Citrus Sinensis ID: 048811
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 318 | ||||||
| 147812093 | 607 | hypothetical protein VITISV_040899 [Viti | 0.905 | 0.474 | 0.280 | 9e-21 | |
| 18414142 | 381 | F-box/LRR-repeat protein [Arabidopsis th | 0.801 | 0.669 | 0.289 | 1e-18 | |
| 334186507 | 443 | F-box/LRR-repeat protein [Arabidopsis th | 0.801 | 0.575 | 0.289 | 2e-18 | |
| 4539430 | 374 | putative protein [Arabidopsis thaliana] | 0.773 | 0.657 | 0.305 | 2e-18 | |
| 22328947 | 419 | F-box/FBD/LRR-repeat protein [Arabidopsi | 0.773 | 0.587 | 0.305 | 3e-18 | |
| 15231646 | 520 | F-box/LRR-repeat protein [Arabidopsis th | 0.893 | 0.546 | 0.283 | 8e-18 | |
| 297820860 | 423 | hypothetical protein ARALYDRAFT_324460 [ | 0.852 | 0.640 | 0.283 | 3e-17 | |
| 18414140 | 468 | F-box/LRR-repeat protein [Arabidopsis th | 0.886 | 0.602 | 0.264 | 1e-16 | |
| 15217928 | 505 | F-box protein [Arabidopsis thaliana] gi| | 0.880 | 0.554 | 0.291 | 2e-16 | |
| 42568929 | 448 | F-box/FBD/LRR-repeat protein [Arabidopsi | 0.867 | 0.616 | 0.308 | 3e-16 |
| >gi|147812093|emb|CAN74740.1| hypothetical protein VITISV_040899 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 107 bits (266), Expect = 9e-21, Method: Compositional matrix adjust.
Identities = 88/314 (28%), Positives = 154/314 (49%), Gaps = 26/314 (8%)
Query: 23 DRISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSVRNLCFDDGGPMGAA--ADNP 80
D IS LPD +L +IL+FLP + AV TS LS+RWR+ W SV L FDD + + +
Sbjct: 10 DIISNLPDELLCHILSFLPTKFAVGTSILSKRWRYLWASVPILDFDDELWLNPSTLVELE 69
Query: 81 DLVDEFNNFIESVMAGTDPVSIHTFSLRSVNAIRRDRFPLWVSQAIMRNVREMEIDIIQY 140
+ + F NF++ V+ ++ I F L + D W+ A+ R V+E+++ ++
Sbjct: 70 ERIIMFQNFVDGVLRHSEVSCIKKFRLGYRDN-NLDSVYSWICIALERRVQELDLHLLID 128
Query: 141 APMQLPGCVYSSMTLEVLRLHTAFRFADPPDGVCFPQLKILQIY-ITHPENRVTEKLFCS 199
++LP + TL V++L A F D P V P LK L + + + ++ +KL
Sbjct: 129 WRVELPPMFFICKTLVVVKLSCAL-FLDIPTTVWLPSLKALHLKSVEYSDDDSIQKLLSG 187
Query: 200 CPSLTELSLTVLIQPDDPPANFIIQSTTLNTLTFVVLFASLRGMSY-------HHRAVIM 252
CP L EL +I+ ++ +++ + +L + +F G ++ ++ V+
Sbjct: 188 CPVLEEL----VIEREERDNQWVVNVSN-PSLKILRIFFFTDGFAHPYEQEDQDYKVVVD 242
Query: 253 APNLQLIRIVDNMLMEYEVHEMQSIQQATLDL-QHWESDTVDPQRA--------RNLIEG 303
APNL+ + I D + +Y V ++ S+ +A +D+ Q E P L+
Sbjct: 243 APNLEYLSITDYLSKDYFVKDLPSLVKAFIDVEQDSEEFEESPHNGGISYHGPIYELLGR 302
Query: 304 VATTACLILSGGVL 317
++ CL L+G L
Sbjct: 303 ISNVKCLSLTGVTL 316
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|18414142|ref|NP_567422.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75245750|sp|Q8L7H1.1|FBL75_ARATH RecName: Full=F-box/LRR-repeat protein At4g14103 gi|22136642|gb|AAM91640.1| unknown protein [Arabidopsis thaliana] gi|332657972|gb|AEE83372.1| F-box/LRR-repeat protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|334186507|ref|NP_001190724.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|332657973|gb|AEE83373.1| F-box/LRR-repeat protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|4539430|emb|CAB38963.1| putative protein [Arabidopsis thaliana] gi|7269486|emb|CAB79489.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|22328947|ref|NP_194364.2| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|75244651|sp|Q8H1R7.1|FDL27_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At4g26340 gi|23296372|gb|AAN13055.1| unknown protein [Arabidopsis thaliana] gi|332659787|gb|AEE85187.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15231646|ref|NP_191479.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75264308|sp|Q9LX51.1|FBL64_ARATH RecName: Full=F-box/LRR-repeat protein At3g59200 gi|7801670|emb|CAB91590.1| putative protein [Arabidopsis thaliana] gi|26450835|dbj|BAC42525.1| unknown protein [Arabidopsis thaliana] gi|29028916|gb|AAO64837.1| At3g59200 [Arabidopsis thaliana] gi|332646367|gb|AEE79888.1| F-box/LRR-repeat protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297820860|ref|XP_002878313.1| hypothetical protein ARALYDRAFT_324460 [Arabidopsis lyrata subsp. lyrata] gi|297324151|gb|EFH54572.1| hypothetical protein ARALYDRAFT_324460 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18414140|ref|NP_567421.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75249810|sp|Q94B46.1|FBL74_ARATH RecName: Full=F-box/LRR-repeat protein At4g14096 gi|14596145|gb|AAK68800.1| Unknown protein [Arabidopsis thaliana] gi|22136112|gb|AAM91134.1| unknown protein [Arabidopsis thaliana] gi|332657971|gb|AEE83371.1| F-box/LRR-repeat protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15217928|ref|NP_176127.1| F-box protein [Arabidopsis thaliana] gi|374095392|sp|Q9LQC1.2|FB65_ARATH RecName: Full=Putative F-box protein At1g58310 gi|332195413|gb|AEE33534.1| F-box protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|42568929|ref|NP_178506.3| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|75223245|sp|Q6NKX3.1|FDL14_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At2g04230 gi|46518465|gb|AAS99714.1| At2g04230 [Arabidopsis thaliana] gi|51971311|dbj|BAD44320.1| hypothetical protein [Arabidopsis thaliana] gi|330250715|gb|AEC05809.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 318 | ||||||
| TAIR|locus:2136834 | 419 | AT4G26340 "AT4G26340" [Arabido | 0.773 | 0.587 | 0.298 | 9e-22 | |
| TAIR|locus:2081157 | 520 | AT3G59200 "AT3G59200" [Arabido | 0.581 | 0.355 | 0.362 | 2.6e-19 | |
| TAIR|locus:2055993 | 448 | AT2G04230 "AT2G04230" [Arabido | 0.867 | 0.616 | 0.295 | 9.8e-19 | |
| TAIR|locus:505006456 | 468 | AT4G14096 "AT4G14096" [Arabido | 0.880 | 0.598 | 0.262 | 1.1e-18 | |
| TAIR|locus:2161073 | 430 | AT5G56440 "AT5G56440" [Arabido | 0.789 | 0.583 | 0.285 | 4.3e-17 | |
| TAIR|locus:2140538 | 316 | AT4G09920 "AT4G09920" [Arabido | 0.849 | 0.854 | 0.261 | 5.2e-17 | |
| TAIR|locus:2015681 | 449 | AT1G16930 "AT1G16930" [Arabido | 0.886 | 0.628 | 0.269 | 7.5e-17 | |
| TAIR|locus:1005716372 | 441 | AT4G00315 "AT4G00315" [Arabido | 0.556 | 0.401 | 0.312 | 3.6e-16 | |
| TAIR|locus:2162489 | 450 | AT5G22660 "AT5G22660" [Arabido | 0.902 | 0.637 | 0.257 | 5.8e-16 | |
| TAIR|locus:2101674 | 427 | AT3G50710 "AT3G50710" [Arabido | 0.566 | 0.421 | 0.302 | 2.2e-15 |
| TAIR|locus:2136834 AT4G26340 "AT4G26340" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 257 (95.5 bits), Expect = 9.0e-22, P = 9.0e-22
Identities = 80/268 (29%), Positives = 126/268 (47%)
Query: 23 DRISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSVRNLCFDDGGPMGAAADNPDL 82
DRIS L D +L IL+F+P +D VATS LS+RW+ W V L +DD G D
Sbjct: 2 DRISQLSDDLLLQILSFIPGKDVVATSLLSKRWQSLWMLVSELEYDDSYHTG------DY 55
Query: 83 VDEFNNFI-ESVMAGTDPVSIHTFSLRSVNAIRRDRFPLWVSQAIMRNVREMEIDI---I 138
F+ F+ S+++ PV H + D LW+ A+ R +R+++I+I
Sbjct: 56 -KSFSQFVYRSLLSNNAPVIKHLHLNLGPDCPAID-IGLWIGFALTRRLRQLKINIRTSS 113
Query: 139 QYAPMQLPGCVYSSMTLEVLRLHTAFRFADPPDGVCFPQLKILQIY-ITHPENRVTEKLF 197
A LP +Y+S TLE LRL F D P VC P LK+L + + + ++ L
Sbjct: 114 NDASFSLPSSLYTSDTLETLRLIN-FVLLDVPSSVCLPSLKVLHLKTVDYEDDASLPSLL 172
Query: 198 CSCPSLTELSLTVLIQPDDPPANFIIQSXXXXXXXXXXXXASLRGMSYHHRAVIMAPNLQ 257
CP+L EL + Q + F++ S + R VI P+L+
Sbjct: 173 FGCPNLEELFVERHDQDLEMDVTFVVPSLRRLSMID-------KNYGQCDRYVIDVPSLK 225
Query: 258 LIRIVDNMLMEY-EVHEMQSIQQATLDL 284
+ I D+ + + ++ M + +A +D+
Sbjct: 226 YLNITDDAVYDVRQIENMPELVEAHVDI 253
|
|
| TAIR|locus:2081157 AT3G59200 "AT3G59200" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2055993 AT2G04230 "AT2G04230" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006456 AT4G14096 "AT4G14096" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2161073 AT5G56440 "AT5G56440" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2140538 AT4G09920 "AT4G09920" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2015681 AT1G16930 "AT1G16930" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1005716372 AT4G00315 "AT4G00315" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162489 AT5G22660 "AT5G22660" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2101674 AT3G50710 "AT3G50710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 318 | |||
| pfam00646 | 48 | pfam00646, F-box, F-box domain | 8e-06 | |
| smart00256 | 41 | smart00256, FBOX, A Receptor for Ubiquitination Ta | 4e-04 |
| >gnl|CDD|201368 pfam00646, F-box, F-box domain | Back alignment and domain information |
|---|
Score = 42.2 bits (100), Expect = 8e-06
Identities = 14/47 (29%), Positives = 23/47 (48%)
Query: 23 DRISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSVRNLCFDD 69
+ LPD +L IL+ L +D + S +S+RWR S++
Sbjct: 1 FSLLDLPDDLLLEILSRLDPKDLLRLSLVSKRWRSLVDSLKLWKKRL 47
|
This domain is approximately 50 amino acids long, and is usually found in the N-terminal half of a variety of proteins. Two motifs that are commonly found associated with the F-box domain are the leucine rich repeats (LRRs; pfam00560 and pfam07723) and the WD repeat (pfam00400). The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression. Length = 48 |
| >gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 318 | |||
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.73 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.22 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 98.87 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.46 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.37 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.26 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.12 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.03 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.98 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.84 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.83 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.72 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.7 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.68 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.64 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.46 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.4 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 97.35 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.2 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.18 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.11 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.05 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.03 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 96.98 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 96.91 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.15 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.08 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 95.98 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 95.94 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 95.92 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 95.91 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 95.61 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 95.51 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 95.49 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 95.47 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.11 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 95.11 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 95.01 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 94.75 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 94.38 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 94.32 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 94.17 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 94.12 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 94.12 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 93.64 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 93.48 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 93.39 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 93.3 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 93.22 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 92.23 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 92.13 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 91.8 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 91.06 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 90.9 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 90.8 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 90.63 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 90.43 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 90.07 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 90.07 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 89.39 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 89.03 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 88.93 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 88.61 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 88.28 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 88.13 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 88.01 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 86.29 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 83.21 |
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.73 E-value=2.6e-19 Score=152.99 Aligned_cols=170 Identities=17% Similarity=0.228 Sum_probs=118.2
Q ss_pred CCCCChHHHHHHhhcCChhhHhhhhhcchhhHhhcCcCe---eeEEeeCCCCCCCCCCCCchhhHHHHHHHHhhCCCcce
Q 048811 25 ISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSVR---NLCFDDGGPMGAAADNPDLVDEFNNFIESVMAGTDPVS 101 (318)
Q Consensus 25 is~LPd~vL~~Ils~L~~~d~~~ts~vskrWr~lw~~~~---~L~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~ 101 (318)
+++||||++..|||.|+.||+.+.+.|||||.++-+.-. .+++.... . ......+.+.+ +
T Consensus 98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~~lDl~~r~-i-----------~p~~l~~l~~r-----g 160 (419)
T KOG2120|consen 98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQTLDLTGRN-I-----------HPDVLGRLLSR-----G 160 (419)
T ss_pred cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhccccccceeeeccCCCc-c-----------ChhHHHHHHhC-----C
Confidence 689999999999999999999999999999997533221 24444443 3 12333344443 4
Q ss_pred EeEEEEEeeCCCCCCChhHHHHHHHHCCceEEEEEEccCccccCCCCCccCCcccEEEecccceecCC--CCcCCCCCCc
Q 048811 102 IHTFSLRSVNAIRRDRFPLWVSQAIMRNVREMEIDIIQYAPMQLPGCVYSSMTLEVLRLHTAFRFADP--PDGVCFPQLK 179 (318)
Q Consensus 102 l~~l~l~~~~~~~~~~~~~wl~~a~~~~l~~L~l~~~~~~~~~lp~~~~~~~~L~~L~L~~~~~~~~~--~~~~~~~~L~ 179 (318)
|..|++--.. .+..++.... ..+..+++++|++........+...+..|..|+.|+| .|....++ ..-..-.+|+
T Consensus 161 V~v~Rlar~~-~~~prlae~~-~~frsRlq~lDLS~s~it~stl~~iLs~C~kLk~lSl-Eg~~LdD~I~~~iAkN~~L~ 237 (419)
T KOG2120|consen 161 VIVFRLARSF-MDQPRLAEHF-SPFRSRLQHLDLSNSVITVSTLHGILSQCSKLKNLSL-EGLRLDDPIVNTIAKNSNLV 237 (419)
T ss_pred eEEEEcchhh-hcCchhhhhh-hhhhhhhHHhhcchhheeHHHHHHHHHHHHhhhhccc-cccccCcHHHHHHhccccce
Confidence 6666654211 1112111111 1123479999999886555556666778999999999 88877654 1233678999
Q ss_pred eeEeeEEE-eCcchhhhhhcCCcccceeeeeeecCC
Q 048811 180 ILQIYITH-PENRVTEKLFCSCPSLTELSLTVLIQP 214 (318)
Q Consensus 180 ~L~L~~~~-~~~~~l~~ll~~cp~Le~L~l~~c~~~ 214 (318)
+|+|+.|. +++.++.-++++|..|.+|+|.+|...
T Consensus 238 ~lnlsm~sG~t~n~~~ll~~scs~L~~LNlsWc~l~ 273 (419)
T KOG2120|consen 238 RLNLSMCSGFTENALQLLLSSCSRLDELNLSWCFLF 273 (419)
T ss_pred eeccccccccchhHHHHHHHhhhhHhhcCchHhhcc
Confidence 99999987 444459999999999999999999874
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 318 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-05 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 1e-04 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 3e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 44.1 bits (103), Expect = 5e-05
Identities = 49/341 (14%), Positives = 97/341 (28%), Gaps = 90/341 (26%)
Query: 15 RVLKKVPEDRISALPDSVLSNILTFLPLED----AVAT---SSLSQRWRHAWTSVRNLCF 67
+L K D I D+V + F L V L ++ + ++
Sbjct: 44 SILSKEEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQR 103
Query: 68 DDGGPMGAAADNPDLVDEFNNFIESVMAGTDPVSIHTFSLRSVNAIRRDRFPLWVSQAIM 127
+ + + F+ +V+ R P + +
Sbjct: 104 QPSMMT----------RMYIEQRDRLYNDNQV-----FAKYNVS--RLQ--PYLKLRQAL 144
Query: 128 RNVREMEIDIIQYAPMQLPGCVYSSMTLEVLR---LHTAFRFA---------DPPDGVCF 175
+R + +++ + G + + L+V + F + P+ V
Sbjct: 145 LELRPAK-NVLIDG-V--LGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETV-- 198
Query: 176 PQLKILQ-IY----------------ITHPENRVTEKL--FCSCPSLTELSLTVLIQPDD 216
L++LQ + I + + +L L VL +
Sbjct: 199 --LEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYEN-CLLVL---LN 252
Query: 217 ---PPA--NFIIQSTTLNTLTFVVLFASLRGMSYHHRAVIMAPNLQLIRIVDNMLMEYEV 271
A F + L T F + L + H ++ L EV
Sbjct: 253 VQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDH---------HSMTLTPDEV 303
Query: 272 HEMQS--IQQATLDLQHWESDTVDPQR----ARNLIEGVAT 306
+ + DL E T +P+R A ++ +G+AT
Sbjct: 304 KSLLLKYLDCRPQDLPR-EVLTTNPRRLSIIAESIRDGLAT 343
|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 318 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.76 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.75 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.73 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.02 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 98.95 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.8 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.59 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.56 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.53 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.52 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.52 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.51 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.47 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.47 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.46 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.46 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.46 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.45 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.44 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.43 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.4 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.4 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.4 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.39 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.39 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.38 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.38 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.38 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.37 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.37 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.37 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.37 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.37 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.37 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.37 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.36 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.36 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.34 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.34 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.34 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.34 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.32 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.32 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.32 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.32 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.31 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.3 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.3 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.29 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.28 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.28 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.26 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.26 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.25 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.25 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.25 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.24 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.24 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.23 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.23 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.22 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.22 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.22 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.2 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.19 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.18 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.17 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.16 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.16 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.15 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.15 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.14 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.13 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.13 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.12 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.12 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.12 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.12 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.11 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.1 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.1 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.09 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.09 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.09 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.08 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.05 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.02 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.01 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.01 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.01 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.01 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.97 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.95 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.95 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.92 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.92 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.92 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.91 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.9 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.87 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.87 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.86 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.86 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.84 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.84 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.83 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.83 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.81 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.81 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.75 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.73 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.7 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.68 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.68 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.68 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.67 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.66 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.64 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.63 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.58 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.56 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.56 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.48 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.45 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.44 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.36 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.29 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.24 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.21 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.13 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.13 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.07 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.06 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.99 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 96.98 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.91 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 96.85 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.83 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 96.8 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.67 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 96.66 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 96.56 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 96.54 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.46 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.4 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.37 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.29 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.08 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 95.96 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 95.6 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 95.45 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 94.37 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 94.32 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 93.21 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 92.88 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 92.41 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 92.0 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 85.75 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 85.55 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 81.08 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 80.39 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 80.11 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
Probab=99.76 E-value=3.8e-21 Score=173.35 Aligned_cols=254 Identities=18% Similarity=0.174 Sum_probs=139.1
Q ss_pred CCccCCCCChHHHHHHhhcCChhhHhhhhhcchhhHhhcC---cCeeeEEeeCCCCCCCCCCCCchhhHHHHHHHHhhCC
Q 048811 21 PEDRISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWT---SVRNLCFDDGGPMGAAADNPDLVDEFNNFIESVMAGT 97 (318)
Q Consensus 21 ~~d~is~LPd~vL~~Ils~L~~~d~~~ts~vskrWr~lw~---~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~ 97 (318)
+...++.||||++.+||++|+.+|+++++.|||+|+++.. ....+++.... + . ...+...+..
T Consensus 5 ~~~~~~~LP~eil~~If~~L~~~d~~~~~~vc~~W~~~~~~~~~~~~l~l~~~~-~--------~---~~~~~~~~~~-- 70 (336)
T 2ast_B 5 PGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKN-L--------H---PDVTGRLLSQ-- 70 (336)
T ss_dssp --CCSSSSCHHHHHHHHTTSCHHHHHHTTSSCHHHHHHHTCSTTSSEEECTTCB-C--------C---HHHHHHHHHT--
T ss_pred ccCChhhCCHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhcCchhheeecccccc-C--------C---HHHHHhhhhc--
Confidence 3456899999999999999999999999999999999843 22345555443 3 1 1112222211
Q ss_pred CcceEeEEEEEeeCCC-CCCChhHHHHHHHHCCceEEEEEEccCccccCCCCCccCCcccEEEecccceecCC--CCcCC
Q 048811 98 DPVSIHTFSLRSVNAI-RRDRFPLWVSQAIMRNVREMEIDIIQYAPMQLPGCVYSSMTLEVLRLHTAFRFADP--PDGVC 174 (318)
Q Consensus 98 ~~~~l~~l~l~~~~~~-~~~~~~~wl~~a~~~~l~~L~l~~~~~~~~~lp~~~~~~~~L~~L~L~~~~~~~~~--~~~~~ 174 (318)
.++.+.+....-. .... .....++++|+++.+......+|..+..|++|++|+| .++.+... .....
T Consensus 71 ---~l~~L~l~~n~l~~~~~~------~~~~~~L~~L~L~~~~l~~~~~~~~~~~~~~L~~L~L-~~~~l~~~~~~~l~~ 140 (336)
T 2ast_B 71 ---GVIAFRCPRSFMDQPLAE------HFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSL-EGLRLSDPIVNTLAK 140 (336)
T ss_dssp ---TCSEEECTTCEECSCCCS------CCCCBCCCEEECTTCEECHHHHHHHHTTBCCCSEEEC-TTCBCCHHHHHHHTT
T ss_pred ---cceEEEcCCccccccchh------hccCCCCCEEEccCCCcCHHHHHHHHhhCCCCCEEeC-cCcccCHHHHHHHhc
Confidence 2445444321100 0000 0012466666666543222224445556677777777 66643321 11224
Q ss_pred CCCCceeEeeEE-EeCcchhhhhhcCCcccceeeeeee-cCCCCCCCceeeeccccceEEEEEEcC-ccceEEEeee---
Q 048811 175 FPQLKILQIYIT-HPENRVTEKLFCSCPSLTELSLTVL-IQPDDPPANFIIQSTTLNTLTFVVLFA-SLRGMSYHHR--- 248 (318)
Q Consensus 175 ~~~L~~L~L~~~-~~~~~~l~~ll~~cp~Le~L~l~~c-~~~~~~~~~~~i~s~~~~~~~l~i~~~-~L~~L~i~~~--- 248 (318)
+++|++|+|.++ .+.+..+..++.+||+|++|++.+| ...+. ......-..+ +|+.|++++|
T Consensus 141 ~~~L~~L~L~~~~~l~~~~l~~~~~~~~~L~~L~l~~~~~l~~~------------~~~~~~~~l~~~L~~L~l~~~~~~ 208 (336)
T 2ast_B 141 NSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEK------------HVQVAVAHVSETITQLNLSGYRKN 208 (336)
T ss_dssp CTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHH------------HHHHHHHHSCTTCCEEECCSCGGG
T ss_pred CCCCCEEECCCCCCCCHHHHHHHHhcCCCCCEEcCCCCCCcChH------------HHHHHHHhcccCCCEEEeCCCccc
Confidence 677777777777 4544446666677777777777777 43100 0000001345 6777777665
Q ss_pred --------EEEeCCCeeEEEEEeccc-c---ceeecCCCCceEEEEEEEeccCCCCChhhHHHHhcCCCceeEEEeecC
Q 048811 249 --------AVIMAPNLQLIRIVDNML-M---EYEVHEMQSIQQATLDLQHWESDTVDPQRARNLIEGVATTACLILSGG 315 (318)
Q Consensus 249 --------~~i~~P~L~~L~~~~~~~-~---~~~~~~~~sL~~l~l~~~~~~~~~~~~~~~~~~l~~l~~v~~L~l~~~ 315 (318)
..-..|+|++|.+.++.. . ...+.++++|+++++..+.. ..... ...+..+++++.|.++++
T Consensus 209 ~~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~l~~l~~L~~L~l~~~~~----~~~~~-~~~l~~~~~L~~L~l~~~ 282 (336)
T 2ast_B 209 LQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYD----IIPET-LLELGEIPTLKTLQVFGI 282 (336)
T ss_dssp SCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGGCTTCCEEECTTCTT----CCGGG-GGGGGGCTTCCEEECTTS
T ss_pred CCHHHHHHHHhhCCCCCEEeCCCCCcCCHHHHHHHhCCCCCCEeeCCCCCC----CCHHH-HHHHhcCCCCCEEeccCc
Confidence 112466777777766652 1 22455667777776654421 10111 133455777777776654
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 318 | ||||
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 4e-06 | |
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 5e-06 | |
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 0.002 | |
| d1p22a1 | 118 | a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b | 0.002 |
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: F-box/WD repeat-containing protein 7, FBXW7 species: Human (Homo sapiens) [TaxId: 9606]
Score = 42.8 bits (100), Expect = 4e-06
Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 3/53 (5%)
Query: 23 DRISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSV---RNLCFDDGGP 72
D IS LP + +L+FL +D + + + WR R C ++G
Sbjct: 17 DFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGID 69
|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 318 | |||
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.14 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.06 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.81 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.78 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.54 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.46 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.4 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.35 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.29 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.15 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.09 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.01 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.98 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.97 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.93 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.9 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.81 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.76 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.71 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.61 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.56 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.51 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.35 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.27 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.26 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.24 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.12 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.08 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 96.96 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.6 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.5 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 96.09 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.07 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.01 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 95.88 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 95.82 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 95.58 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 95.24 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 95.07 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 95.05 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 94.91 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 94.66 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 94.25 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 90.0 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 88.74 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 81.96 |
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.14 E-value=1.2e-11 Score=73.69 Aligned_cols=36 Identities=28% Similarity=0.508 Sum_probs=33.3
Q ss_pred CCCCChHHHHHHhhcCChhhHhhhhhcchhhHhhcC
Q 048811 25 ISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWT 60 (318)
Q Consensus 25 is~LPd~vL~~Ils~L~~~d~~~ts~vskrWr~lw~ 60 (318)
++.||+|++.+||++|+.+|+++++.|||+|+++..
T Consensus 1 f~~LP~eil~~If~~L~~~dl~~~~~Vcr~w~~l~~ 36 (41)
T d1fs1a1 1 WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLAS 36 (41)
T ss_dssp CCSSCHHHHHHHHTTSCGGGHHHHHTTCHHHHHHHT
T ss_pred CCcCCHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhC
Confidence 478999999999999999999999999999998643
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|