Citrus Sinensis ID: 048811


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MRRSTGSVPRIRRGRVLKKVPEDRISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSVRNLCFDDGGPMGAAADNPDLVDEFNNFIESVMAGTDPVSIHTFSLRSVNAIRRDRFPLWVSQAIMRNVREMEIDIIQYAPMQLPGCVYSSMTLEVLRLHTAFRFADPPDGVCFPQLKILQIYITHPENRVTEKLFCSCPSLTELSLTVLIQPDDPPANFIIQSTTLNTLTFVVLFASLRGMSYHHRAVIMAPNLQLIRIVDNMLMEYEVHEMQSIQQATLDLQHWESDTVDPQRARNLIEGVATTACLILSGGVLL
cccccccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHcccHHHHcccccEEEEcccccccccccHHHHHHHHHHHHHHHcccccccEEEEEEEEccccccccHHHHHHHHHHccccEEEEEEcccccccccccccccccccEEEEEEEEcccccccccccccccEEEEEEEEccHHHHHHHHHccccccEEEEccEEcccccccEEEEEcccccEEEEEEEEEcccccccccEEEEEcccEEEEEEEEcccccEEEEcccccEEEEEEEEEccccccccccHHHHccccccccEEEEEccccc
ccccEccccccccccccccccccHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEccccccEccccEEEcccEEEEEEEcEEEEcccccccccHHHHEEEEEEEEccHHHHHHHHHcccHHHHEEEEEEccccccEEEEEEEccccEEEEEEEEcccccccccccEEEEEcccEEEEEEEccccccEEEEcccccEEEEEEEEEcccccccHHHHHHHHHHHHcccEEEEcccccc
mrrstgsvprirrgrvlkkvpedrisalpdsvlsniltflpledavatssLSQRWRHAWTSVRnlcfddggpmgaaadnpdlVDEFNNFIESvmagtdpvsihTFSLrsvnairrdrfplwVSQAIMRNVREMEIDIIQyapmqlpgcvyssMTLEVLRLHTafrfadppdgvcfpqlKILQIYIthpenrvteklfcscpsltelsltvliqpddppanfiiqsttlNTLTFVVLFASLrgmsyhhravimapnlqlIRIVDNMLMEYEVHEMQSIQQATLDLQhwesdtvdpqraRNLIEGVATTACLILSGGVLL
mrrstgsvprirrgrvlkkvpedrisalpdsvlsnILTFLPLEDAVATSSLSQRWRHAWTSVRNLCFDDGGPMGAAADNPDLVDEFNNFIESVMAGTDPVSIHTFSLrsvnairrdrfplWVSQAIMRNVREMEIDIIQYAPMQLPGCVYSSMTLEVLRLHTAFRFADPPDGVCFPQLKILQIYITHPENRVTEKLFCSCPSLTELSLTVLIQPDDPPANFIIQSTTLNTLTFVVLFASLRGMSYHHRAVIMAPNLQLIRIVDNMLMEYEVHEMQSIQQATLDLQHWESDTVDPQRARNLIEGVATTACLILSGGVLL
MRRSTGSVPRIRRGRVLKKVPEDRISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSVRNLCFDDGGPMGAAADNPDLVDEFNNFIESVMAGTDPVSIHTFSLRSVNAIRRDRFPLWVSQAIMRNVREMEIDIIQYAPMQLPGCVYSSMTLEVLRLHTAFRFADPPDGVCFPQLKILQIYITHPENRVTEKLFCSCPSLTELSLTVLIQPDDPPANFIIQSttlntltfvvlfASLRGMSYHHRAVIMAPNLQLIRIVDNMLMEYEVHEMQSIQQATLDLQHWESDTVDPQRARNLIEGVATTACLILSGGVLL
************************ISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSVRNLCFDDGGPMGAAADNPDLVDEFNNFIESVMAGTDPVSIHTFSLRSVNAIRRDRFPLWVSQAIMRNVREMEIDIIQYAPMQLPGCVYSSMTLEVLRLHTAFRFADPPDGVCFPQLKILQIYITHPENRVTEKLFCSCPSLTELSLTVLIQPDDPPANFIIQSTTLNTLTFVVLFASLRGMSYHHRAVIMAPNLQLIRIVDNMLMEYEVHEMQSIQQATLDLQHWESDTVDPQRARNLIEGVATTACLILSGGV**
**************************ALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSVRNLCFDDGGPMGAAADNPDLVDEFNNFIESVMAGTDPVSIHTFSLRSVNAIRRDRFPLWVSQAIMRNVREMEIDIIQYAPMQLPGCVYSSMTLEVLRLHTAFRFADPPDGVCFPQLKILQIYITHPENRVTEKLFCSCPSLTELSLTVLIQPDDPPANFIIQSTTLNTLTFVVLFASLRGMSYHHRAVIMAPNLQLIRIVDNMLMEYEVHEMQSIQQATLDLQHWESDTVDPQRARNLIEGVATTACLILSGGVLL
*********RIRRGRVLKKVPEDRISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSVRNLCFDDGGPMGAAADNPDLVDEFNNFIESVMAGTDPVSIHTFSLRSVNAIRRDRFPLWVSQAIMRNVREMEIDIIQYAPMQLPGCVYSSMTLEVLRLHTAFRFADPPDGVCFPQLKILQIYITHPENRVTEKLFCSCPSLTELSLTVLIQPDDPPANFIIQSTTLNTLTFVVLFASLRGMSYHHRAVIMAPNLQLIRIVDNMLMEYEVHEMQSIQQATLDLQHWESDTVDPQRARNLIEGVATTACLILSGGVLL
**********************DRISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSVRNLCFDDGGPMGAAADNPDLVDEFNNFIESVMAGTDPVSIHTFSLRSVNAIRRDRFPLWVSQAIMRNVREMEIDIIQYAPMQLPGCVYSSMTLEVLRLHTAFRFADPPDGVCFPQLKILQIYITHPENRVTEKLFCSCPSLTELSLTVLIQPDDPPANFIIQSTTLNTLTFVVLFASLRGMSYHHRAVIMAPNLQLIRIVDNMLMEYEVHEMQSIQQATLDLQHWESDTVDPQRARNLIEGVATTACLILSGGVL*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRSTGSVPRIRRGRVLKKVPEDRISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSVRNLCFDDGGPMGAAADNPDLVDEFNNFIESVMAGTDPVSIHTFSLRSVNAIRRDRFPLWVSQAIMRNVREMEIDIIQYAPMQLPGCVYSSMTLEVLRLHTAFRFADPPDGVCFPQLKILQIYITHPENRVTEKLFCSCPSLTELSLTVLIQPDDPPANFIIQSTTLNTLTFVVLFASLRGMSYHHRAVIMAPNLQLIRIVDNMLMEYEVHEMQSIQQATLDLQHWESDTVDPQRARNLIEGVATTACLILSGGVLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query318 2.2.26 [Sep-21-2011]
Q8L7H1381 F-box/LRR-repeat protein yes no 0.801 0.669 0.289 2e-20
Q8H1R7 419 F-box/FBD/LRR-repeat prot no no 0.773 0.587 0.305 4e-20
Q9LX51 520 F-box/LRR-repeat protein no no 0.893 0.546 0.283 1e-19
Q94B46 468 F-box/LRR-repeat protein no no 0.886 0.602 0.264 2e-18
Q9LQC1 505 Putative F-box protein At no no 0.880 0.554 0.291 3e-18
Q6NKX3 448 F-box/FBD/LRR-repeat prot no no 0.867 0.616 0.308 5e-18
Q9FJ30 540 Putative F-box/LRR-repeat no no 0.949 0.559 0.261 2e-17
Q9FM87 430 Putative FBD-associated F no no 0.776 0.574 0.284 3e-17
Q9SCQ5 427 Putative FBD-associated F no no 0.707 0.526 0.284 4e-17
Q56W59 455 F-box/LRR-repeat protein no no 0.893 0.624 0.291 8e-17
>sp|Q8L7H1|FBL75_ARATH F-box/LRR-repeat protein At4g14103 OS=Arabidopsis thaliana GN=At4g14103 PE=2 SV=1 Back     alignment and function desciption
 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 77/266 (28%), Positives = 130/266 (48%), Gaps = 11/266 (4%)

Query: 23  DRISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSVRNLCFDDGGPMGAAADNPDL 82
           D IS+LPD + S+IL+FLP ++A +TS LS++WR+ +  V NL  DD   +    +  ++
Sbjct: 8   DVISSLPDDISSHILSFLPTKEAASTSVLSKKWRYLFAFVPNLDLDDSVYLNPENET-EI 66

Query: 83  VDEFNNFIESVMAGTDPVSIHTFSLRSVNAIRRDRFPLWVSQAIMRNVREMEIDIIQYAP 142
              F +F++ V+A      +H FSL+  + I   R   W++  + R V ++++ +   + 
Sbjct: 67  STSFMDFVDRVLALQGNSPLHKFSLKIGDGIDPVRIIPWINNVLERGVSDLDLHLNLESE 126

Query: 143 MQLPGCVYSSMTLEVLRLHTAFRFADPPDGVCFPQLKILQIYITHPENRVT--EKLFCSC 200
             LP  VY   TL  L+L          + V  P+LK L I  TH E       KL   C
Sbjct: 127 FLLPSQVYLCKTLVWLKLRFGLYPTIDVEDVHLPKLKTLYIEATHFEEHGVGLTKLLSGC 186

Query: 201 PSLTELSLTVLIQPDDPPANFIIQSTTLNTLTFVVLFASLRGMSYHHRAVIM-APNLQLI 259
           P L +L L       D  + FI    +++  T   L  S +      ++V++  PNL  +
Sbjct: 187 PMLEDLVL-------DDISWFIWDFASVSVPTLKRLRFSWQERDEFPKSVLLDTPNLVYL 239

Query: 260 RIVDNMLMEYEVHEMQSIQQATLDLQ 285
           +  D +  +Y    + S+ +A +DL+
Sbjct: 240 KFTDTVAGKYPKVNLDSLVEAHIDLR 265





Arabidopsis thaliana (taxid: 3702)
>sp|Q8H1R7|FDL27_ARATH F-box/FBD/LRR-repeat protein At4g26340 OS=Arabidopsis thaliana GN=At4g26340 PE=2 SV=1 Back     alignment and function description
>sp|Q9LX51|FBL64_ARATH F-box/LRR-repeat protein At3g59200 OS=Arabidopsis thaliana GN=At3g59200 PE=2 SV=1 Back     alignment and function description
>sp|Q94B46|FBL74_ARATH F-box/LRR-repeat protein At4g14096 OS=Arabidopsis thaliana GN=At4g14096 PE=2 SV=1 Back     alignment and function description
>sp|Q9LQC1|FB65_ARATH Putative F-box protein At1g58310 OS=Arabidopsis thaliana GN=At1g58310 PE=4 SV=2 Back     alignment and function description
>sp|Q6NKX3|FDL14_ARATH F-box/FBD/LRR-repeat protein At2g04230 OS=Arabidopsis thaliana GN=At2g04230 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJ30|FBL88_ARATH Putative F-box/LRR-repeat protein At5g41840 OS=Arabidopsis thaliana GN=At5g41840 PE=4 SV=1 Back     alignment and function description
>sp|Q9FM87|FBD26_ARATH Putative FBD-associated F-box protein At5g56440 OS=Arabidopsis thaliana GN=At5g56440 PE=4 SV=1 Back     alignment and function description
>sp|Q9SCQ5|FBD10_ARATH Putative FBD-associated F-box protein At3g50710 OS=Arabidopsis thaliana GN=At3g50710 PE=4 SV=1 Back     alignment and function description
>sp|Q56W59|FBL84_ARATH F-box/LRR-repeat protein At5g35995 OS=Arabidopsis thaliana GN=At5g35995 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
147812093 607 hypothetical protein VITISV_040899 [Viti 0.905 0.474 0.280 9e-21
18414142381 F-box/LRR-repeat protein [Arabidopsis th 0.801 0.669 0.289 1e-18
334186507 443 F-box/LRR-repeat protein [Arabidopsis th 0.801 0.575 0.289 2e-18
4539430374 putative protein [Arabidopsis thaliana] 0.773 0.657 0.305 2e-18
22328947 419 F-box/FBD/LRR-repeat protein [Arabidopsi 0.773 0.587 0.305 3e-18
15231646 520 F-box/LRR-repeat protein [Arabidopsis th 0.893 0.546 0.283 8e-18
297820860 423 hypothetical protein ARALYDRAFT_324460 [ 0.852 0.640 0.283 3e-17
18414140 468 F-box/LRR-repeat protein [Arabidopsis th 0.886 0.602 0.264 1e-16
15217928 505 F-box protein [Arabidopsis thaliana] gi| 0.880 0.554 0.291 2e-16
42568929 448 F-box/FBD/LRR-repeat protein [Arabidopsi 0.867 0.616 0.308 3e-16
>gi|147812093|emb|CAN74740.1| hypothetical protein VITISV_040899 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  107 bits (266), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 88/314 (28%), Positives = 154/314 (49%), Gaps = 26/314 (8%)

Query: 23  DRISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSVRNLCFDDGGPMGAA--ADNP 80
           D IS LPD +L +IL+FLP + AV TS LS+RWR+ W SV  L FDD   +  +   +  
Sbjct: 10  DIISNLPDELLCHILSFLPTKFAVGTSILSKRWRYLWASVPILDFDDELWLNPSTLVELE 69

Query: 81  DLVDEFNNFIESVMAGTDPVSIHTFSLRSVNAIRRDRFPLWVSQAIMRNVREMEIDIIQY 140
           + +  F NF++ V+  ++   I  F L   +    D    W+  A+ R V+E+++ ++  
Sbjct: 70  ERIIMFQNFVDGVLRHSEVSCIKKFRLGYRDN-NLDSVYSWICIALERRVQELDLHLLID 128

Query: 141 APMQLPGCVYSSMTLEVLRLHTAFRFADPPDGVCFPQLKILQIY-ITHPENRVTEKLFCS 199
             ++LP   +   TL V++L  A  F D P  V  P LK L +  + + ++   +KL   
Sbjct: 129 WRVELPPMFFICKTLVVVKLSCAL-FLDIPTTVWLPSLKALHLKSVEYSDDDSIQKLLSG 187

Query: 200 CPSLTELSLTVLIQPDDPPANFIIQSTTLNTLTFVVLFASLRGMSY-------HHRAVIM 252
           CP L EL    +I+ ++    +++  +   +L  + +F    G ++        ++ V+ 
Sbjct: 188 CPVLEEL----VIEREERDNQWVVNVSN-PSLKILRIFFFTDGFAHPYEQEDQDYKVVVD 242

Query: 253 APNLQLIRIVDNMLMEYEVHEMQSIQQATLDL-QHWESDTVDPQRA--------RNLIEG 303
           APNL+ + I D +  +Y V ++ S+ +A +D+ Q  E     P             L+  
Sbjct: 243 APNLEYLSITDYLSKDYFVKDLPSLVKAFIDVEQDSEEFEESPHNGGISYHGPIYELLGR 302

Query: 304 VATTACLILSGGVL 317
           ++   CL L+G  L
Sbjct: 303 ISNVKCLSLTGVTL 316




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|18414142|ref|NP_567422.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75245750|sp|Q8L7H1.1|FBL75_ARATH RecName: Full=F-box/LRR-repeat protein At4g14103 gi|22136642|gb|AAM91640.1| unknown protein [Arabidopsis thaliana] gi|332657972|gb|AEE83372.1| F-box/LRR-repeat protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334186507|ref|NP_001190724.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|332657973|gb|AEE83373.1| F-box/LRR-repeat protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|4539430|emb|CAB38963.1| putative protein [Arabidopsis thaliana] gi|7269486|emb|CAB79489.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|22328947|ref|NP_194364.2| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|75244651|sp|Q8H1R7.1|FDL27_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At4g26340 gi|23296372|gb|AAN13055.1| unknown protein [Arabidopsis thaliana] gi|332659787|gb|AEE85187.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15231646|ref|NP_191479.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75264308|sp|Q9LX51.1|FBL64_ARATH RecName: Full=F-box/LRR-repeat protein At3g59200 gi|7801670|emb|CAB91590.1| putative protein [Arabidopsis thaliana] gi|26450835|dbj|BAC42525.1| unknown protein [Arabidopsis thaliana] gi|29028916|gb|AAO64837.1| At3g59200 [Arabidopsis thaliana] gi|332646367|gb|AEE79888.1| F-box/LRR-repeat protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297820860|ref|XP_002878313.1| hypothetical protein ARALYDRAFT_324460 [Arabidopsis lyrata subsp. lyrata] gi|297324151|gb|EFH54572.1| hypothetical protein ARALYDRAFT_324460 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18414140|ref|NP_567421.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75249810|sp|Q94B46.1|FBL74_ARATH RecName: Full=F-box/LRR-repeat protein At4g14096 gi|14596145|gb|AAK68800.1| Unknown protein [Arabidopsis thaliana] gi|22136112|gb|AAM91134.1| unknown protein [Arabidopsis thaliana] gi|332657971|gb|AEE83371.1| F-box/LRR-repeat protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15217928|ref|NP_176127.1| F-box protein [Arabidopsis thaliana] gi|374095392|sp|Q9LQC1.2|FB65_ARATH RecName: Full=Putative F-box protein At1g58310 gi|332195413|gb|AEE33534.1| F-box protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42568929|ref|NP_178506.3| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|75223245|sp|Q6NKX3.1|FDL14_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At2g04230 gi|46518465|gb|AAS99714.1| At2g04230 [Arabidopsis thaliana] gi|51971311|dbj|BAD44320.1| hypothetical protein [Arabidopsis thaliana] gi|330250715|gb|AEC05809.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
TAIR|locus:2136834 419 AT4G26340 "AT4G26340" [Arabido 0.773 0.587 0.298 9e-22
TAIR|locus:2081157 520 AT3G59200 "AT3G59200" [Arabido 0.581 0.355 0.362 2.6e-19
TAIR|locus:2055993 448 AT2G04230 "AT2G04230" [Arabido 0.867 0.616 0.295 9.8e-19
TAIR|locus:505006456 468 AT4G14096 "AT4G14096" [Arabido 0.880 0.598 0.262 1.1e-18
TAIR|locus:2161073 430 AT5G56440 "AT5G56440" [Arabido 0.789 0.583 0.285 4.3e-17
TAIR|locus:2140538316 AT4G09920 "AT4G09920" [Arabido 0.849 0.854 0.261 5.2e-17
TAIR|locus:2015681 449 AT1G16930 "AT1G16930" [Arabido 0.886 0.628 0.269 7.5e-17
TAIR|locus:1005716372 441 AT4G00315 "AT4G00315" [Arabido 0.556 0.401 0.312 3.6e-16
TAIR|locus:2162489 450 AT5G22660 "AT5G22660" [Arabido 0.902 0.637 0.257 5.8e-16
TAIR|locus:2101674 427 AT3G50710 "AT3G50710" [Arabido 0.566 0.421 0.302 2.2e-15
TAIR|locus:2136834 AT4G26340 "AT4G26340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 257 (95.5 bits), Expect = 9.0e-22, P = 9.0e-22
 Identities = 80/268 (29%), Positives = 126/268 (47%)

Query:    23 DRISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSVRNLCFDDGGPMGAAADNPDL 82
             DRIS L D +L  IL+F+P +D VATS LS+RW+  W  V  L +DD    G      D 
Sbjct:     2 DRISQLSDDLLLQILSFIPGKDVVATSLLSKRWQSLWMLVSELEYDDSYHTG------DY 55

Query:    83 VDEFNNFI-ESVMAGTDPVSIHTFSLRSVNAIRRDRFPLWVSQAIMRNVREMEIDI---I 138
                F+ F+  S+++   PV  H       +    D   LW+  A+ R +R+++I+I    
Sbjct:    56 -KSFSQFVYRSLLSNNAPVIKHLHLNLGPDCPAID-IGLWIGFALTRRLRQLKINIRTSS 113

Query:   139 QYAPMQLPGCVYSSMTLEVLRLHTAFRFADPPDGVCFPQLKILQIY-ITHPENRVTEKLF 197
               A   LP  +Y+S TLE LRL   F   D P  VC P LK+L +  + + ++     L 
Sbjct:   114 NDASFSLPSSLYTSDTLETLRLIN-FVLLDVPSSVCLPSLKVLHLKTVDYEDDASLPSLL 172

Query:   198 CSCPSLTELSLTVLIQPDDPPANFIIQSXXXXXXXXXXXXASLRGMSYHHRAVIMAPNLQ 257
               CP+L EL +    Q  +    F++ S               +      R VI  P+L+
Sbjct:   173 FGCPNLEELFVERHDQDLEMDVTFVVPSLRRLSMID-------KNYGQCDRYVIDVPSLK 225

Query:   258 LIRIVDNMLMEY-EVHEMQSIQQATLDL 284
              + I D+ + +  ++  M  + +A +D+
Sbjct:   226 YLNITDDAVYDVRQIENMPELVEAHVDI 253




GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2081157 AT3G59200 "AT3G59200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055993 AT2G04230 "AT2G04230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006456 AT4G14096 "AT4G14096" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161073 AT5G56440 "AT5G56440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140538 AT4G09920 "AT4G09920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015681 AT1G16930 "AT1G16930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716372 AT4G00315 "AT4G00315" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162489 AT5G22660 "AT5G22660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101674 AT3G50710 "AT3G50710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
pfam0064648 pfam00646, F-box, F-box domain 8e-06
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 4e-04
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
 Score = 42.2 bits (100), Expect = 8e-06
 Identities = 14/47 (29%), Positives = 23/47 (48%)

Query: 23 DRISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSVRNLCFDD 69
            +  LPD +L  IL+ L  +D +  S +S+RWR    S++      
Sbjct: 1  FSLLDLPDDLLLEILSRLDPKDLLRLSLVSKRWRSLVDSLKLWKKRL 47


This domain is approximately 50 amino acids long, and is usually found in the N-terminal half of a variety of proteins. Two motifs that are commonly found associated with the F-box domain are the leucine rich repeats (LRRs; pfam00560 and pfam07723) and the WD repeat (pfam00400). The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression. Length = 48

>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 318
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.73
KOG4341483 consensus F-box protein containing LRR [General fu 99.22
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.87
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.46
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.37
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.26
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.12
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.03
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.98
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.84
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.83
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.72
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.68
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.64
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 97.46
KOG4341483 consensus F-box protein containing LRR [General fu 97.4
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 97.35
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.2
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.18
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.11
KOG1947 482 consensus Leucine rich repeat proteins, some prote 97.05
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.03
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 96.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 96.91
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.15
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 96.08
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.98
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 95.94
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.92
KOG0617264 consensus Ras suppressor protein (contains leucine 95.91
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 95.61
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 95.51
KOG0281 499 consensus Beta-TrCP (transducin repeats containing 95.49
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 95.47
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.11
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 95.11
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 95.01
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 94.75
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 94.38
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 94.32
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 94.17
KOG0617264 consensus Ras suppressor protein (contains leucine 94.12
KOG2982 418 consensus Uncharacterized conserved protein [Funct 94.12
KOG4237 498 consensus Extracellular matrix protein slit, conta 93.64
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 93.48
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 93.39
KOG2997366 consensus F-box protein FBX9 [General function pre 93.3
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 93.22
PRK15386 426 type III secretion protein GogB; Provisional 92.23
KOG2123 388 consensus Uncharacterized conserved protein [Funct 92.13
PLN03150623 hypothetical protein; Provisional 91.8
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.06
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 90.9
KOG2123 388 consensus Uncharacterized conserved protein [Funct 90.8
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.63
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 90.43
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 90.07
KOG1259490 consensus Nischarin, modulator of integrin alpha5 90.07
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 89.39
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 89.03
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 88.93
PLN03150623 hypothetical protein; Provisional 88.61
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 88.28
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 88.13
KOG0274 537 consensus Cdc4 and related F-box and WD-40 protein 88.01
PF13013109 F-box-like_2: F-box-like domain 86.29
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 83.21
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.73  E-value=2.6e-19  Score=152.99  Aligned_cols=170  Identities=17%  Similarity=0.228  Sum_probs=118.2

Q ss_pred             CCCCChHHHHHHhhcCChhhHhhhhhcchhhHhhcCcCe---eeEEeeCCCCCCCCCCCCchhhHHHHHHHHhhCCCcce
Q 048811           25 ISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSVR---NLCFDDGGPMGAAADNPDLVDEFNNFIESVMAGTDPVS  101 (318)
Q Consensus        25 is~LPd~vL~~Ils~L~~~d~~~ts~vskrWr~lw~~~~---~L~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~  101 (318)
                      +++||||++..|||.|+.||+.+.+.|||||.++-+.-.   .+++.... .           ......+.+.+     +
T Consensus        98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~~lDl~~r~-i-----------~p~~l~~l~~r-----g  160 (419)
T KOG2120|consen   98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQTLDLTGRN-I-----------HPDVLGRLLSR-----G  160 (419)
T ss_pred             cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhccccccceeeeccCCCc-c-----------ChhHHHHHHhC-----C
Confidence            689999999999999999999999999999997533221   24444443 3           12333344443     4


Q ss_pred             EeEEEEEeeCCCCCCChhHHHHHHHHCCceEEEEEEccCccccCCCCCccCCcccEEEecccceecCC--CCcCCCCCCc
Q 048811          102 IHTFSLRSVNAIRRDRFPLWVSQAIMRNVREMEIDIIQYAPMQLPGCVYSSMTLEVLRLHTAFRFADP--PDGVCFPQLK  179 (318)
Q Consensus       102 l~~l~l~~~~~~~~~~~~~wl~~a~~~~l~~L~l~~~~~~~~~lp~~~~~~~~L~~L~L~~~~~~~~~--~~~~~~~~L~  179 (318)
                      |..|++--.. .+..++.... ..+..+++++|++........+...+..|..|+.|+| .|....++  ..-..-.+|+
T Consensus       161 V~v~Rlar~~-~~~prlae~~-~~frsRlq~lDLS~s~it~stl~~iLs~C~kLk~lSl-Eg~~LdD~I~~~iAkN~~L~  237 (419)
T KOG2120|consen  161 VIVFRLARSF-MDQPRLAEHF-SPFRSRLQHLDLSNSVITVSTLHGILSQCSKLKNLSL-EGLRLDDPIVNTIAKNSNLV  237 (419)
T ss_pred             eEEEEcchhh-hcCchhhhhh-hhhhhhhHHhhcchhheeHHHHHHHHHHHHhhhhccc-cccccCcHHHHHHhccccce
Confidence            6666654211 1112111111 1123479999999886555556666778999999999 88877654  1233678999


Q ss_pred             eeEeeEEE-eCcchhhhhhcCCcccceeeeeeecCC
Q 048811          180 ILQIYITH-PENRVTEKLFCSCPSLTELSLTVLIQP  214 (318)
Q Consensus       180 ~L~L~~~~-~~~~~l~~ll~~cp~Le~L~l~~c~~~  214 (318)
                      +|+|+.|. +++.++.-++++|..|.+|+|.+|...
T Consensus       238 ~lnlsm~sG~t~n~~~ll~~scs~L~~LNlsWc~l~  273 (419)
T KOG2120|consen  238 RLNLSMCSGFTENALQLLLSSCSRLDELNLSWCFLF  273 (419)
T ss_pred             eeccccccccchhHHHHHHHhhhhHhhcCchHhhcc
Confidence            99999987 444459999999999999999999874



>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PF13013 F-box-like_2: F-box-like domain Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 1e-04
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 3e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 44.1 bits (103), Expect = 5e-05
 Identities = 49/341 (14%), Positives = 97/341 (28%), Gaps = 90/341 (26%)

Query: 15  RVLKKVPEDRISALPDSVLSNILTFLPLED----AVAT---SSLSQRWRHAWTSVRNLCF 67
            +L K   D I    D+V   +  F  L       V       L   ++   + ++    
Sbjct: 44  SILSKEEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQR 103

Query: 68  DDGGPMGAAADNPDLVDEFNNFIESVMAGTDPVSIHTFSLRSVNAIRRDRFPLWVSQAIM 127
                             +    + +           F+  +V+  R    P    +  +
Sbjct: 104 QPSMMT----------RMYIEQRDRLYNDNQV-----FAKYNVS--RLQ--PYLKLRQAL 144

Query: 128 RNVREMEIDIIQYAPMQLPGCVYSSMTLEVLR---LHTAFRFA---------DPPDGVCF 175
             +R  + +++    +   G   + + L+V     +     F          + P+ V  
Sbjct: 145 LELRPAK-NVLIDG-V--LGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETV-- 198

Query: 176 PQLKILQ-IY----------------ITHPENRVTEKL--FCSCPSLTELSLTVLIQPDD 216
             L++LQ +                 I    + +  +L             L VL    +
Sbjct: 199 --LEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYEN-CLLVL---LN 252

Query: 217 ---PPA--NFIIQSTTLNTLTFVVLFASLRGMSYHHRAVIMAPNLQLIRIVDNMLMEYEV 271
                A   F +    L T  F  +   L   +  H ++               L   EV
Sbjct: 253 VQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDH---------HSMTLTPDEV 303

Query: 272 HEMQS--IQQATLDLQHWESDTVDPQR----ARNLIEGVAT 306
             +    +     DL   E  T +P+R    A ++ +G+AT
Sbjct: 304 KSLLLKYLDCRPQDLPR-EVLTTNPRRLSIIAESIRDGLAT 343


>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.76
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.75
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.73
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.02
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.8
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.59
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.56
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.53
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.52
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.52
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.51
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.47
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.47
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.46
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.46
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.46
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.45
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.44
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.43
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.4
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.4
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.4
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.39
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.39
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.38
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.38
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.38
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.37
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.37
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.37
1o6v_A 466 Internalin A; bacterial infection, extracellular r 98.37
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.37
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.37
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.36
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.36
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.34
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.34
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.34
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.34
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.32
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.32
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.32
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.32
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.31
1o6v_A 466 Internalin A; bacterial infection, extracellular r 98.3
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.3
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.29
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.28
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.28
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.26
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.25
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.25
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.25
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.24
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.23
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.22
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 98.2
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.18
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.17
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.16
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.15
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 98.14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.13
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.12
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.12
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.12
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.11
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 98.1
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.1
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.02
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.01
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.01
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.01
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.01
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 97.97
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 97.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.92
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 97.92
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.91
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.9
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 97.87
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.87
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.86
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.86
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.84
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.83
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 97.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.81
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.81
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.75
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.73
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.7
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.68
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.68
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 97.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.66
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.64
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.63
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.58
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 97.56
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.56
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.45
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 97.44
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.36
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.29
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.24
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.21
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.13
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 96.99
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.98
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 96.91
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 96.85
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 96.83
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.8
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.67
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 96.56
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.54
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 96.46
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 96.4
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 96.37
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.29
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 95.96
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 95.6
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.45
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 94.37
4fdw_A401 Leucine rich hypothetical protein; putative cell s 94.32
4fdw_A401 Leucine rich hypothetical protein; putative cell s 93.21
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 92.88
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 92.41
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 92.0
4gt6_A394 Cell surface protein; leucine rich repeats, putati 85.75
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 85.55
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 81.08
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 80.39
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 80.11
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
Probab=99.76  E-value=3.8e-21  Score=173.35  Aligned_cols=254  Identities=18%  Similarity=0.174  Sum_probs=139.1

Q ss_pred             CCccCCCCChHHHHHHhhcCChhhHhhhhhcchhhHhhcC---cCeeeEEeeCCCCCCCCCCCCchhhHHHHHHHHhhCC
Q 048811           21 PEDRISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWT---SVRNLCFDDGGPMGAAADNPDLVDEFNNFIESVMAGT   97 (318)
Q Consensus        21 ~~d~is~LPd~vL~~Ils~L~~~d~~~ts~vskrWr~lw~---~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~   97 (318)
                      +...++.||||++.+||++|+.+|+++++.|||+|+++..   ....+++.... +        .   ...+...+..  
T Consensus         5 ~~~~~~~LP~eil~~If~~L~~~d~~~~~~vc~~W~~~~~~~~~~~~l~l~~~~-~--------~---~~~~~~~~~~--   70 (336)
T 2ast_B            5 PGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKN-L--------H---PDVTGRLLSQ--   70 (336)
T ss_dssp             --CCSSSSCHHHHHHHHTTSCHHHHHHTTSSCHHHHHHHTCSTTSSEEECTTCB-C--------C---HHHHHHHHHT--
T ss_pred             ccCChhhCCHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhcCchhheeecccccc-C--------C---HHHHHhhhhc--
Confidence            3456899999999999999999999999999999999843   22345555443 3        1   1112222211  


Q ss_pred             CcceEeEEEEEeeCCC-CCCChhHHHHHHHHCCceEEEEEEccCccccCCCCCccCCcccEEEecccceecCC--CCcCC
Q 048811           98 DPVSIHTFSLRSVNAI-RRDRFPLWVSQAIMRNVREMEIDIIQYAPMQLPGCVYSSMTLEVLRLHTAFRFADP--PDGVC  174 (318)
Q Consensus        98 ~~~~l~~l~l~~~~~~-~~~~~~~wl~~a~~~~l~~L~l~~~~~~~~~lp~~~~~~~~L~~L~L~~~~~~~~~--~~~~~  174 (318)
                         .++.+.+....-. ....      .....++++|+++.+......+|..+..|++|++|+| .++.+...  .....
T Consensus        71 ---~l~~L~l~~n~l~~~~~~------~~~~~~L~~L~L~~~~l~~~~~~~~~~~~~~L~~L~L-~~~~l~~~~~~~l~~  140 (336)
T 2ast_B           71 ---GVIAFRCPRSFMDQPLAE------HFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSL-EGLRLSDPIVNTLAK  140 (336)
T ss_dssp             ---TCSEEECTTCEECSCCCS------CCCCBCCCEEECTTCEECHHHHHHHHTTBCCCSEEEC-TTCBCCHHHHHHHTT
T ss_pred             ---cceEEEcCCccccccchh------hccCCCCCEEEccCCCcCHHHHHHHHhhCCCCCEEeC-cCcccCHHHHHHHhc
Confidence               2445444321100 0000      0012466666666543222224445556677777777 66643321  11224


Q ss_pred             CCCCceeEeeEE-EeCcchhhhhhcCCcccceeeeeee-cCCCCCCCceeeeccccceEEEEEEcC-ccceEEEeee---
Q 048811          175 FPQLKILQIYIT-HPENRVTEKLFCSCPSLTELSLTVL-IQPDDPPANFIIQSTTLNTLTFVVLFA-SLRGMSYHHR---  248 (318)
Q Consensus       175 ~~~L~~L~L~~~-~~~~~~l~~ll~~cp~Le~L~l~~c-~~~~~~~~~~~i~s~~~~~~~l~i~~~-~L~~L~i~~~---  248 (318)
                      +++|++|+|.++ .+.+..+..++.+||+|++|++.+| ...+.            ......-..+ +|+.|++++|   
T Consensus       141 ~~~L~~L~L~~~~~l~~~~l~~~~~~~~~L~~L~l~~~~~l~~~------------~~~~~~~~l~~~L~~L~l~~~~~~  208 (336)
T 2ast_B          141 NSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEK------------HVQVAVAHVSETITQLNLSGYRKN  208 (336)
T ss_dssp             CTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHH------------HHHHHHHHSCTTCCEEECCSCGGG
T ss_pred             CCCCCEEECCCCCCCCHHHHHHHHhcCCCCCEEcCCCCCCcChH------------HHHHHHHhcccCCCEEEeCCCccc
Confidence            677777777777 4544446666677777777777777 43100            0000001345 6777777665   


Q ss_pred             --------EEEeCCCeeEEEEEeccc-c---ceeecCCCCceEEEEEEEeccCCCCChhhHHHHhcCCCceeEEEeecC
Q 048811          249 --------AVIMAPNLQLIRIVDNML-M---EYEVHEMQSIQQATLDLQHWESDTVDPQRARNLIEGVATTACLILSGG  315 (318)
Q Consensus       249 --------~~i~~P~L~~L~~~~~~~-~---~~~~~~~~sL~~l~l~~~~~~~~~~~~~~~~~~l~~l~~v~~L~l~~~  315 (318)
                              ..-..|+|++|.+.++.. .   ...+.++++|+++++..+..    ..... ...+..+++++.|.++++
T Consensus       209 ~~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~l~~l~~L~~L~l~~~~~----~~~~~-~~~l~~~~~L~~L~l~~~  282 (336)
T 2ast_B          209 LQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYD----IIPET-LLELGEIPTLKTLQVFGI  282 (336)
T ss_dssp             SCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGGCTTCCEEECTTCTT----CCGGG-GGGGGGCTTCCEEECTTS
T ss_pred             CCHHHHHHHHhhCCCCCEEeCCCCCcCCHHHHHHHhCCCCCCEeeCCCCCC----CCHHH-HHHHhcCCCCCEEeccCc
Confidence                    112466777777766652 1   22455667777776654421    10111 133455777777776654



>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 318
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 4e-06
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 5e-06
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 0.002
d1p22a1118 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b 0.002
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: F-box/WD repeat-containing protein 7, FBXW7
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.8 bits (100), Expect = 4e-06
 Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 3/53 (5%)

Query: 23 DRISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWTSV---RNLCFDDGGP 72
          D IS LP  +   +L+FL  +D +  +   + WR         R  C ++G  
Sbjct: 17 DFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGID 69


>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.14
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.06
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.81
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.78
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.54
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.46
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.4
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.35
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.29
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.15
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.09
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.01
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.98
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.97
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 97.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.9
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.81
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.76
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.71
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.61
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.51
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.35
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.27
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.26
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.24
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.12
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.08
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 96.96
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.6
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.5
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.09
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.07
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.01
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 95.88
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.82
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.58
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 95.24
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 95.07
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.05
d2ifga3156 High affinity nerve growth factor receptor, N-term 94.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 94.66
d2ifga3156 High affinity nerve growth factor receptor, N-term 94.25
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 90.0
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 88.74
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 81.96
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.14  E-value=1.2e-11  Score=73.69  Aligned_cols=36  Identities=28%  Similarity=0.508  Sum_probs=33.3

Q ss_pred             CCCCChHHHHHHhhcCChhhHhhhhhcchhhHhhcC
Q 048811           25 ISALPDSVLSNILTFLPLEDAVATSSLSQRWRHAWT   60 (318)
Q Consensus        25 is~LPd~vL~~Ils~L~~~d~~~ts~vskrWr~lw~   60 (318)
                      ++.||+|++.+||++|+.+|+++++.|||+|+++..
T Consensus         1 f~~LP~eil~~If~~L~~~dl~~~~~Vcr~w~~l~~   36 (41)
T d1fs1a1           1 WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLAS   36 (41)
T ss_dssp             CCSSCHHHHHHHHTTSCGGGHHHHHTTCHHHHHHHT
T ss_pred             CCcCCHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhC
Confidence            478999999999999999999999999999998643



>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure