Citrus Sinensis ID: 048828

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------
QLPDFIGNLSALGILLIRWNSLGGQIPTTLGLLRNLVYLNVAENQFSGMFPRWICNISSLELIYLTVNRFSGSLPFDILVNLPNLKELGVGGNNFVGSIPDSLSNASNLERLDLPGNQFKGKVSIDFSSLKNLWWLNLEQNNLGMGTANDLDFVTSLTNCSSLKSLSLYDNQFGGELPHSIANLSSTMIQFSIGGNQISGTIPPGIRNLVNLVALTMDSNQLHGTIPDVIGELKNLQVLFLFRNFLQGSIPPSLGNLTKLADLALSFNNLQGNIPSSLGNCQNLISFRASHNKLTGALPYQLLSITTLSLYLDLSYNLLNGSLPLQMFTGRRPTDSAFTEGLTLHEFATMALPEKVIEIVDPSLLWR
cccccccccccccccccccccccccccHHHHccccccEEccccccccccccHHHHHHccccccccccccccccccHHHHcccccccEEEccccEEcccccHHccccccccEEEccccEEEEcccccccccccccEEEcccccccccccccccccccccccccccEEEcccccccccccHHHHHHHHHHcHHHccccEEEEccccccccccccccccccccccEEcccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHHHccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEEccccccccccccccccccHccccccEEEEEccccccccccHHHHHcccccEEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEccccccEEEccHHHHcccccccEEEccccEEEEEccHHHcccccccEEEccccccccccccccccHHHccHHHHHHHcc
QLPDFIGNLSALGILLIRWnslggqipttLGLLRNLVYLNVAEnqfsgmfprwicNISSLELIYLTVNrfsgslpfdilvnlpnlkelgvggnnfvgsipdslsnasnlerldlpgnqfkgkvsidFSSLKNLWWLNLEqnnlgmgtandLDFVTSltncsslkslslydnqfggelphsIANLSSTMIQFsiggnqisgtippgiRNLVNLVALTmdsnqlhgtiPDVIGELKNLQVLFLFRNflqgsippslgnltKLADLALSFNNlqgnipsslgncQNLISFRAShnkltgalpyqlLSITTLSLYLDLSYnllngslplqmftgrrptdsaftegltlhefatmalpekvieivdpsllwr
QLPDFIGNLSALGILLIRWNSLGGQIPTTLGLLRNLVYLNVAENQFSGMFPRWICNISSLELIYLTVNRFSGSLPFDILVNLPNLKELGVGGNNFVGSIPDSLSNASNLERLDLPGNQFKGKVSIDFSSLKNLWWLNLEQNNLGMGTANDLDFVTSLTNCSSLKSLSLYDNQFGGELPHSIANLSSTMIQFSIGGNQISGTIPPGIRNLVNLVALTMDSNQLHGTIPDVIGELKNLQVLFLFRNFLQGSIPPSLGNLTKLADLALSFNNLQGNIPSSLGNCQNLISFRASHNKLTGALPYQLLSITTLSLYLDLSYNLLNGSLPLQMFTGRRPTDSAFTEGLTLHEfatmalpekvieivdpsllwr
QLPDFIGNLSALGILLIRWNSLGGQIPTTLGLLRNLVYLNVAENQFSGMFPRWICNISSLELIYLTVNRFSGSLPFDILVNLPNLKELGVGGNNFVGSIPDSLSNASNLERLDLPGNQFKGKVSIDFSSlknlwwlnleqnnlGMGTANDLDFVTSLTNCSSLKSLSLYDNQFGGELPHSIANLSSTMIQFSIGGNQISGTIPPGIRNLVNLVALTMDSNQLHGTIPDVIGELKNLQVLFLFRNFLQGSIPPSLGNLTKLADLALSFNNLQGNIPSSLGNCQNLISFRASHNKLTGALPYQllsittlslyldlsynllngslPLQMFTGRRPTDSAFTEGLTLHEFATMALPEKVIEIVDPSLLWR
****FIGNLSALGILLIRWNSLGGQIPTTLGLLRNLVYLNVAENQFSGMFPRWICNISSLELIYLTVNRFSGSLPFDILVNLPNLKELGVGGNNFVGSIP**********RLDLPGNQFKGKVSIDFSSLKNLWWLNLEQNNLGMGTANDLDFVTSLTNCSSLKSLSLYDNQFGGELPHSIANLSSTMIQFSIGGNQISGTIPPGIRNLVNLVALTMDSNQLHGTIPDVIGELKNLQVLFLFRNFLQGSIPPSLGNLTKLADLALSFNNLQGNIPSSLGNCQNLISFRASHNKLTGALPYQLLSITTLSLYLDLSYNLLNGSLPLQMFTGRRPTDSAFTEGLTLHEFATMALPEKVIEIVDPSLL**
QLPDFIGNLSALGILLIRWNSLGGQIPTTLGLLRNLVYLNVAENQFSGMFPRWICNISSLELIYLTVNRFSGSLPFDILVNLPNLKELGVGGNNFVGSIPDSLSNASNLERLDLPGNQFKGKVSIDFSSLKNLWWLNLEQNNLGMGTANDLDFVTSLTNCSSLKSLSLYDNQFGGELPHSIANLSSTMIQFSIGGNQISGTIPPGIRNLVNLVALTMDSNQLHGTIPDVIGELKNLQVLFLFRNFLQGSIPPSLGNLTKLADLALSFNNLQGNIPSSLGNCQNLISFRASHNKLTGALPYQLLSITTLSLYLDLSYNLLNGSLPLQMFTGRRPTDSAFTEGLTLHEFATMALPEKVIEIVDPSLLW*
QLPDFIGNLSALGILLIRWNSLGGQIPTTLGLLRNLVYLNVAENQFSGMFPRWICNISSLELIYLTVNRFSGSLPFDILVNLPNLKELGVGGNNFVGSIPDSLSNASNLERLDLPGNQFKGKVSIDFSSLKNLWWLNLEQNNLGMGTANDLDFVTSLTNCSSLKSLSLYDNQFGGELPHSIANLSSTMIQFSIGGNQISGTIPPGIRNLVNLVALTMDSNQLHGTIPDVIGELKNLQVLFLFRNFLQGSIPPSLGNLTKLADLALSFNNLQGNIPSSLGNCQNLISFRASHNKLTGALPYQLLSITTLSLYLDLSYNLLNGSLPLQMFTGRRPTDSAFTEGLTLHEFATMALPEKVIEIVDPSLLWR
QLPDFIGNLSALGILLIRWNSLGGQIPTTLGLLRNLVYLNVAENQFSGMFPRWICNISSLELIYLTVNRFSGSLPFDILVNLPNLKELGVGGNNFVGSIPDSLSNASNLERLDLPGNQFKGKVSIDFSSLKNLWWLNLEQNNLGMGTANDLDFVTSLTNCSSLKSLSLYDNQFGGELPHSIANLSSTMIQFSIGGNQISGTIPPGIRNLVNLVALTMDSNQLHGTIPDVIGELKNLQVLFLFRNFLQGSIPPSLGNLTKLADLALSFNNLQGNIPSSLGNCQNLISFRASHNKLTGALPYQLLSITTLSLYLDLSYNLLNGSLPLQMFTGRRPTDSAFTEGLTLHEFATMALPEKVIEIVDPSLLWR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QLPDFIGNLSALGILLIRWNSLGGQIPTTLGLLRNLVYLNVAENQFSGMFPRWICNISSLELIYLTVNRFSGSLPFDILVNLPNLKELGVGGNNFVGSIPDSLSNASNLERLDLPGNQFKGKVSIDFSSLKNLWWLNLEQNNLGMGTANDLDFVTSLTNCSSLKSLSLYDNQFGGELPHSIANLSSTMIQFSIGGNQISGTIPPGIRNLVNLVALTMDSNQLHGTIPDVIGELKNLQVLFLFRNFLQGSIPPSLGNLTKLADLALSFNNLQGNIPSSLGNCQNLISFRASHNKLTGALPYQLLSITTLSLYLDLSYNLLNGSLPLQMFTGRRPTDSAFTEGLTLHEFATMALPEKVIEIVDPSLLWR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query367 2.2.26 [Sep-21-2011]
C0LGP4 1010 Probable LRR receptor-lik yes no 0.877 0.318 0.450 4e-63
C0LGT6 1031 LRR receptor-like serine/ no no 0.885 0.315 0.429 3e-61
Q9SD62 1025 Putative receptor-like pr no no 0.893 0.32 0.435 5e-60
Q9FL28 1173 LRR receptor-like serine/ no no 0.858 0.268 0.382 5e-46
Q9ZUI0 980 Putative leucine-rich rep no no 0.891 0.333 0.367 8e-44
Q9FRS6 1029 Leucine-rich repeat recep no no 0.910 0.324 0.343 2e-41
O22938 890 Leucine-rich repeat recep no no 0.888 0.366 0.351 1e-40
C0LGW6 966 LRR receptor-like serine/ no no 0.844 0.320 0.359 2e-40
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.880 0.257 0.347 4e-40
C0LGS2 1136 Probable LRR receptor-lik no no 0.869 0.280 0.360 1e-39
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function desciption
 Score =  242 bits (617), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 204/324 (62%), Gaps = 2/324 (0%)

Query: 1   QLPDFIGNLSALGILLIRWNSLGGQIPTTLGLLRNLVYLNVAENQFSGMFPRWICNISSL 60
           +LP  +GNL+ L  L +  N+L G+IP+ +  L  +  L +  N FSG+FP  + N+SSL
Sbjct: 177 KLPTSLGNLTLLEQLALSHNNLEGEIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSSL 236

Query: 61  ELIYLTVNRFSGSLPFDILVNLPNLKELGVGGNNFVGSIPDSLSNASNLERLDLPGNQFK 120
           +L+ +  N FSG L  D+ + LPNL    +GGN F GSIP +LSN S LERL +  N   
Sbjct: 237 KLLGIGYNHFSGRLRPDLGILLPNLLSFNMGGNYFTGSIPTTLSNISTLERLGMNENNLT 296

Query: 121 GKVSIDFSSLKNLWWLNLEQNNLGMGTANDLDFVTSLTNCSSLKSLSLYDNQFGGELPHS 180
           G +   F ++ NL  L L  N+LG  ++ DL+F+TSLTNC+ L++L +  N+ GG+LP S
Sbjct: 297 GSIPT-FGNVPNLKLLFLHTNSLGSDSSRDLEFLTSLTNCTQLETLGIGRNRLGGDLPIS 355

Query: 181 IANLSSTMIQFSIGGNQISGTIPPGIRNLVNLVALTMDSNQLHGTIPDVIGELKNLQVLF 240
           IANLS+ ++   +GG  ISG+IP  I NL+NL  L +D N L G +P  +G+L NL+ L 
Sbjct: 356 IANLSAKLVTLDLGGTLISGSIPYDIGNLINLQKLILDQNMLSGPLPTSLGKLLNLRYLS 415

Query: 241 LFRNFLQGSIPPSLGNLTKLADLALSFNNLQGNIPSSLGNCQNLISFRASHNKLTGALPY 300
           LF N L G IP  +GN+T L  L LS N  +G +P+SLGNC +L+      NKL G +P 
Sbjct: 416 LFSNRLSGGIPAFIGNMTMLETLDLSNNGFEGIVPTSLGNCSHLLELWIGDNKLNGTIPL 475

Query: 301 QLLSITTLSLYLDLSYNLLNGSLP 324
           +++ I  L L LD+S N L GSLP
Sbjct: 476 EIMKIQQL-LRLDMSGNSLIGSLP 498

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function description
>sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 Back     alignment and function description
>sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=2 SV=1 Back     alignment and function description
>sp|O22938|Y2182_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 OS=Arabidopsis thaliana GN=At2g41820 PE=1 SV=1 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query367
255553269 2793 receptor-kinase, putative [Ricinus commu 0.885 0.116 0.498 5e-73
359482058 1040 PREDICTED: probable LRR receptor-like se 0.863 0.304 0.472 2e-70
357484501 1006 Kinase-like protein [Medicago truncatula 0.885 0.323 0.466 9e-70
147853780 1904 hypothetical protein VITISV_030954 [Viti 0.822 0.158 0.469 1e-69
357484467 1030 Kinase-like protein [Medicago truncatula 0.885 0.315 0.463 1e-68
357505893 1003 Receptor kinase-like protein [Medicago t 0.850 0.311 0.453 5e-68
449440271 1343 PREDICTED: LOW QUALITY PROTEIN: putative 0.880 0.240 0.456 5e-67
449483700 1343 PREDICTED: LOW QUALITY PROTEIN: putative 0.880 0.240 0.456 6e-67
357484195 1032 Receptor kinase-like protein [Medicago t 0.869 0.309 0.468 2e-66
449483698 1099 PREDICTED: probable LRR receptor-like se 0.839 0.280 0.448 3e-66
>gi|255553269|ref|XP_002517677.1| receptor-kinase, putative [Ricinus communis] gi|223543309|gb|EEF44841.1| receptor-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  281 bits (718), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 163/327 (49%), Positives = 213/327 (65%), Gaps = 2/327 (0%)

Query: 1   QLPDFIGNLSALGILLIRWNSLGGQIPTTLGLLRNLVYLNVAENQFSGMFPRWICNISSL 60
           ++P  +GNLS+L I    +NSL G IP  +G L +L    V  NQ SG+ P  I N SS+
Sbjct: 312 EIPASLGNLSSLTIFQATYNSLVGNIPQEMGRLTSLTVFGVGANQLSGIIPPSIFNFSSV 371

Query: 61  ELIYLTVNRFSGSLPFDILVNLPNLKELGVGGNNFVGSIPDSLSNASNLERLDLPGNQFK 120
             +  T N+ + SLP +I  +LPNL   G+G NN  GSIP+SL NAS LE +DL  N F 
Sbjct: 372 TRLLFTQNQLNASLPDNI--HLPNLTFFGIGDNNLFGSIPNSLFNASRLEIIDLGWNYFN 429

Query: 121 GKVSIDFSSLKNLWWLNLEQNNLGMGTANDLDFVTSLTNCSSLKSLSLYDNQFGGELPHS 180
           G+V I+  SLKNLW + L  NNLG  +++DL F+TSL NC+ L+ L    N FGG LP+S
Sbjct: 430 GQVPINIGSLKNLWRIRLHGNNLGSNSSSDLAFLTSLNNCTKLRILDFGRNNFGGVLPNS 489

Query: 181 IANLSSTMIQFSIGGNQISGTIPPGIRNLVNLVALTMDSNQLHGTIPDVIGELKNLQVLF 240
           +ANLS+ +  F  G NQI G IP G+ NL+NLV L M  N   G +P   G+ + LQVL 
Sbjct: 490 VANLSTELSLFYFGRNQIRGIIPAGLENLINLVGLVMHYNLFTGVVPSYFGKFQKLQVLD 549

Query: 241 LFRNFLQGSIPPSLGNLTKLADLALSFNNLQGNIPSSLGNCQNLISFRASHNKLTGALPY 300
           LF N L G IP SLGNLT L+ L LS N  +G+IPSS+GN +NL +   SHNKLTGA+P+
Sbjct: 550 LFGNRLSGRIPSSLGNLTGLSMLYLSRNLFEGSIPSSIGNLKNLNTLAISHNKLTGAIPH 609

Query: 301 QLLSITTLSLYLDLSYNLLNGSLPLQM 327
           ++L +T+LS  LDLS N L G+LP ++
Sbjct: 610 EILGLTSLSQALDLSQNSLTGNLPPEI 636

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359482058|ref|XP_002274540.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357484501|ref|XP_003612538.1| Kinase-like protein [Medicago truncatula] gi|355513873|gb|AES95496.1| Kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|147853780|emb|CAN83822.1| hypothetical protein VITISV_030954 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357484467|ref|XP_003612521.1| Kinase-like protein [Medicago truncatula] gi|355513856|gb|AES95479.1| Kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357505893|ref|XP_003623235.1| Receptor kinase-like protein [Medicago truncatula] gi|355498250|gb|AES79453.1| Receptor kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449440271|ref|XP_004137908.1| PREDICTED: LOW QUALITY PROTEIN: putative receptor-like protein kinase At3g47110-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449483700|ref|XP_004156664.1| PREDICTED: LOW QUALITY PROTEIN: putative receptor-like protein kinase At3g47110-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357484195|ref|XP_003612385.1| Receptor kinase-like protein [Medicago truncatula] gi|355513720|gb|AES95343.1| Receptor kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449483698|ref|XP_004156663.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query367
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.817 0.297 0.425 1.7e-67
TAIR|locus:2075661 1025 AT3G47110 [Arabidopsis thalian 0.820 0.293 0.418 8e-67
TAIR|locus:2079157 1011 AT3G47580 [Arabidopsis thalian 0.814 0.295 0.391 6.8e-62
TAIR|locus:2075631 1009 AT3G47090 [Arabidopsis thalian 0.814 0.296 0.397 1.5e-60
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.814 0.290 0.404 6.2e-59
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.814 0.291 0.371 1e-54
UNIPROTKB|O24435 813 O24435 "Receptor kinase-like p 0.817 0.369 0.393 8.2e-52
TAIR|locus:2047525 980 AT2G24130 [Arabidopsis thalian 0.814 0.305 0.362 7.1e-48
TAIR|locus:2181042 967 AT5G01890 [Arabidopsis thalian 0.801 0.304 0.345 2.6e-40
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.787 0.246 0.365 3e-40
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 606 (218.4 bits), Expect = 1.7e-67, Sum P(2) = 1.7e-67
 Identities = 128/301 (42%), Positives = 181/301 (60%)

Query:     1 QLPDFIGNLSALGILLIRWNSLGGQIPTTLGLLRNLVYLNVAENQFSGMFPRWICNISSL 60
             +LP  +GNL+ L  L +  N+L G+IP+ +  L  +  L +  N FSG+FP  + N+SSL
Sbjct:   177 KLPTSLGNLTLLEQLALSHNNLEGEIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSSL 236

Query:    61 ELIYLTVNRFSGSLPFDILVNLPNLKELGVGGNNFVGSIPDSLSNASNLERLDLPGNQFK 120
             +L+ +  N FSG L  D+ + LPNL    +GGN F GSIP +LSN S LERL +  N   
Sbjct:   237 KLLGIGYNHFSGRLRPDLGILLPNLLSFNMGGNYFTGSIPTTLSNISTLERLGMNENNLT 296

Query:   121 GKVSIDFSSXXXXXXXXXXXXXXGMGTANDLDFVTSLTNCSSLKSLSLYDNQFGGELPHS 180
             G +   F +              G  ++ DL+F+TSLTNC+ L++L +  N+ GG+LP S
Sbjct:   297 GSIPT-FGNVPNLKLLFLHTNSLGSDSSRDLEFLTSLTNCTQLETLGIGRNRLGGDLPIS 355

Query:   181 IANLSSTMIQFSIGGNQISGTIPPGIRNLVNLVALTMDSNQLHGTIPDVIGELKNLQVLF 240
             IANLS+ ++   +GG  ISG+IP  I NL+NL  L +D N L G +P  +G+L NL+ L 
Sbjct:   356 IANLSAKLVTLDLGGTLISGSIPYDIGNLINLQKLILDQNMLSGPLPTSLGKLLNLRYLS 415

Query:   241 LFRNFLQGSIPPSLGNLTKLADLALSFNNLQGNIPSSLGNCQNLISFRASHNKLTGALPY 300
             LF N L G IP  +GN+T L  L LS N  +G +P+SLGNC +L+      NKL G +P 
Sbjct:   416 LFSNRLSGGIPAFIGNMTMLETLDLSNNGFEGIVPTSLGNCSHLLELWIGDNKLNGTIPL 475

Query:   301 Q 301
             +
Sbjct:   476 E 476
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075631 AT3G47090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2047525 AT2G24130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181042 AT5G01890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query367
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-47
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-46
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-41
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-40
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-39
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-20
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  172 bits (438), Expect = 1e-47
 Identities = 116/325 (35%), Positives = 173/325 (53%), Gaps = 12/325 (3%)

Query: 1   QLPDFIGNLSALGILLIRWNSLGGQIPTTLGLLRNLVYLNVAENQFSGMFPRWICNISSL 60
            +P  +GNL  L  L +  N L G IP ++  L+ L+ L++++N  SG  P  +  + +L
Sbjct: 251 PIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNL 310

Query: 61  ELIYLTVNRFSGSLPFDILVNLPNLKELGVGGNNFVGSIPDSLSNASNLERLDLPGNQFK 120
           E+++L  N F+G +P   L +LP L+ L +  N F G IP +L   +NL  LDL  N   
Sbjct: 311 EILHLFSNNFTGKIP-VALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLT 369

Query: 121 GKVSIDFSSLKNLWWLNLEQNNLGMGTANDLDFVTSLTNCSSLKSLSLYDNQFGGELPHS 180
           G++     S  NL+ L L  N+L      + +   SL  C SL+ + L DN F GELP  
Sbjct: 370 GEIPEGLCSSGNLFKLILFSNSL------EGEIPKSLGACRSLRRVRLQDNSFSGELPSE 423

Query: 181 IANLSSTMIQF-SIGGNQISGTIPPGIRNLVNLVALTMDSNQLHGTIPDVIGELKNLQVL 239
              L   ++ F  I  N + G I     ++ +L  L++  N+  G +PD  G  K L+ L
Sbjct: 424 FTKLP--LVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGS-KRLENL 480

Query: 240 FLFRNFLQGSIPPSLGNLTKLADLALSFNNLQGNIPSSLGNCQNLISFRASHNKLTGALP 299
            L RN   G++P  LG+L++L  L LS N L G IP  L +C+ L+S   SHN+L+G +P
Sbjct: 481 DLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIP 540

Query: 300 YQLLSITTLSLYLDLSYNLLNGSLP 324
                +  LS  LDLS N L+G +P
Sbjct: 541 ASFSEMPVLSQ-LDLSQNQLSGEIP 564

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 367
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.92
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.82
KOG4237498 consensus Extracellular matrix protein slit, conta 99.81
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.5
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.44
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.21
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.2
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.19
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.15
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
PLN03150623 hypothetical protein; Provisional 99.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.09
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.06
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.0
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.99
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.96
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.96
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.95
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.94
PLN03150623 hypothetical protein; Provisional 98.88
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.87
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.81
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.79
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.76
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.75
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.67
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.64
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.63
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.44
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.37
KOG4341483 consensus F-box protein containing LRR [General fu 98.35
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.32
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.28
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.26
KOG4341483 consensus F-box protein containing LRR [General fu 98.11
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.07
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.05
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.0
PRK15386426 type III secretion protein GogB; Provisional 97.96
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.91
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.9
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.87
PRK15386426 type III secretion protein GogB; Provisional 97.81
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.67
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.36
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.23
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.18
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.16
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.77
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.56
KOG4308478 consensus LRR-containing protein [Function unknown 95.62
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.59
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.57
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.44
KOG4308478 consensus LRR-containing protein [Function unknown 94.13
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.69
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.3
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 92.05
smart0037026 LRR Leucine-rich repeats, outliers. 91.38
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.38
KOG0473 326 consensus Leucine-rich repeat protein [Function un 84.67
KOG0473 326 consensus Leucine-rich repeat protein [Function un 83.17
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.1e-35  Score=300.84  Aligned_cols=325  Identities=32%  Similarity=0.549  Sum_probs=194.8

Q ss_pred             CCchhccCCCCcEEEccCcccCCCCccccCCCCCCcEEEccCccccCCcchhccCCCCcceeecccccccccCChhhhhC
Q 048828            2 LPDFIGNLSALGILLIRWNSLGGQIPTTLGLLRNLVYLNVAENQFSGMFPRWICNISSLELIYLTVNRFSGSLPFDILVN   81 (367)
Q Consensus         2 l~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~i~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~   81 (367)
                      +|..++++++|++|++++|.+.+..|..+..+++|++|++++|.+.+..|..+.++++|++|++++|.+.+.+|..+ ..
T Consensus       204 ~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l-~~  282 (968)
T PLN00113        204 IPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSI-FS  282 (968)
T ss_pred             CChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhH-hh
Confidence            56667777777777777777776677777777777777777777766677777777777777777777665555443 46


Q ss_pred             CCCccEEEccCCcceeeCcccccCCCCCcEEeCCCCcccccccccccCCCCCCeEEcCCCcccCcCCCCCccccccCCCC
Q 048828           82 LPNLKELGVGGNNFVGSIPDSLSNASNLERLDLPGNQFKGKVSIDFSSLKNLWWLNLEQNNLGMGTANDLDFVTSLTNCS  161 (367)
Q Consensus        82 ~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~  161 (367)
                      +++|++|++++|.+...+|..+.++++|++|++++|.+.+..+..+..+++|++|++++|.+....+      ..+..++
T Consensus       283 l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p------~~l~~~~  356 (968)
T PLN00113        283 LQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIP------KNLGKHN  356 (968)
T ss_pred             ccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCC------hHHhCCC
Confidence            6677777777666665566666666666666666666655555555566666666666555442211      1222223


Q ss_pred             CCcEEEcccCcc------------------------ccccChhhhhhcccceEEEecCCcccccCCcccc----------
Q 048828          162 SLKSLSLYDNQF------------------------GGELPHSIANLSSTMIQFSIGGNQISGTIPPGIR----------  207 (367)
Q Consensus       162 ~L~~L~l~~~~~------------------------~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~l~----------  207 (367)
                      +|+.|++++|.+                        .+..|..+..+.. ++.+++++|.+.+..|..+.          
T Consensus       357 ~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~-L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L  435 (968)
T PLN00113        357 NLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRS-LRRVRLQDNSFSGELPSEFTKLPLVYFLDI  435 (968)
T ss_pred             CCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCC-CCEEECcCCEeeeECChhHhcCCCCCEEEC
Confidence            333333333332                        2222222222221 44444444444333333333          


Q ss_pred             --------------CCCCCcEEEccCCcccccccccccCccCCcEEEccCccccccCCccccCCCCCCeEEccCCeeccc
Q 048828          208 --------------NLVNLVALTMDSNQLHGTIPDVIGELKNLQVLFLFRNFLQGSIPPSLGNLTKLADLALSFNNLQGN  273 (367)
Q Consensus       208 --------------~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~~~i~~~~~~~l~~~~~L~~L~l~~n~i~~~  273 (367)
                                    .+++|+.|++++|.+.+..|..+ ..++|+.|++++|++++..|..+..+++|+.|++++|.+.+.
T Consensus       436 s~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~  514 (968)
T PLN00113        436 SNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGE  514 (968)
T ss_pred             cCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceee
Confidence                          34444444444444433333322 234566666666666655666666677777777777777766


Q ss_pred             cCcccccCCCCcEEEcCCCcccCCcchhhhhhcccceeEeccCCeeeeccCccccCCCCCCCC
Q 048828          274 IPSSLGNCQNLISFRASHNKLTGALPYQLLSITTLSLYLDLSYNLLNGSLPLQMFTGRRPTDS  336 (367)
Q Consensus       274 ~~~~~~~~~~L~~L~l~~n~i~~~~~~~~~~~~~ll~~L~l~~n~i~~~~p~~~~~~~~~~~~  336 (367)
                      .|..+..+++|+.|++++|.+++.+|..+..++.+ ++|++++|.+++.+|..+.....+..+
T Consensus       515 ~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L-~~L~Ls~N~l~~~~p~~l~~l~~L~~l  576 (968)
T PLN00113        515 IPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVL-SQLDLSQNQLSGEIPKNLGNVESLVQV  576 (968)
T ss_pred             CChHHcCccCCCEEECCCCcccccCChhHhCcccC-CEEECCCCcccccCChhHhcCcccCEE
Confidence            77777777777777777777777777777777666 777777777777777776665554444

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query367
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-30
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-30
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-12
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 8e-10
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 9e-10
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 1e-09
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 5e-09
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 6e-09
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 7e-09
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 1e-08
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score =  130 bits (327), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 108/315 (34%), Positives = 147/315 (46%), Gaps = 36/315 (11%)
Query: 12  LGILLIRWNSLGGQIPTTLGLLRNLVYLNVAENQFSGMFPRWICNISSLELIYLTVNRFS 71
           L  L +  N+    IP  LG    L +L+++ N+ SG F R I   + L+L+ ++ N+F 
Sbjct: 202 LEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFV 260
Query: 72  GSLPFDILVNLPNLKELGVGGNNFVGSIPDSLSNASN-LERLDLPGNQFKGKVSIDFSSX 130
           G +P    + L +L+ L +  N F G IPD LS A + L  LDL GN F G V   F S 
Sbjct: 261 GPIP---PLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSC 317
Query: 131 XXXXXXXXXXXXXGMGTANDLDFVTSLTNCSSLKSLSLYDNQFGGELPHSIANLSSTMIQ 190
                              D     +L     LK L L  N+F GELP S+ NLS++++ 
Sbjct: 318 SLLESLALSSNNFSGELPMD-----TLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLT 372
Query: 191 FSIGGNQISG--------------------------TIPPGIRNLVNLVALTMDSNQLHG 224
             +  N  SG                           IPP + N   LV+L +  N L G
Sbjct: 373 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG 432
Query: 225 TIPDVIGELKNLQVLFLFRNFLQGSIPPSLGNLTKLADLALSFNNLQGNIPSSLGNCQNL 284
           TIP  +G L  L+ L L+ N L+G IP  L  +  L  L L FN+L G IPS L NC NL
Sbjct: 433 TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNL 492
Query: 285 ISFRASHNKLTGALP 299
                S+N+LTG +P
Sbjct: 493 NWISLSNNRLTGEIP 507
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query367
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-80
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-75
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-73
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-70
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-68
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-62
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-39
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-60
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-59
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-53
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-46
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-45
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-42
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-45
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-45
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-42
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-42
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-39
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-38
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-45
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-45
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-41
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-40
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-37
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-43
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-39
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-33
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-32
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-27
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-39
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-34
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-22
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-36
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-34
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-25
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-27
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-27
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-27
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-27
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-27
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-22
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-16
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-15
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-22
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-18
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-20
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-12
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 7e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-16
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-14
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-13
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 9e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  259 bits (665), Expect = 3e-80
 Identities = 113/323 (34%), Positives = 160/323 (49%), Gaps = 12/323 (3%)

Query: 5   FIGNLSALGILLIRWNSLGGQIPTTLGLLRNLVYLNVAENQFSGMFPRWICNISSLELIY 64
           F+G+ SAL  L I  N L G     +     L  LN++ NQF G  P       SL+ + 
Sbjct: 218 FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPL--KSLQYLS 275

Query: 65  LTVNRFSGSLPFDILVNLPNLKELGVGGNNFVGSIPDSLSNASNLERLDLPGNQFKGKVS 124
           L  N+F+G +P  +      L  L + GN+F G++P    + S LE L L  N F G++ 
Sbjct: 276 LAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELP 335

Query: 125 ID-FSSLKNLWWLNLEQNNLGMGTANDLDFVTSLTNCS-SLKSLSLYDNQFGGELPHSIA 182
           +D    ++ L  L+L  N    G         SLTN S SL +L L  N F G +  ++ 
Sbjct: 336 MDTLLKMRGLKVLDLSFNEF-SGE-----LPESLTNLSASLLTLDLSSNNFSGPILPNLC 389

Query: 183 NLSSTMIQ-FSIGGNQISGTIPPGIRNLVNLVALTMDSNQLHGTIPDVIGELKNLQVLFL 241
                 +Q   +  N  +G IPP + N   LV+L +  N L GTIP  +G L  L+ L L
Sbjct: 390 QNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKL 449

Query: 242 FRNFLQGSIPPSLGNLTKLADLALSFNNLQGNIPSSLGNCQNLISFRASHNKLTGALPYQ 301
           + N L+G IP  L  +  L  L L FN+L G IPS L NC NL     S+N+LTG +P  
Sbjct: 450 WLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKW 509

Query: 302 LLSITTLSLYLDLSYNLLNGSLP 324
           +  +  L+  L LS N  +G++P
Sbjct: 510 IGRLENLA-ILKLSNNSFSGNIP 531
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query367
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.77
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.73
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.59
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.58
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.57
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.51
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.42
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.41
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.41
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.39
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.35
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.3
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.19
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.16
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.02
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.97
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.71
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.58
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.57
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.22
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.92
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.67
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.44
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.15
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 85.41
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 80.68
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-39  Score=320.32  Aligned_cols=341  Identities=32%  Similarity=0.485  Sum_probs=179.0

Q ss_pred             CchhccCCCCcEEEccCcccCCCCccc-cCCCCCCcEEEccCccccCCcchhccCCC-CcceeecccccccccCChhhhh
Q 048828            3 PDFIGNLSALGILLIRWNSLGGQIPTT-LGLLRNLVYLNVAENQFSGMFPRWICNIS-SLELIYLTVNRFSGSLPFDILV   80 (367)
Q Consensus         3 ~~~~~~~~~L~~L~l~~~~~~~~~~~~-~~~~~~L~~L~l~~~~i~~~~~~~~~~l~-~L~~L~l~~~~~~~~~~~~~~~   80 (367)
                      |..|+++++|++|++++|.+.+.+|.. +..+++|++|++++|.+.+..|..+..++ +|++|++++|.+.+.++..+..
T Consensus       311 p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~  390 (768)
T 3rgz_A          311 PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQ  390 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTC
T ss_pred             chHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhh
Confidence            344444444444444444444333332 44444444444444444434444443333 3444444444433333222211


Q ss_pred             -CCCCccEEEccCCcceeeCcccccCCCCCcEEeCCCCcccccccccccCCCCCCeEEcCCCcccCcCCCCC--------
Q 048828           81 -NLPNLKELGVGGNNFVGSIPDSLSNASNLERLDLPGNQFKGKVSIDFSSLKNLWWLNLEQNNLGMGTANDL--------  151 (367)
Q Consensus        81 -~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~--------  151 (367)
                       .+++|++|++++|.+...+|..+.++++|++|++++|.+.+..|..+..+++|++|++++|.+....+..+        
T Consensus       391 ~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~  470 (768)
T 3rgz_A          391 NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLET  470 (768)
T ss_dssp             STTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCE
T ss_pred             cccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceE
Confidence             13455555555555555555566666666666666666655555555566666666666555543222100        


Q ss_pred             ----------ccccccCCCCCCcEEEcccCccccccChhhhhhcccceEEEecCCcccccCCccccCCCCCcEEEccCCc
Q 048828          152 ----------DFVTSLTNCSSLKSLSLYDNQFGGELPHSIANLSSTMIQFSIGGNQISGTIPPGIRNLVNLVALTMDSNQ  221 (367)
Q Consensus       152 ----------~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~l~~~~~L~~L~l~~n~  221 (367)
                                ..+..+..+++|++|++++|.+.+.+|..+..++. |+.|++++|.+.+..|..+..+++|+.|++++|.
T Consensus       471 L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~-L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~  549 (768)
T 3rgz_A          471 LILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLEN-LAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNL  549 (768)
T ss_dssp             EECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTT-CCEEECCSSCCEEECCGGGGGCTTCCEEECCSSE
T ss_pred             EEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCC-CCEEECCCCcccCcCCHHHcCCCCCCEEECCCCc
Confidence                      11123444555555555555555555555544443 5555555555555555555556666666666555


Q ss_pred             cccccccc----------------------------------------------------------------------cc
Q 048828          222 LHGTIPDV----------------------------------------------------------------------IG  231 (367)
Q Consensus       222 ~~~~~~~~----------------------------------------------------------------------~~  231 (367)
                      +++..|..                                                                      +.
T Consensus       550 l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~  629 (768)
T 3rgz_A          550 FNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFD  629 (768)
T ss_dssp             EESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCS
T ss_pred             cCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhh
Confidence            54333321                                                                      12


Q ss_pred             CccCCcEEEccCccccccCCccccCCCCCCeEEccCCeeccccCcccccCCCCcEEEcCCCcccCCcchhhhhhccccee
Q 048828          232 ELKNLQVLFLFRNFLQGSIPPSLGNLTKLADLALSFNNLQGNIPSSLGNCQNLISFRASHNKLTGALPYQLLSITTLSLY  311 (367)
Q Consensus       232 ~~~~L~~L~l~~~~i~~~~~~~l~~~~~L~~L~l~~n~i~~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~~~~~~ll~~  311 (367)
                      .+++|+.|++++|++++.+|..++.++.|+.|++++|.+++.+|..+..+++|+.|++++|+++|.+|..+..+..+ ++
T Consensus       630 ~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L-~~  708 (768)
T 3rgz_A          630 NNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTML-TE  708 (768)
T ss_dssp             SSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCC-SE
T ss_pred             ccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCC-CE
Confidence            23456666666666666666666666666666666666666666666666666666666666666666666666655 66


Q ss_pred             EeccCCeeeeccCccccCCCCCCCCCcCCccchhh
Q 048828          312 LDLSYNLLNGSLPLQMFTGRRPTDSAFTEGLTLHE  346 (367)
Q Consensus       312 L~l~~n~i~~~~p~~~~~~~~~~~~~~~~~~~l~~  346 (367)
                      |++++|+++|.+|..- .........|.++..+..
T Consensus       709 L~ls~N~l~g~iP~~~-~~~~~~~~~~~gN~~Lcg  742 (768)
T 3rgz_A          709 IDLSNNNLSGPIPEMG-QFETFPPAKFLNNPGLCG  742 (768)
T ss_dssp             EECCSSEEEEECCSSS-SGGGSCGGGGCSCTEEES
T ss_pred             EECcCCcccccCCCch-hhccCCHHHhcCCchhcC
Confidence            6666666666666531 111222333445544544
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 367
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-12
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-09
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 77.0 bits (188), Expect = 3e-16
 Identities = 57/244 (23%), Positives = 87/244 (35%), Gaps = 23/244 (9%)

Query: 49  MFPRWICNISSLELIYLTVNRFSGSLPFDILVNLPNLKELGVGGNNFVGSIPDSLSNASN 108
                +  +++L  +       +      +L  L NL+ L    N      P      +N
Sbjct: 163 NQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLG--ILTN 220

Query: 109 LERLDLPGNQFKGKVSIDFSSLKNLWWLNLEQNNLGMGTANDLDFVTSLTNCSSLKSLSL 168
           L+ L L GNQ K   +   +SL NL  L+L  N +          +  L+  + L  L L
Sbjct: 221 LDELSLNGNQLKDIGT--LASLTNLTDLDLANNQISN--------LAPLSGLTKLTELKL 270

Query: 169 YDNQFGGELPHSIANLSSTMIQFSIGGNQISGTIPPGIRNLVNLVALTMDSNQLHGTIPD 228
             NQ     P     L+      ++  N+        I NL NL  LT+  N +    P 
Sbjct: 271 GANQISNISP-----LAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISP- 324

Query: 229 VIGELKNLQVLFLFRNFLQGSIPPSLGNLTKLADLALSFNNLQGNIPSSLGNCQNLISFR 288
            +  L  LQ LF   N +      SL NLT +  L+   N +    P  L N   +    
Sbjct: 325 -VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP--LANLTRITQLG 379

Query: 289 ASHN 292
            +  
Sbjct: 380 LNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query367
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.75
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.73
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.71
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.66
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.62
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.61
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.59
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.37
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.37
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.46
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.23
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.21
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.02
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.67
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.6
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.95  E-value=3.3e-27  Score=206.08  Aligned_cols=251  Identities=27%  Similarity=0.396  Sum_probs=152.4

Q ss_pred             CCcEEEccCccccC--CcchhccCCCCcceeeccc-ccccccCChhhhhCCCCccEEEccCCcceeeCcccccCCCCCcE
Q 048828           35 NLVYLNVAENQFSG--MFPRWICNISSLELIYLTV-NRFSGSLPFDILVNLPNLKELGVGGNNFVGSIPDSLSNASNLER  111 (367)
Q Consensus        35 ~L~~L~l~~~~i~~--~~~~~~~~l~~L~~L~l~~-~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~  111 (367)
                      +++.|+++++.+.+  .+|..+.++++|++|++++ |.+.|.+|..+ .++++|++|++++|.+....+..+..+.+|++
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i-~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~  129 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAI-AKLTQLHYLYITHTNVSGAIPDFLSQIKTLVT  129 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGG-GGCTTCSEEEEEEECCEEECCGGGGGCTTCCE
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCcccccccccccccccccccccc-ccccccchhhhccccccccccccccchhhhcc
Confidence            46666666666554  2455666666666666654 55555555543 45666666666666666555555666666666


Q ss_pred             EeCCCCcccccccccccCCCCCCeEEcCCCcccCcCCCCCccccccCCCCCCcEEEcccCccccccChhhhhhcccceEE
Q 048828          112 LDLPGNQFKGKVSIDFSSLKNLWWLNLEQNNLGMGTANDLDFVTSLTNCSSLKSLSLYDNQFGGELPHSIANLSSTMIQF  191 (367)
Q Consensus       112 L~l~~n~l~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~l  191 (367)
                      +++++|.+....|..+..++++++++++                              +|.+.+.+|..+......++.+
T Consensus       130 l~l~~N~~~~~~p~~l~~l~~L~~l~l~------------------------------~n~l~~~ip~~~~~l~~l~~~l  179 (313)
T d1ogqa_         130 LDFSYNALSGTLPPSISSLPNLVGITFD------------------------------GNRISGAIPDSYGSFSKLFTSM  179 (313)
T ss_dssp             EECCSSEEESCCCGGGGGCTTCCEEECC------------------------------SSCCEEECCGGGGCCCTTCCEE
T ss_pred             cccccccccccCchhhccCcccceeecc------------------------------cccccccccccccccccccccc
Confidence            6666665555555445444444444444                              4444444444444443333455


Q ss_pred             EecCCcccccCCccccCCCCCcEEEccCCcccccccccccCccCCcEEEccCccccccCCccccCCCCCCeEEccCCeec
Q 048828          192 SIGGNQISGTIPPGIRNLVNLVALTMDSNQLHGTIPDVIGELKNLQVLFLFRNFLQGSIPPSLGNLTKLADLALSFNNLQ  271 (367)
Q Consensus       192 ~l~~~~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~~~i~~~~~~~l~~~~~L~~L~l~~n~i~  271 (367)
                      .++.|++.+..+..+..+.. ..+++..+...+..+..+..+++++.++++++.+.+.++ .+..+++|+.|++++|.++
T Consensus       180 ~~~~n~l~~~~~~~~~~l~~-~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~  257 (313)
T d1ogqa_         180 TISRNRLTGKIPPTFANLNL-AFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIY  257 (313)
T ss_dssp             ECCSSEEEEECCGGGGGCCC-SEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCE
T ss_pred             cccccccccccccccccccc-ccccccccccccccccccccccccccccccccccccccc-ccccccccccccCccCeec
Confidence            55555555455554544433 356666666666666666667777777777777764433 4556677777777777777


Q ss_pred             cccCcccccCCCCcEEEcCCCcccCCcchhhhhhcccceeEeccCCeee
Q 048828          272 GNIPSSLGNCQNLISFRASHNKLTGALPYQLLSITTLSLYLDLSYNLLN  320 (367)
Q Consensus       272 ~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~~~~~~ll~~L~l~~n~i~  320 (367)
                      +.+|..+.++++|++|+|++|+++|.+|+ +..+..+ +.+++++|+..
T Consensus       258 g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L-~~l~l~~N~~l  304 (313)
T d1ogqa_         258 GTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRF-DVSAYANNKCL  304 (313)
T ss_dssp             ECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGS-CGGGTCSSSEE
T ss_pred             ccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCC-CHHHhCCCccc
Confidence            77777777777777777777777777774 3455555 77777777643
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure