MFNIPNVADLEK-KMEETIRKDPIAISLPYRGDQVLPQRMR--C 230
              A+    S  +D H  + +   + D+ + K+  ++R+    +SL     + LP  +   C
Sbjct:   469 FAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRR----VSLMNNKLESLPDLVEEFC 524

Query:   231 PRLGLFLLHTIGLCSIQVSDHFFEGMEGLKVLQFXXXXXXXXXX-XXDRLINLQTLCLDG 289
              +  + LL    L   +V   F +    L++L                RL +L +L L  
Sbjct:   525 VKTSVLLLQGNFLLK-EVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRD 583

Query:   290 C-RLKDIAKVGQLKKLEVLSFRDSDIEQLPLEIGQLRRLQLLDLSNCWTLEVIAPNVISK 348
             C +L  +  +  L KLE+L    + I + P  + +L+R + LDLS    LE I   V+S+
Sbjct:   584 CFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSR 643

Query:   349 LSRLEELYMGNSFKRWEKVEGGSN---ASLVELNGLSKLTTLEIHVRYAEIL--PQDLVS 403
             LS LE L M +S  RW  V+G +    A++ E+  L +L  L I +  +  L   ++   
Sbjct:   644 LSSLETLDMTSSHYRWS-VQGETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWI 702

Query:   404 VELQRYKMFIGEARGRWFVKSETSRLMKLERLKSVSILLRNPGMRMLLQRTEDLWLETLE 463
               L+++++ +G    R+ +++   +     RL    + +    +  LL  T  L L   +
Sbjct:   703 KRLKKFQLVVGS---RYILRTRHDK----RRLTISHLNVSQVSIGWLLAYTTSLALNHCQ 755

Query:   464 GVPSVVHEL-DDGEGFPRLKHLYVESC-----SEILHIVGSVRRVGCEVFPLLETLYLIG 517
             G+ +++ +L  D +GF  LK L +E+      S +  +  +  +   ++  LL  L  + 
Sbjct:   756 GIEAMMKKLVSDNKGFKNLKSLTIENVIINTNSWVEMVSTNTSKQSSDILDLLPNLEELH 815

Query:   518 L--ANLETICCSQLREDQSFSNLRIIEVEHCNKLKHLFSFSMAKNLLWLQKVGVEECDEL 575
             L   +LET    Q         L+IIE+  C KL+ L        +  L+++ +  CD L
Sbjct:   816 LRRVDLETFSELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIPNLEEIEISYCDSL 875

Query:   576 K 576
             +
Sbjct:   876 Q 876




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170902 AT5G43740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query582
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 2e-17
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 9e-04
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.003
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score = 82.4 bits (204), Expect = 2e-17
 Identities = 41/134 (30%), Positives = 61/134 (45%), Gaps = 6/134 (4%)

Query: 5   KEIQIDVLSKEEALQLFKKIVGDSM--KTSAFQSIAVEIVGRCGGLPVALITLAKALKNE 62
           K  +++ L  EE+ +LF   V +         + +A EIV +C GLP+AL  L   L  +
Sbjct: 149 KPHEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFK 208

Query: 63  S-LDTWKDVLRQLRSSYAKEIDGMEKNVYLSIKLSYDFLRSEEAKSLFLLCGLFSEGHAI 121
           S +  W+ VL QL +  A         V   + LSYD L     K  FL   LF E + I
Sbjct: 209 STVQEWEHVLEQLNNELAGR--DGLNEVLSILSLSYDNLPM-HLKRCFLYLALFPEDYNI 265

Query: 122 PVPYLLRYGMGMGY 135
               L++  +  G+
Sbjct: 266 RKEQLIKLWIAEGF 279


Length = 285

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 582
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.92
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.85
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.82
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.76
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.61
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.58
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.54
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.53
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.5
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.36
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.32
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.19
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.17
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.16
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.14
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.01
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.84
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.8
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.78
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.69
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.68
KOG4341483 consensus F-box protein containing LRR [General fu 98.63
KOG4341483 consensus F-box protein containing LRR [General fu 98.55
PLN03150623 hypothetical protein; Provisional 98.53
PLN03150623 hypothetical protein; Provisional 98.48
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.43
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.38
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.34
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.33
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.29
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.27
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.2
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.16
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.15
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.13
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.11
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.1
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.9
PRK15386426 type III secretion protein GogB; Provisional 97.8
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.78
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.73
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.67
PRK15386426 type III secretion protein GogB; Provisional 97.66
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.65
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.51
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.46
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.41
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.3
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.19
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.0
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.92
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.8
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.8
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.77
KOG1947 482 consensus Leucine rich repeat proteins, some prote 96.14
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.08
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.64
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.58
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.25
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.12
PRK04841 903 transcriptional regulator MalT; Provisional 94.37
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.22
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.88
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.53
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.67
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.54
smart0037026 LRR Leucine-rich repeats, outliers. 90.54
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.84
smart0037026 LRR Leucine-rich repeats, outliers. 87.85
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.85
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 84.87
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 84.39
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=1.9e-61  Score=522.76  Aligned_cols=403  Identities=29%  Similarity=0.403  Sum_probs=319.9

Q ss_pred             CCCcceEEccCCCHHHHHHHHHHhhCCC--CCCcchHHHHHHHHHHhCCcchHHHHHHHHHccC-ChHHHHHHHHHHhcc
Q 048810            1 MNSQKEIQIDVLSKEEALQLFKKIVGDS--MKTSAFQSIAVEIVGRCGGLPVALITLAKALKNE-SLDTWKDVLRQLRSS   77 (582)
Q Consensus         1 ~~~~~~~~l~~L~~~~~~~Lf~~~a~~~--~~~~~l~~~~~~i~~~c~GlPLai~~~g~~L~~~-~~~~W~~~l~~l~~~   77 (582)
                      ||++.++++++|.++|||+||+++||+.  ..++.+.++|++||++|+|+|||++++|+.|+.| +.++|+++.+.+.+.
T Consensus       306 m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~  385 (889)
T KOG4658|consen  306 MGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSS  385 (889)
T ss_pred             ccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHcccccc
Confidence            7888999999999999999999999943  4556699999999999999999999999999987 888999999999888


Q ss_pred             ccccccchhhhHHHHHHHHHhhcCchhHHHHHHHhccCCCCCccChhHHHHHhhccCcccccccHHHHHHHHHHHHHHHH
Q 048810           78 YAKEIDGMEKNVYLSIKLSYDFLRSEEAKSLFLLCGLFSEGHAIPVPYLLRYGMGMGYFKEVYTVEEARSRVHTLIGKLK  157 (582)
Q Consensus        78 ~~~~~~~~~~~i~~~l~~sy~~L~~~~lk~cfly~~~fp~~~~i~~~~li~~Wiaeg~~~~~~~~~~~~~~~~~~~~~L~  157 (582)
                      ...++.++.+.|+++|++|||+||.+ +|.||+|||+|||||+|++++||..||||||+++....+.+++.+++|+.+||
T Consensus       386 ~~~~~~~~~~~i~~iLklSyd~L~~~-lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV  464 (889)
T KOG4658|consen  386 LAADFSGMEESILPILKLSYDNLPEE-LKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELV  464 (889)
T ss_pred             ccCCCCchhhhhHHhhhccHhhhhHH-HHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHH
Confidence            66566667899999999999999966 99999999999999999999999999999999886556778899999999999


Q ss_pred             hccccccCC---CCccEEhhhHHHHHHHHHhc-----cCCeEEcccchhhhHHHH-HhhccCcEEEEecCCCCcCCCCCC
Q 048810          158 SLCLLLDGD---AEDEVKMHDVIRVVAVSIAE-----DEHMFNIPNVADLEKKME-ETIRKDPIAISLPYRGDQVLPQRM  228 (582)
Q Consensus       158 ~~~l~~~~~---~~~~~~mhdl~~~l~~~~~~-----~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~l~~~~~~~l~~~~  228 (582)
                      .+++++...   ....|+|||+|||||.++++     +++.+....  ......| ...+..+|++++.++.+..++...
T Consensus       465 ~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~--~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~  542 (889)
T KOG4658|consen  465 RASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDG--VGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSS  542 (889)
T ss_pred             HHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECC--cCccccccccchhheeEEEEeccchhhccCCC
Confidence            999998664   45789999999999999999     555333322  1222334 556678999999999999999999


Q ss_pred             CCCCccEEEeeccCccccccChHHhcCCCCccEEEcCCCC-CCCCChhhhcccCccEEEcCCCCCCC-ccccCCCCCccE
Q 048810          229 RCPRLGLFLLHTIGLCSIQVSDHFFEGMEGLKVLQFPGIG-SSSLPSSLDRLINLQTLCLDGCRLKD-IAKVGQLKKLEV  306 (582)
Q Consensus       229 ~~~~L~~L~l~~~~~~~~~~~~~~~~~l~~Lr~L~l~~~~-~~~lp~~i~~L~~L~~L~L~~~~l~~-~~~~~~l~~L~~  306 (582)
                      .+++|++|-+..+......++..+|..|+.||+|||++|. +.++|++|++|.|||||+++++.++. |..+++|++|.+
T Consensus       543 ~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~  622 (889)
T KOG4658|consen  543 ENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIY  622 (889)
T ss_pred             CCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhhe
Confidence            9999999999988323678888999999999999999764 67899999999999999999999999 999999999999


Q ss_pred             EEeeCCC-CCccchhhcCCCCCCEEcccccc-cccccCcccccCCCcccEEEcCCCccccccccCCCccchhhccCCCCc
Q 048810          307 LSFRDSD-IEQLPLEIGQLRRLQLLDLSNCW-TLEVIAPNVISKLSRLEELYMGNSFKRWEKVEGGSNASLVELNGLSKL  384 (582)
Q Consensus       307 L~l~~~~-l~~lp~~i~~l~~L~~L~l~~~~-~l~~lp~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~l~~l~~L  384 (582)
                      |++..+. +..+|.....|++|++|.+..-. ..+..-...+.++.+|+.+.......          .....+..+..|
T Consensus       623 Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~~~~~~~~l~el~~Le~L~~ls~~~~s~----------~~~e~l~~~~~L  692 (889)
T KOG4658|consen  623 LNLEVTGRLESIPGILLELQSLRVLRLPRSALSNDKLLLKELENLEHLENLSITISSV----------LLLEDLLGMTRL  692 (889)
T ss_pred             eccccccccccccchhhhcccccEEEeeccccccchhhHHhhhcccchhhheeecchh----------HhHhhhhhhHHH
Confidence            9999884 44555656669999999987632 11111111134455555555433221          122334444444


Q ss_pred             c----EEEEEecccccCCccc-ccccccEEEEEeccc
Q 048810          385 T----TLEIHVRYAEILPQDL-VSVELQRYKMFIGEA  416 (582)
Q Consensus       385 ~----~L~l~~~~~~~~~~~~-~~~~L~~L~l~~~~~  416 (582)
                      +    .+.+.++...+.+..+ .+.+|+.|.+..+..
T Consensus       693 ~~~~~~l~~~~~~~~~~~~~~~~l~~L~~L~i~~~~~  729 (889)
T KOG4658|consen  693 RSLLQSLSIEGCSKRTLISSLGSLGNLEELSILDCGI  729 (889)
T ss_pred             HHHhHhhhhcccccceeecccccccCcceEEEEcCCC
Confidence            4    2232333333444443 778888888876665



>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query582
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 2e-26
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-21
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-18
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 9e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-05
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-05
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 1e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 9e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-04
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score =  112 bits (280), Expect = 2e-26
 Identities = 29/199 (14%), Positives = 67/199 (33%), Gaps = 12/199 (6%)

Query: 1   MNSQKEIQIDVLSKEEALQLFKKIVGDSMKTSAFQSIAVEIVGRCGGLPVALITLAKALK 60
             + + I++  L  +E     +            + +  + +    G P  L+   K+ +
Sbjct: 282 SQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCE 341

Query: 61  NESLDTWKDVLRQLRSSYAKEIDGMEKNVYLSI----KLSYDFLRSEEAKSLFLLCGLFS 116
            ++ +    +  +L S     ++ +    Y S+    +   + L S+E +S      +  
Sbjct: 342 PKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVL-SDEDRSALAFAVVMP 400

Query: 117 EGHAIPVPYLLRYGMGMGYFKEVYTVE-EARSRVHTLIGKLKSLCLLLDGD--AEDEVKM 173
            G  IPV              E   ++ E   R+  L  +      LL G        K+
Sbjct: 401 PGVDIPVKLWSCVIPVDICSNEEEQLDDEVADRLKRLSKR----GALLSGKRMPVLTFKI 456

Query: 174 HDVIRVVAVSIAEDEHMFN 192
             +I +    + + + + N
Sbjct: 457 DHIIHMFLKHVVDAQTIAN 475


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query582
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.93
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.93
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.93
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.93
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.93
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.92
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.91
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.91
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.89
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.88
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.87
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.87
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.86
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.84
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.83
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.83
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.83
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.82
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.79
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.78
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.78
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.78
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.78
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.77
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.77
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.76
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.76
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.75
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.75
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.75
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.74
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.73
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.73
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.71
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.71
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.7
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.7
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.69
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.69
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.69
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.69
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.68
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.67
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.67
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.66
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.65
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.63
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.63
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.62
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.61
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.61
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.61
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.61
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.6
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.6
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.6
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.6
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.59
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.58
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.57
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.56
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.55
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.54
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.54
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.54
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.54
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.53
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.52
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.5
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.48
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.47
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.43
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.43
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.42
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.41
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.4
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.39
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.38
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.34
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.33
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.3
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.29
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.29
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.23
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.22
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.19
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.14
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.09
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.04
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.9
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.84
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.84
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.72
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.68
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.68
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.51
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.5
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.42
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.17
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.16
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.16
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.08
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.94
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.89
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.68
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.54
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.35
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.62
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 95.57
2fna_A357 Conserved hypothetical protein; structural genomic 94.98
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.94
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.91
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.87
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.08
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 92.38
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 80.78
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
Probab=99.94  E-value=1.9e-26  Score=250.01  Aligned_cols=144  Identities=24%  Similarity=0.290  Sum_probs=122.2

Q ss_pred             hhhHHHHHhhccCcEEEEecCCCCcCCCCC--CCCCCccEEEeeccCccccccChHHhcCCCCccEEEcCCCCCCCC-Ch
Q 048810          198 DLEKKMEETIRKDPIAISLPYRGDQVLPQR--MRCPRLGLFLLHTIGLCSIQVSDHFFEGMEGLKVLQFPGIGSSSL-PS  274 (582)
Q Consensus       198 ~~~~~~~~~~~~~~~~l~l~~~~~~~l~~~--~~~~~L~~L~l~~~~~~~~~~~~~~~~~l~~Lr~L~l~~~~~~~l-p~  274 (582)
                      ..+..+|...+.+++++++++|.+..++..  .++++|++|+++++  ....+++..|.++++|++|++++|.++.+ |.
T Consensus        21 ~~l~~ip~~~~~~l~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n--~l~~i~~~~~~~l~~L~~L~Ls~n~l~~~~p~   98 (606)
T 3vq2_A           21 QKLSKVPDDIPSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRC--EIETIEDKAWHGLHHLSNLILTGNPIQSFSPG   98 (606)
T ss_dssp             SCCSSCCTTSCTTCCEEECTTSCCCEECTTTTTTCTTCCEEECTTC--CCCEECTTTTTTCTTCCEEECTTCCCCCCCTT
T ss_pred             CCcccCCCCCCCCcCEEECCCCCcCEeChhhccCCccCcEEeCCCC--cccccCHHHhhchhhcCEeECCCCcccccChh
Confidence            445566666678999999999999887763  38999999999987  55667666779999999999999999886 78


Q ss_pred             hhhcccCccEEEcCCCCCCC--ccccCCCCCccEEEeeCCCCC--ccchhhcCCCCCCEEcccccccccccCcc
Q 048810          275 SLDRLINLQTLCLDGCRLKD--IAKVGQLKKLEVLSFRDSDIE--QLPLEIGQLRRLQLLDLSNCWTLEVIAPN  344 (582)
Q Consensus       275 ~i~~L~~L~~L~L~~~~l~~--~~~~~~l~~L~~L~l~~~~l~--~lp~~i~~l~~L~~L~l~~~~~l~~lp~~  344 (582)
                      .++++++|++|++++|.++.  +..++++++|++|++++|.+.  .+|..++++++|++|++++| .+..+++.
T Consensus        99 ~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~lp~~~~~l~~L~~L~Ls~n-~l~~~~~~  171 (606)
T 3vq2_A           99 SFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHVDLSYN-YIQTITVN  171 (606)
T ss_dssp             SSTTCTTCCEEECTTSCCCCSSSSCCTTCTTCCEEECCSSCCCCCCCCGGGGTCTTCCEEECCSS-CCCEECTT
T ss_pred             hcCCcccCCEEEccCCccccccccccCCCCCCCEEeCCCCcccceechHhHhhcCCCCEEEccCC-cceecChh
Confidence            89999999999999999988  477999999999999999988  57999999999999999984 55555443



>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 582
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 4e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 61.8 bits (149), Expect = 4e-11
 Identities = 15/105 (14%), Positives = 37/105 (35%), Gaps = 7/105 (6%)

Query: 7   IQIDVLSKEEALQLFKKIVGDSMKTSAFQSIAVEIVGRCGGLPVALITLAKALKNESLDT 66
           I++  L  +E     +            + +  + +    G P  L+   K+ + ++ + 
Sbjct: 180 IEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEK 239

Query: 67  WKDVLRQLRSSYAKEIDGMEKNVYLSIKLSYDFLRSEEAKSLFLL 111
              +  +L S   + + G+E         SY  L     + + +L
Sbjct: 240 MAQLNNKLES---RGLVGVEC----ITPYSYKSLAMALQRCVEVL 277


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query582
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.79
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.78
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.74
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.73
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.72
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.71
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.69
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.68
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.68
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.65
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.6
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.59
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.56
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.5
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.41
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.38
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.33
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.31
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.31
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.2
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.18
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.93
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.9
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.78
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.65
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.32
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.77
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.53
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.0
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.93
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.74
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.1
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.83  E-value=1.1e-19  Score=182.77  Aligned_cols=299  Identities=16%  Similarity=0.183  Sum_probs=188.8

Q ss_pred             hccCcEEEEecCCCCcCCCCCCCCCCccEEEeeccCccccccChHHhcCCCCccEEEcCCCCCCCCChhhhcccCccEEE
Q 048810          207 IRKDPIAISLPYRGDQVLPQRMRCPRLGLFLLHTIGLCSIQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLDRLINLQTLC  286 (582)
Q Consensus       207 ~~~~~~~l~l~~~~~~~l~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~l~~Lr~L~l~~~~~~~lp~~i~~L~~L~~L~  286 (582)
                      ...+++.|+++++.+..+.....+++|++|+++++  ....+++  ++++++|++|++++|.+..++. ++.+++|++|+
T Consensus        42 ~l~~l~~L~l~~~~I~~l~gl~~L~nL~~L~Ls~N--~l~~l~~--l~~L~~L~~L~L~~n~i~~i~~-l~~l~~L~~L~  116 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNN--QLTDITP--LKNLTKLVDILMNNNQIADITP-LANLTNLTGLT  116 (384)
T ss_dssp             HHTTCCEEECCSSCCCCCTTGGGCTTCCEEECCSS--CCCCCGG--GTTCTTCCEEECCSSCCCCCGG-GTTCTTCCEEE
T ss_pred             HhCCCCEEECCCCCCCCccccccCCCCCEEeCcCC--cCCCCcc--ccCCcccccccccccccccccc-ccccccccccc
Confidence            45678999999999988865557889999999987  4555654  6889999999999999888764 88899999999


Q ss_pred             cCCCCCCCccccCCCCCccEEEeeCCCCCcc------------------------------------------chhhcCC
Q 048810          287 LDGCRLKDIAKVGQLKKLEVLSFRDSDIEQL------------------------------------------PLEIGQL  324 (582)
Q Consensus       287 L~~~~l~~~~~~~~l~~L~~L~l~~~~l~~l------------------------------------------p~~i~~l  324 (582)
                      +.++.++..........+..+....+.+..+                                          +.....+
T Consensus       117 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  196 (384)
T d2omza2         117 LFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKL  196 (384)
T ss_dssp             CCSSCCCCCGGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCGGGGGC
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccchhhhhccccccccccccccccccccccccc
Confidence            9888877744444555555555443322211                                          1123344


Q ss_pred             CCCCEEcccccccccccCcccccCCCcccEEEcCCCccccccccCCCccchhhccCCCCccEEEEEecccccCCcccccc
Q 048810          325 RRLQLLDLSNCWTLEVIAPNVISKLSRLEELYMGNSFKRWEKVEGGSNASLVELNGLSKLTTLEIHVRYAEILPQDLVSV  404 (582)
Q Consensus       325 ~~L~~L~l~~~~~l~~lp~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~  404 (582)
                      ++++.+++++ +.+..+++  .+..++|++|++++|.+..          +..+..+++|+.|++.+|.+..++....++
T Consensus       197 ~~~~~l~l~~-n~i~~~~~--~~~~~~L~~L~l~~n~l~~----------~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~  263 (384)
T d2omza2         197 TNLESLIATN-NQISDITP--LGILTNLDELSLNGNQLKD----------IGTLASLTNLTDLDLANNQISNLAPLSGLT  263 (384)
T ss_dssp             TTCSEEECCS-SCCCCCGG--GGGCTTCCEEECCSSCCCC----------CGGGGGCTTCSEEECCSSCCCCCGGGTTCT
T ss_pred             cccceeeccC-CccCCCCc--ccccCCCCEEECCCCCCCC----------cchhhcccccchhccccCccCCCCcccccc
Confidence            4455555544 23333333  2344455555555443221          223444555555555555544444333444


Q ss_pred             cccEEEEEeccccccccccccccccceecccceeehccccchHHHhhhcccceeeccccCcccccccccCCCCCCCCcEE
Q 048810          405 ELQRYKMFIGEARGRWFVKSETSRLMKLERLKSVSILLRNPGMRMLLQRTEDLWLETLEGVPSVVHELDDGEGFPRLKHL  484 (582)
Q Consensus       405 ~L~~L~l~~~~~~~~~~~~~~~l~~l~l~~~~~~~~l~~~~~i~~~~~~L~~L~L~~~~~~~~~~~~~~~~~~l~~L~~L  484 (582)
                      +|+.|++..+..                     ...   + .+.. ++.++.+.+..+.. +.+..    ...+++++.|
T Consensus       264 ~L~~L~l~~~~l---------------------~~~---~-~~~~-~~~l~~l~~~~n~l-~~~~~----~~~~~~l~~L  312 (384)
T d2omza2         264 KLTELKLGANQI---------------------SNI---S-PLAG-LTALTNLELNENQL-EDISP----ISNLKNLTYL  312 (384)
T ss_dssp             TCSEEECCSSCC---------------------CCC---G-GGTT-CTTCSEEECCSSCC-SCCGG----GGGCTTCSEE
T ss_pred             cCCEeeccCccc---------------------CCC---C-cccc-cccccccccccccc-ccccc----cchhcccCeE
Confidence            455544432221                     111   1 1122 36677777776653 33322    3378899999


Q ss_pred             EEeecCCceeeecccccccCCCCcccccccccccccccccccccccCcccCCCccEEEEecccCcccccChhHHhhhhhc
Q 048810          485 YVESCSEILHIVGSVRRVGCEVFPLLETLYLIGLANLETICCSQLREDQSFSNLRIIEVEHCNKLKHLFSFSMAKNLLWL  564 (582)
Q Consensus       485 ~l~~~~~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~L~~~~~~~~~~~~~~~~L~~L~l~~c~~L~~l~~~~~~~~l~~L  564 (582)
                      +++++ .++.++      ....+|+|++|+++++ +++.++.     .+.+++|++|++++| +++.+++   +.++++|
T Consensus       313 ~ls~n-~l~~l~------~l~~l~~L~~L~L~~n-~l~~l~~-----l~~l~~L~~L~l~~N-~l~~l~~---l~~l~~L  375 (384)
T d2omza2         313 TLYFN-NISDIS------PVSSLTKLQRLFFANN-KVSDVSS-----LANLTNINWLSAGHN-QISDLTP---LANLTRI  375 (384)
T ss_dssp             ECCSS-CCSCCG------GGGGCTTCCEEECCSS-CCCCCGG-----GGGCTTCCEEECCSS-CCCBCGG---GTTCTTC
T ss_pred             ECCCC-CCCCCc------ccccCCCCCEEECCCC-CCCCChh-----HcCCCCCCEEECCCC-cCCCChh---hccCCCC
Confidence            99887 344432      3567899999999986 6776642     567899999999988 6888864   5789999


Q ss_pred             ceeeecc
Q 048810          565 QKVGVEE  571 (582)
Q Consensus       565 ~~L~i~~  571 (582)
                      +.|+|++
T Consensus       376 ~~L~L~~  382 (384)
T d2omza2         376 TQLGLND  382 (384)
T ss_dssp             SEEECCC
T ss_pred             CEeeCCC
Confidence            9999986



>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure