Citrus Sinensis ID: 048829


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970------
REKTGEDLGLEIFKELHSRSFFQQSSNDASRFVMHDLINDLAHWAAGEIYFTMEYTSEVNKQQSFSRYLRHLSYIPEYYVGGKRFGDLYDIQHLRTFLPVMLTDSSPGYLAPSILPKLLKLQRLRVFSLRGYHISELPDSVGDLRYLRYLNLSGTNIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLIKLHHLNNSNTDSLEETPLGIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHLRGALEISKLENVKDVGNAKEARLDGKKNLKELLLRWTRSTDGSSSREAETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLKHLTVRGVSRVKRLGSEFYGDDSPIPFPCLETLRFEDLQEWEVWISHGSGQGVEGFPKLRELHILECPKLRGTFPEHLPVLEMLVIEGCEELLVSVLSLPALCKFLIGGCKKVVWESATGHLGSQNSVVCRDTSNQSHDGLLQDICSLKSLEIRGCPKLQSLVAEEEKDQQQQLCELSCRLEYLRLRYCEGLVKLPQSSLSLSSLKEIEIYKCSSLVSFPEVALPSKLKKIEIRECDALKSLPEPWMCDTSSSLEILKIWDCHSLTYIAEVQLPLSLKRLDIQRCNKIRTLTVEEGIQSSSSRRYTSSLLENLAISSCPSLTCIFSKNELPATLESLEVGNLPPSVKVLDVYGCPKLESIAERLDNNTSLETINISNCENLKILSSGLHNLCQLQQIGIGGCGNLESFPEGGLPCAKLRRLEIYDCKRLEALPKGLHNLTSLQQLTIIGGELPSLEEDGLPTNLHSLRIEGNMGIWKSMIERGRGFHRFSSLRYLLIRGCDDDMVSFPPEPEDRRLGTTLPLPASLTSLSIAFFPNLESLSSSIVDLQNLTKLTLYDCPKLKYFPEKGLPSSLLQLRIYRCPLIEEKCRKDGGQYWDLLTHIPYARIAGKWVFNDDSTKED
cccHHHHHHHHHHHHHHHcccccEEccccccEEEcHHHHHHHHHHHHccEEEEEEccccccccccccccEEEEEEcccccccccccccccccccEEEEEccccccccccccccHHHHHcccccEEEEEccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccHHHccccccccEEEcccccccccccccccccccccccccEEEcccccccHHHHccccccccEEEEcccccccccHHHHHHccccccccccEEEEEcccccccccccHHHHHHHccccccccccccEEEEEcccccccccccccccccEEEEEEEccccccccccccccccccEEEEccccccEEEcccccccccccccccccEEEEcccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccccccccEEEEccccccEEcccccccccccEEEEcccccccccccccccccccEEEEEccccccEEcHHHHHHHHHHHHcccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEccccccccccccccccccccccEEEEEccccccccccccccccccEEEEEccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEccccccccccccccccccccEEEEEcccccccccccccccccEEEEEcccccccHHHcccccccccccccEEEEEcccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEEccHHHHHHHcccccccccccccccEEEEccEEEEEccccccc
ccccHHHHHHHHHHHHHHHHHHccccccccEEEHHHHHHHHHHHHcccEEEEEcccccccccccccccEEEEEEEccccccccccccHHcHHcccEEEEccccccccccHHHHHHHHHHHHcEEEEEEEcccccccccccHccccHEEEEEcccccHcccccHHHHHHHHHHHHHcccHHHHHccHHHHccccccEEEccccccHHcccccccccHcccEccEEEEcccccccHHHHHcHHHcccEEEEccccccccHHHHHHHHHHccccccEEEEEEccccccccccccccHHHHHHHcccccccEEEEEEccccccccccccccccHHcEEEEEcccccccccccccccccccEEEEcccccEEEccHHHcccccccccccccEEEEcccHHHHHcccccccccccccccccEEEEcccHHHHcccccccccccEEEEcccccccccccccccccEEEEEccccccccccccccHHcEEEEccccccccccccccccccccEEEEccccccEEcccHcccccccccccccccccEEEEccccccccccccccccccccEEEEcccccccccccccccccccEEEEcccccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccHcHHHccHHHHHccccccccccccccEEEEccccccccccccccccHHHHHcccccccccccEEEEccccccccccccccccccccEEEEcccccHccccccccccccccEEEEccccccccccccccccccccEEEEcccHHHHcccHHccccccccEEEEccccccccccccccccccEEEEcccHHHHHHHHHcHccccccccccEEEEccccccccccccccccHcccHcccccccccEEEEcccccHHHccccccccccccEEEEcccccHcccccccccccccEEEEcccHHHHHHHHcccccccccEEEccEEEEcccEEEcccccccc
REKTGEDLGLEIFKELhsrsffqqssndaSRFVMHDLINDLAHWAAGEIYFTMEYTSEVNKQQSFSRYLRHLsyipeyyvggkrfgdlyDIQHLRTFLpvmltdsspgylapsilpkLLKLQRLRVFSLrgyhiselpdsvgdlRYLRYLNlsgtnirtlpESVNKLYNLHSLLLEDCDRLKKLCADMGNliklhhlnnsntdsleetplgigkLTCLQTLCNfvvgkdsgsglSELKLLMHLRGaleisklenvkdvgnakeARLDGKKNLKELLLRWTrstdgsssreaetemgvldmlkphknleqfgicgyggtkfptwlgdslfsnlvtlefedcgmctalpsvgqlpslkhltvRGVSRvkrlgsefygddspipfpcletlrfedlQEWEVWIshgsgqgvegfpklrelhilecpklrgtfpehlPVLEMLVIEGCEELLVSVLSLPALCKFLIGGCKKVVWesatghlgsqnsvvcrdtsnqshdgLLQDICSlksleirgcpklqsLVAEEEKDQQQQLCELSCRLEYLRLRYCEGLvklpqsslslsslkeieiykcsslvsfpevalpsklkkIEIRECdalkslpepwmcdtsssleilkiwdchsltyiaevqlplslkrldIQRCNKIRTLTVEegiqssssrrYTSSLLEnlaisscpsltcifsknelpatleslevgnlppsvkvldvygcpklESIAErldnntsletinisncenLKILSSGLHNLCqlqqigiggcgnlesfpegglpcaklrrleiydckrlealpkglhnltSLQQLTIiggelpsleedglptnlhsLRIEGNMGIWKSMIERGRGFHRFSSLRYLLIrgcdddmvsfppepedrrlgttlplpasltslsiaffpnleslsSSIVdlqnltkltlydcpklkyfpekglpsslLQLRIyrcplieekcrkdggqYWDLLTHipyariagkwvfnddstked
REKTGEDLGLEIFKELHSRSFFQQSSNDASRFVMHDLINDLAHWAAGEIYFTMEYTSEVNKQQSFSRYLRHLSYIPEYYVGGKRFGDLYDIQHLRTFLPVMLTDSSPGYLAPSILPKLLKLQRLRVFSLRGyhiselpdsvgdlRYLRYLNLSgtnirtlpeSVNKLYNLHSLLLEDCDRLKKLCADMGNLIKLHHLNNSNTDSLEETPLGIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHLRGAleisklenvkdvgnakearldgkknlkelllrwtrstdgsssreaETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSLFSNLVTLEFEDCGMCTALpsvgqlpslkhltVRGVSRVKRlgsefygddspipfPCLETLRFEDLQEWEVWISHGSGQGVEGFPKLRELHILECPKLRGTFPEHLPVLEMLVIEGCEELLVSVLSLPALCKFLIGGCKKVVWESATghlgsqnsvvCRDTSNQSHDGLLQDICSLKSLEIRGCPKLQSLVAEEEKDQQQQLCELSCRLEYLRLRYCEGLVKLPQSSLSLSSLKEIEIYKCSSLVSFPEVALPSKLKKIEIRECDalkslpepwMCDTSSSLEILKIWDCHSLTYIAEVqlplslkrldIQRCNKIRTltveegiqssssrRYTSSLLENLAISSCPSLTCIFSKNELPATLESLEVGNLPPSVKVLDVYGCPKLESIAerldnntslETINISNCENLKILSSGLHNLCQLQQIGIGGCGNLESFPEGGLPCAKLRRLEIYDCKRLEALPKGLHNLTSLQQLTIIGGELPSLEEDGLPTNLHSLRIEGNMGIWKSMIERGRGFHRFSSLRYLLIRGCDDDMVSFPPEPEDRRLGTTLPLPASLTSLSIAFFPNLESLSSSIVDLQNLTKLTLYDCPKLkyfpekglpsslLQLRIYRCPLIEEKCRKDGGQYWDLLTHIPyariagkwvfnddstked
REKTGEDLGLEIFKELHSRSFFQQSSNDASRFVMHDLINDLAHWAAGEIYFTMEYTSEVNKQQSFSRYLRHLSYIPEYYVGGKRFGDLYDIQHLRTFLPVMLTDSSPGYLAPSILPKLLKLQRLRVFSLRGYHISELPDSVGDLRYLRYLNLSGTNIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLIKLHHLNNSNTDSLEETPLGIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHLRGALEISKLENVKDVGNAKEARLDGKKNLKELLLRWTRSTDGSSSREAETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLKHLTVRGVSRVKRLGSEFYGDDSPIPFPCLETLRFEDLQEWEVWISHGSGQGVEGFPKLRELHILECPKLRGTFPEHLPVLEMLVIEGCEELLVSVLSLPALCKFLIGGCKKVVWESATGHLGSQNSVVCRDTSNQSHDGLLQDICSLKSLEIRGCPKLQSLVAEEEKDQQQQLCELSCRLEYLRLRYCEGLVKLPQsslslsslKEIEIYKCSSLVSFPEVALPSKLKKIEIRECDALKSLPEPWMCDTSSSLEILKIWDCHSLTYIAEVQLPLSLKRLDIQRCNKIRTLTVEEGIQssssrrytssLLENLAISSCPSLTCIFSKNELPATLESLEVGNLPPSVKVLDVYGCPKLESIAERLDNNTSLETINISNCENLKILSSGLHnlcqlqqigiggcgnlESFPEGGLPCAKLRRLEIYDCKRLEALPKGLHNLTSLQQLTIIGGELPSLEEDGLPTNLHSLRIEGNMGIWKSMIERGRGFHRFSSLRYLLIRGCDDDMVSFPPEPEDRRlgttlplpasltslsIAFFPNLESLSSSIVDLQNLTKLTLYDCPKLKYFPEKGLPSSLLQLRIYRCPLIEEKCRKDGGQYWDLLTHIPYARIAGKWVFNDDSTKED
***********IFKEL************ASRFVMHDLINDLAHWAAGEIYFTMEYTSEVNKQQSFSRYLRHLSYIPEYYVGGKRFGDLYDIQHLRTFLPVMLTDSSPGYLAPSILPKLLKLQRLRVFSLRGYHISELPDSVGDLRYLRYLNLSGTNIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLIKLHHLNNSNTDSLEETPLGIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHLRGALEISKLENVKDV**************KELLLRW******************LDMLKPHKNLEQFGICGYGGTKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLKHLTVRGVSRVKRLGSEFYGDDSPIPFPCLETLRFEDLQEWEVWISHGSGQGVEGFPKLRELHILECPKLRGTFPEHLPVLEMLVIEGCEELLVSVLSLPALCKFLIGGCKKVVWESATGHLGSQNSVVCRDT***SHDGLLQDICSLKSLEIRGCPKLQSLV********QQLCELSCRLEYLRLRYCEGLVKLPQSSLSLSSLKEIEIYKCSSLVSFPEVALPSKLKKIEIRECDALKSLPEPWMCDTSSSLEILKIWDCHSLTYIAEVQLPLSLKRLDIQRCNKIRTLTVEEGI*******YTSSLLENLAISSCPSLTCIFSKNELPATLESLEVGNLPPSVKVLDVYGCPKLESIAERLDNNTSLETINISNCENLKILSSGLHNLCQLQQIGIGGCGNLESFPEGGLPCAKLRRLEIYDCKRLEALPKGLHNLTSLQQLTIIGGELPSLEEDGLPTNLHSLRIEGNMGIWKSMIERGRGFHRFSSLRYLLIRGCDDDMVS************TLPLPASLTSLSIAFFPNLESLSSSIVDLQNLTKLTLYDCPKLKYFPEKGLPSSLLQLRIYRCPLIEEKCRKDGGQYWDLLTHIPYARIAGKWVFN*******
*EKTGEDLGLEIFKELHSRSFFQQSSNDASRFVMHDLINDLAHWAAGEIYFTMEYTSE*****SFSRYLRHLSYIPEYYVGGKRFGDLYDIQHLRTFLPVMLTDSSPGYLAPSILPKLLKLQRLRVFSLRGYHISELPDSVGDLRYLRYLNLSGTNIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLIKLHHLNNSNTDSLEETPLGIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHLRGALEISKLENVKDVGNAKEARLDGKKNLKELLLRWTRSTD*******ETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLKHLTVRGVSRVKRLGSEFYGDDSPIPFPCLETLRFEDLQEWEVWISHGSGQGVEGFPKLRELHILECPKLRGTFPEHLPVLEMLVIEGCEELLVSVLSLPALCKFLIGGCKKVVWESATGHLGSQNSVVCRDTSNQSHDGLLQDICSLKSLEIRGCPKLQSLVAEEEKDQQQQLCELSCRLEYLRLRYCEGLVKLPQSSLSLSSLKEIEIYKCSSLVSFPEVALPSKLKKIEIRECDALKSLPEPWMCDTSSSLEILKIWDCHSLTYIAEVQLPLSLKRLDIQRCNKIRTLT**************SSLLENLAISSCPSLTCIFSKNELPATLESLEVGNLPPSVKVLDVYGCPKLESIAERLDNNTSLETINISNCENLKILSSGLHNLCQLQQIGIGGCGNLESFPEGGLPCAKLRRLEIYDCKRLEALPKGLHNLTSLQQLTIIGGELPSLEEDGLPTNLHSLRIEGNMGIWKSMI****GFHRFSSLRYLLIRGCDDDMVSFPPEPEDRRLGTTLPLPASLTSLSIAFFPNLESLSSSIVDLQNLTKLTLYDCPKLKYFPEKGLPSSLLQLRIYRCPLIEEKCRKDGGQYWDLLTHIPYARIAGKWV*********
REKTGEDLGLEIFKELHSRSFFQQSSNDASRFVMHDLINDLAHWAAGEIYFTMEYTSEVNKQQSFSRYLRHLSYIPEYYVGGKRFGDLYDIQHLRTFLPVMLTDSSPGYLAPSILPKLLKLQRLRVFSLRGYHISELPDSVGDLRYLRYLNLSGTNIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLIKLHHLNNSNTDSLEETPLGIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHLRGALEISKLENVKDVGNAKEARLDGKKNLKELLLRWT*************EMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLKHLTVRGVSRVKRLGSEFYGDDSPIPFPCLETLRFEDLQEWEVWISHGSGQGVEGFPKLRELHILECPKLRGTFPEHLPVLEMLVIEGCEELLVSVLSLPALCKFLIGGCKKVVWESATGHLGSQNSVVCRDTSNQSHDGLLQDICSLKSLEIRGCPKLQSLV*********QLCELSCRLEYLRLRYCEGLVKLPQSSLSLSSLKEIEIYKCSSLVSFPEVALPSKLKKIEIRECDALKSLPEPWMCDTSSSLEILKIWDCHSLTYIAEVQLPLSLKRLDIQRCNKIRTLTVE***********TSSLLENLAISSCPSLTCIFSKNELPATLESLEVGNLPPSVKVLDVYGCPKLESIAERLDNNTSLETINISNCENLKILSSGLHNLCQLQQIGIGGCGNLESFPEGGLPCAKLRRLEIYDCKRLEALPKGLHNLTSLQQLTIIGGELPSLEEDGLPTNLHSLRIEGNMGIWKSMIERGRGFHRFSSLRYLLIRGCDDDMVSFPPEPEDRRLGTTLPLPASLTSLSIAFFPNLESLSSSIVDLQNLTKLTLYDCPKLKYFPEKGLPSSLLQLRIYRCPLIEEKCRKDGGQYWDLLTHIPYARIAGKWVFNDDSTKED
***TGEDLGLEIFKELHSRSFFQQSSNDASRFVMHDLINDLAHWAAGEIYFTMEYTSEVNKQQSFSRYLRHLSYIPEYYVGGKRFGDLYDIQHLRTFLPVMLTDSSPGYLAPSILPKLLKLQRLRVFSLRGYHISELPDSVGDLRYLRYLNLSGTNIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLIKLHHLNNSNTDSLEETPLGIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHLRGALEISKLENVKDVGNAKEARLDGKKNLKELLLRWTRSTDGSSSREAETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLKHLTVRGVSRVKRLGSEFYGDDSPIPFPCLETLRFEDLQEWEVWISHGSGQGVEGFPKLRELHILECPKLRGTFPEHLPVLEMLVIEGCEELLVSVLSLPALCKFLIGGCKKVVWESATGHLGSQNSVVCRDTSNQSHDGLLQDICSLKSLEIRGCPKLQSLVAEEEKDQQQQLCELSCRLEYLRLRYCEGLVKLPQSSLSLSSLKEIEIYKCSSLVSFPEVALPSKLKKIEIRECDALKSLPEPWMCDTSSSLEILKIWDCHSLTYIAEVQLPLSLKRLDIQRCNKIRTLTVEEGIQSSSSRRYTSSLLENLAISSCPSLTCIFSKNELPATLESLEVGNLPPSVKVLDVYGCPKLESIAERLDNNTSLETINISNCENLKILSSGLHNLCQLQQIGIGGCGNLESFPEGGLPCAKLRRLEIYDCKRLEALPKGLHNLTSLQQLTIIGGELPSLEEDGLPTNLHSLRIEGNMGIWKSMIERGRGFHRFSSLRYLLIRGCDDDMVSFPPEPEDRRLGTTLPLPASLTSLSIAFFPNLESLSSSIVDLQNLTKLTLYDCPKLKYFPEKGLPSSLLQLRIYRCPLIEEKCRKDGGQYWDLLTHIPYARIAGKWVFNDDS****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
REKTGEDLGLEIFKELHSRSFFQQSSNDASRFVMHDLINDLAHWAAGEIYFTMEYTSEVNKQQSFSRYLRHLSYIPEYYVGGKRFGDLYDIQHLRTFLPVMLTDSSPGYLAPSILPKLLKLQRLRVFSLRGYHISELPDSVGDLRYLRYLNLSGTNIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLIKLHHLNNSNTDSLEETPLGIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHLRGALEISKLENVKDVGNAKEARLDGKKNLKELLLRWTRSTDGSSSREAETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLKHLTVRGVSRVKRLGSEFYGDDSPIPFPCLETLRFEDLQEWEVWISHGSGQGVEGFPKLRELHILECPKLRGTFPEHLPVLEMLVIEGCEELLVSVLSLPALCKFLIGGCKKVVWESATGHLGSQNSVVCRDTSNQSHDGLLQDICSLKSLEIRGCPKLQSLVAEEEKDQQQQLCELSCRLEYLRLRYCEGLVKLPQSSLSLSSLKEIEIYKCSSLVSFPEVALPSKLKKIEIRECDALKSLPEPWMCDTSSSLEILKIWDCHSLTYIAEVQLPLSLKRLDIQRCNKIRTLTVEEGIQSSSSRRYTSSLLENLAISSCPSLTCIFSKNELPATLESLEVGNLPPSVKVLDVYGCPKLESIAERLDNNTSLETINISNCENLKILSSGLHNLCQLQQIGIGGCGNLESFPEGGLPCAKLRRLEIYDCKRLEALPKGLHNLTSLQQLTIIGGELPSLEEDGLPTNLHSLRIEGNMGIWKSMIERGRGFHRFSSLRYLLIRGCDDDMVSFPPEPEDRRLGTTLPLPASLTSLSIAFFPNLESLSSSIVDLQNLTKLTLYDCPKLKYFPEKGLPSSLLQLRIYRCPLIEEKCRKDGGQYWDLLTHIPYARIAGKWVFNDDSTKED
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query976 2.2.26 [Sep-21-2011]
Q9LRR51424 Putative disease resistan yes no 0.929 0.636 0.323 2e-96
Q9LRR41054 Putative disease resistan no no 0.552 0.511 0.360 2e-78
Q7XA42979 Putative disease resistan N/A no 0.493 0.492 0.318 4e-53
Q7XA39988 Putative disease resistan N/A no 0.503 0.496 0.310 7e-51
Q7XA40992 Putative disease resistan N/A no 0.508 0.5 0.314 9e-51
Q7XBQ9970 Disease resistance protei N/A no 0.475 0.478 0.339 1e-50
O23530 1301 Protein SUPPRESSOR OF npr no no 0.390 0.292 0.251 5e-09
P0CB161201 Putative disease resistan no no 0.572 0.465 0.224 1e-07
Q38834852 Disease resistance RPP13- no no 0.255 0.292 0.268 1e-07
Q8W3K3910 Putative disease resistan no no 0.278 0.298 0.303 3e-07
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function desciption
 Score =  354 bits (909), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 329/1016 (32%), Positives = 488/1016 (48%), Gaps = 109/1016 (10%)

Query: 6    EDLGLEIFKELHSRSFFQQSSNDASRFVMHDLINDLAHWAAGEIYFTMEYTSEVNKQQSF 65
            ED+G +   +L ++SFFQ+     + FVMHDL+NDLA   +G+  F +E     +     
Sbjct: 459  EDIGNDYLGDLVAQSFFQRLDITMTSFVMHDLMNDLAKAVSGDFCFRLED----DNIPEI 514

Query: 66   SRYLRHLSYIPEYYVGGKRFGDLYDIQHLRTFLPVMLTDSSPGYLAPSIL------PKLL 119
                RH S+          F  +   + LRT LP     +SP  L    L      P L 
Sbjct: 515  PSTTRHFSFSRSQCDASVAFRSICGAEFLRTILPF----NSPTSLESLQLTEKVLNPLLN 570

Query: 120  KLQRLRVFSLRGYHISELPDSVGDLRYLRYLNLSGTNIRTLPESVNKLYNLHSLLLEDCD 179
             L  LR+ SL  Y I+ LP S+  L+ LRYL+LS T I+ LPE V  L NL +LLL +C 
Sbjct: 571  ALSGLRILSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLLLSNCR 630

Query: 180  RLKKLCADMGNLIKLHHLNNSNTDSLEETPLGIGKLTCLQTLCNFVVGKDSGSGLSELKL 239
             L  L   +  LI L  L+   T  L E P GI KL  LQ L NFV+G+ SG+GL ELK 
Sbjct: 631  DLTSLPKSIAELINLRLLDLVGT-PLVEMPPGIKKLRSLQKLSNFVIGRLSGAGLHELKE 689

Query: 240  LMHLRGALEISKLENVKDVGNAKEARLDGKKNLKELLLRWTRS----TDGSSSREAETEM 295
            L HLRG L IS+L+NV     AK+A L  K  L  L+L+WT        GS +  A  + 
Sbjct: 690  LSHLRGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFVPGSFNALACDQK 749

Query: 296  GVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSL 355
             VL ML+PH +L+ F I  Y G  FP WLGDS F  + ++    C +C +LP VGQLPSL
Sbjct: 750  EVLRMLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLCISLPPVGQLPSL 809

Query: 356  KHLTVRGVSRVKRLGSEFY---GDDSPIPFPCLETLRFEDLQEWEVWISHGSGQGVEGFP 412
            K+L++   + ++++G +F+    +   +PF  L+ L+F  +  W+ WI      G+  FP
Sbjct: 810  KYLSIEKFNILQKVGLDFFFGENNSRGVPFQSLQILKFYGMPRWDEWICPELEDGI--FP 867

Query: 413  KLRELHILECPKLRGTFPEHLPVLEMLVIEGCEELLV---------SVLSLPALCKFLIG 463
             L++L I  CP LR  FPE LP    + I  C    V         S+ ++P      I 
Sbjct: 868  CLQKLIIQRCPSLRKKFPEGLPSSTEVTISDCPLRAVSGGENSFRRSLTNIPE-SPASIP 926

Query: 464  GCKKVVWESATGHLGSQNSVVCR---DTSNQSHDGLLQDICSLKSLEIRGCPKLQSLVAE 520
               +    S TG+  S  S   +    +S+QS+D    D     +  +   PK +     
Sbjct: 927  SMSRRELSSPTGNPKSDASTSAQPGFASSSQSND----DNEVTSTSSLSSLPKDRQ---T 979

Query: 521  EEKDQ-QQQLCELSCRLE---YLRLRYCEGLVKLP--------QSSLSLSSLKEIEIYKC 568
            E+ DQ + QL  L  + E    +  RY   +  +P        ++SL      E  I   
Sbjct: 980  EDFDQYETQLGSLPQQFEEPAVISARYSGYISDIPSTLSPYMSRTSLVPDPKNEGSILPG 1039

Query: 569  SSLVSFPEVALPSKLKKIEIRECDALKSLPEPWMCDTSSSLEILKIWDCHSLTYIAEVQL 628
            SS   + +  + S +     R  +A+K  P  +  D  + +E LK+ D   L     ++L
Sbjct: 1040 SSSYQYHQYGIKSSVPS--PRSSEAIK--PSQYD-DDETDMEYLKVTDISHL-----MEL 1089

Query: 629  PLSLKRLDIQRCNKIRTLTVEEGIQSSSSRRYTSSLLENLAISSCPSLTCIFSKNELPAT 688
            P +L+ L I  C+ + +L   E +  S         L  L I +C SL   F  +  P T
Sbjct: 1090 PQNLQSLHIDSCDGLTSLP--ENLTESYPN------LHELLIIACHSLES-FPGSHPPTT 1140

Query: 689  LESLEVG-----NLPPSVKVLDVYGCPKLESIAERLDNNTS--------LETINISNCEN 735
            L++L +      N   S++    Y   +   I     N  +        L +++I +CE+
Sbjct: 1141 LKTLYIRDCKKLNFTESLQPTRSYSQLEYLFIGSSCSNLVNFPLSLFPKLRSLSIRDCES 1200

Query: 736  LKILS--SGL-HNLCQLQQIGIGGCGNLESFPEGGLPCAKLRRLEIYDCKRLEALPKGLH 792
             K  S  +GL  +   L+ + I  C NLE+FP+GGLP  KL  + + +CK+L+ALP+ L 
Sbjct: 1201 FKTFSIHAGLGDDRIALESLEIRDCPNLETFPQGGLPTPKLSSMLLSNCKKLQALPEKLF 1260

Query: 793  NLTSLQQLTIIG-GELPSLEEDGLPTNLHSLRIEGNMGIWKSMIERGR-GFHRFSSLRYL 850
             LTSL  L II   E+ ++   G P+NL +L I     +   +  R   G     +LR L
Sbjct: 1261 GLTSLLSLFIIKCPEIETIPGGGFPSNLRTLCI----SLCDKLTPRIEWGLRDLENLRNL 1316

Query: 851  LIRGCDDDMVSFPPEPEDRRLGTTLPLPASLTSLSIAFFPNLESLS-SSIVDLQNLTKLT 909
             I G ++D+ SFP E           LP S+ SL I+ F NL++L+     D + +  + 
Sbjct: 1317 EIDGGNEDIESFPEEGL---------LPKSVFSLRISRFENLKTLNRKGFHDTKAIETME 1367

Query: 910  LYDCPKLKYFPEKGLPSSLLQLRIYRCPLIEEKCRKDGGQYWDLLTHIPYARIAGK 965
            +  C KL+   ++ LP  L  LRI  C L+ E   +   +++ +L +IPY  I G+
Sbjct: 1368 ISGCDKLQISIDEDLP-PLSCLRISSCSLLTETFAEVETEFFKVL-NIPYVEIDGE 1421




Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|Q8W3K3|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query976
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.951 0.652 0.431 0.0
400131587 1388 FB_MR5 [Malus x robusta] 0.903 0.635 0.424 1e-178
225449649 1418 PREDICTED: putative disease resistance p 0.929 0.639 0.408 1e-164
356554923 1399 PREDICTED: putative disease resistance R 0.937 0.654 0.398 1e-160
359487225 1373 PREDICTED: putative disease resistance R 0.906 0.644 0.385 1e-153
225450023 1396 PREDICTED: putative disease resistance p 0.901 0.630 0.386 1e-151
451798992 1440 disease resistance protein At3g14460-lik 0.911 0.618 0.379 1e-150
359495024 1390 PREDICTED: putative disease resistance p 0.915 0.643 0.389 1e-150
359487416 1472 PREDICTED: putative disease resistance p 0.903 0.599 0.379 1e-149
359495026 2204 PREDICTED: uncharacterized protein LOC10 0.896 0.397 0.388 1e-148
>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/1000 (43%), Positives = 581/1000 (58%), Gaps = 71/1000 (7%)

Query: 2    EKTGEDLGLEIFKELHSRSFFQQSSNDASRFVMHDLINDLAHWAAGEIYFTMEYTSEVNK 61
            +K  EDLG E F++L SRSFFQQSS++ SRFVMHDLI DLA W AG  YF +E   + N+
Sbjct: 459  DKPMEDLGGEYFRDLLSRSFFQQSSSNKSRFVMHDLITDLAQWVAGISYFRLETKLKGNE 518

Query: 62   QQSFSRYLRHLSYIPEYYVGGKRFGDLYDIQHLRTFLPVMLTDSSPGYLAPSILPKLL-K 120
            Q   S   RHLS++   Y G K+F  + + +HLRTFLP+M       YL+  I+ +LL K
Sbjct: 519  QSKVSSKARHLSFVGSRYDGAKKFEAISEFKHLRTFLPLMAPYVGYSYLSYHIINQLLPK 578

Query: 121  LQRLRVFSLRGYHISELPDSVGDLRYLRYLNLSGTNIRTLPESVNKLYNLHSLLLEDCDR 180
            LQ LRV SL GY I  LP ++GDL++LRYL+LS T +R+LP S++ LYNL +LLLE+C  
Sbjct: 579  LQNLRVLSLSGYRIVYLPQTIGDLKHLRYLDLSCTQLRSLPTSISTLYNLQTLLLENCTS 638

Query: 181  LKKLCADMGNLIKLHHLNNSNTDSLEETPLGIGKLTCLQTLCNFVVGK-DSGSGLSELKL 239
            LK L  D G L  L HLN   ++ LE  PL IG L+ LQTL NFVVGK DS   + EL  
Sbjct: 639  LKFLPPDFGKLFNLRHLNIFGSNLLEGMPLSIGNLSSLQTLSNFVVGKADSFCVIRELGP 698

Query: 240  LMHLRGALEISKLENVKDVGNAKEARLDGKKNLKELLLRWTRSTDGSSSREAETEMGVLD 299
            L+HLRG L ISKLENV     A+++ L GK++L E+++ W  S++ + S++ ET++ VL+
Sbjct: 699  LVHLRGTLCISKLENVTKAQEARDSYLYGKQDLNEVVMEW--SSNLNESQDEETQLEVLN 756

Query: 300  MLKPHKNLEQFGICGYGGTKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLKHLT 359
            ML+P+  L++  +  YGGTKFPTW+GD  FSNLV L FE+C  C +LP VGQLP LK L 
Sbjct: 757  MLQPNVKLKELTVKCYGGTKFPTWIGDPSFSNLVLLRFENCDNCNSLPPVGQLPFLKDLL 816

Query: 360  VRGVSRVKRLGSEFYGDDSPIPFPCLETLRFEDLQEWEVWISHGSGQGVEGFPKLRELHI 419
            ++G++ VK +G EFYG+    PF  LETL FED+  W  WI  G     E F  L +L I
Sbjct: 817  IKGMAGVKSVGREFYGESCSRPFQSLETLHFEDMPRWVNWIPLGVN---EAFACLHKLSI 873

Query: 420  LECPKLRGTFPEHLPVLEMLVIEGCEELLVSVLSLPALCKFLIGGCKKVVWESATGHLGS 479
            + C  L    P+HLP L+ LVI GC  ++VSV +LP LC  +I GCK+V  ES+ G  GS
Sbjct: 874  IRCHNLVRKLPDHLPSLKKLVIHGCWNMVVSVSNLPMLCVLVIEGCKRVECESSVG-FGS 932

Query: 480  QNSVVCRDTS--NQSHDGLLQDICSLKSLEIRGCPKLQSLVAEEEKDQQQQLCELSCRLE 537
              S+     S    +  GL+  +  ++ L+I    KL +L                    
Sbjct: 933  PYSMAFSKISEFGNATAGLMHGVSKVEYLKIVDSEKLTTLWE------------------ 974

Query: 538  YLRLRYCEGLVKLPQSSLSLSSLKEIEIYKCSSLVSFPEVALPSKLKKIEIRECDALKS- 596
                       K+P+    L  L+E+ I  C +LVSFP    PS LK I+I+ C  LKS 
Sbjct: 975  -----------KIPEGLHRLKFLRELSIEDCPTLVSFPASGFPSMLKVIQIKSCSGLKSL 1023

Query: 597  LPEPWMCDTSSS-LEILKIWDCHSLTYIAEVQLPLSLKRLDIQRCNKIRTL-------TV 648
            LPE  +    ++ LE L +  C S+  IA  QLP +LK+L+I  C  ++ +       + 
Sbjct: 1024 LPEGTLHSRENACLERLCVVRCDSMKSIARGQLPTTLKKLEISHCMNLQCVLDEGEGSSS 1083

Query: 649  EEGIQSSSSRRYTSSLLENLAISSCPSLTCIFSKNELPATLESL------------EVGN 696
              G+        + + L+ L I SCPSLT + S  +LPATL  L              G 
Sbjct: 1084 SSGMHDEDINNRSKTHLQYLDIKSCPSLTTLTSSGKLPATLTHLLLRECPKLMCLSSTGK 1143

Query: 697  LPPSVKVLDVYGCPKLESIAERLDNNTSLETINISNCENLKILSSGLHNLCQLQQIGIGG 756
            LP +++ L++    KL+ IAERL  NTSLE I I NC  LK L   LHNL +L+Q  I  
Sbjct: 1144 LPAALQYLEIQSISKLQKIAERLHQNTSLECIKIWNCHGLKSLPEDLHNLSKLRQFLIFW 1203

Query: 757  CGNLESFPEGGLPCAKLRRLEIYDCKRLEALPKGLHNLTSLQQLTIIG--GELPSLEEDG 814
            C +  SFP  GLP + LR L I +CK L+ALP G+ NLTSLQ+L I      LPS +E G
Sbjct: 1204 CQSFSSFPAAGLP-SNLRVLGIKNCKNLKALPNGMRNLTSLQKLDISHRLDSLPSPQE-G 1261

Query: 815  LPTNLHSLRIEGNMGIWKSMIERGRGFHRFSSLRYLLIRGCDDDMVSFPPEPEDRRLGTT 874
            LPTNL  L +  ++  +K M E   G  + +SL  L I G   D+ S+P E E+   G  
Sbjct: 1262 LPTNLIELNMH-DLKFYKPMFE--WGLQQPTSLIKLSIHGECLDVDSYPGEREN---GVM 1315

Query: 875  LPLPASLTSLSIAFFPNLESLS-SSIVDLQNLTKLTLYDCPKLKYFPEKGLPSSLLQLRI 933
            + LP SL+ L I++F NLE LS     +L +L +L +Y+C KL   P++GLP SL QL I
Sbjct: 1316 MLLPNSLSILCISYFQNLECLSPKGFQNLTSLNQLKIYNCLKLTSLPKEGLPPSLTQLEI 1375

Query: 934  YRCPLIEEKCRKDGGQYWDLLTHIPYARIAGKWVFNDDST 973
              CPL+ + C  + GQ W  + HIP   I  K++    +T
Sbjct: 1376 RNCPLLSQHCNNEKGQEWSKIAHIPCVLIDNKFIHETVTT 1415




Source: Quercus suber

Species: Quercus suber

Genus: Quercus

Family: Fagaceae

Order: Fagales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|400131587|emb|CCH50986.1| FB_MR5 [Malus x robusta] Back     alignment and taxonomy information
>gi|225449649|ref|XP_002262753.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356554923|ref|XP_003545790.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|359487225|ref|XP_002268551.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225450023|ref|XP_002272823.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] gi|451798994|gb|AGF69195.1| disease resistance protein At3g14460-like protein 2 [Vitis labrusca] Back     alignment and taxonomy information
>gi|451798992|gb|AGF69194.1| disease resistance protein At3g14460-like protein 1 [Vitis labrusca] Back     alignment and taxonomy information
>gi|359495024|ref|XP_002267933.2| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487416|ref|XP_002272889.2| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495026|ref|XP_003634900.1| PREDICTED: uncharacterized protein LOC100854556 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query976
TAIR|locus:20916621424 AT3G14460 [Arabidopsis thalian 0.938 0.643 0.312 5.2e-89
TAIR|locus:20916721054 AT3G14470 [Arabidopsis thalian 0.536 0.497 0.371 1e-77
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.647 0.350 0.264 8.6e-16
TAIR|locus:22058041556 AT1G27180 [Arabidopsis thalian 0.165 0.104 0.346 1.5e-11
TAIR|locus:21292361301 SNC1 "SUPPRESSOR OF NPR1-1, CO 0.313 0.235 0.222 3.8e-11
TAIR|locus:21171491201 AT4G19050 [Arabidopsis thalian 0.396 0.322 0.252 5.2e-11
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.322 0.159 0.240 5.8e-11
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.232 0.175 0.251 8.1e-11
TAIR|locus:22058241384 AT1G27170 [Arabidopsis thalian 0.401 0.283 0.261 1e-08
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.302 0.248 0.232 1.1e-08
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 896 (320.5 bits), Expect = 5.2e-89, P = 5.2e-89
 Identities = 317/1014 (31%), Positives = 480/1014 (47%)

Query:     6 EDLGLEIFKELHSRSFFQQSSNDASRFVMHDLINDLAHWAAGEIYFTMEYTSEVNKQQSF 65
             ED+G +   +L ++SFFQ+     + FVMHDL+NDLA   +G+  F +E    + +  S 
Sbjct:   459 EDIGNDYLGDLVAQSFFQRLDITMTSFVMHDLMNDLAKAVSGDFCFRLE-DDNIPEIPST 517

Query:    66 SRYLRHLSYIPEYYVGGKRFGDLYDIQHLRTFLPVMLTDSSPGY-LAPSILPKLLK-LQR 123
             +R   H S+          F  +   + LRT LP     S     L   +L  LL  L  
Sbjct:   518 TR---HFSFSRSQCDASVAFRSICGAEFLRTILPFNSPTSLESLQLTEKVLNPLLNALSG 574

Query:   124 LRVFSLRGYHISELPDSVGDLRYLRYLNLSGTNIRTLPESVNKLYNLHSLLLEDCDRLKK 183
             LR+ SL  Y I+ LP S+  L+ LRYL+LS T I+ LPE V  L NL +LLL +C  L  
Sbjct:   575 LRILSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLLLSNCRDLTS 634

Query:   184 LCADMGNLIKLHHLNNSNTDSLEETPLGIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHL 243
             L   +  LI L  L+   T  L E P GI KL  LQ L NFV+G+ SG+GL ELK L HL
Sbjct:   635 LPKSIAELINLRLLDLVGTP-LVEMPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELSHL 693

Query:   244 RGALEISKLENVKDVGNAKEARLDGKKNLKELLLRWTRS----TDGSSSREAETEMGVLD 299
             RG L IS+L+NV     AK+A L  K  L  L+L+WT        GS +  A  +  VL 
Sbjct:   694 RGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFVPGSFNALACDQKEVLR 753

Query:   300 MLKPHKNLEQFGICGYGGTKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLKHLT 359
             ML+PH +L+ F I  Y G  FP WLGDS F  + ++    C +C +LP VGQLPSLK+L+
Sbjct:   754 MLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKYLS 813

Query:   360 VRGVSRVKRLGSEFY-GDDSP--IPFPCLETLRFEDLQEWEVWISHGSGQGVEGFPKLRE 416
             +   + ++++G +F+ G+++   +PF  L+ L+F  +  W+ WI      G+  FP L++
Sbjct:   814 IEKFNILQKVGLDFFFGENNSRGVPFQSLQILKFYGMPRWDEWICPELEDGI--FPCLQK 871

Query:   417 LHILECPKLRGTFPEHLPVLEMLVIEGCEELLVS---------VLSLPALCKFLIGGCKK 467
             L I  CP LR  FPE LP    + I  C    VS         + ++P     +    ++
Sbjct:   872 LIIQRCPSLRKKFPEGLPSSTEVTISDCPLRAVSGGENSFRRSLTNIPESPASIPSMSRR 931

Query:   468 VVWESATGHLGSQNSVVCRD---TSNQSHDGLLQDICSLKSLEIRGCPKLQSLVAEEEKD 524
              +  S TG+  S  S   +    +S+QS+D    ++ S  SL     PK +     E+ D
Sbjct:   932 EL-SSPTGNPKSDASTSAQPGFASSSQSNDD--NEVTSTSSLS--SLPKDRQT---EDFD 983

Query:   525 QQQ-QLCELSCRLE---YLRLRYCEGLVKLPQXXXXXXXXKEI--EIYKCSSLV----SF 574
             Q + QL  L  + E    +  RY   +  +P           +  +     S++    S+
Sbjct:   984 QYETQLGSLPQQFEEPAVISARYSGYISDIPSTLSPYMSRTSLVPDPKNEGSILPGSSSY 1043

Query:   575 PEVALPSKLKKIEIRECDALKSLPEPWMCDTSSSLEILKIWDCHSLTYIAEVQLPLSLKR 634
                    K      R  +A+K  P  +  D  + +E LK+ D   L     ++LP +L+ 
Sbjct:  1044 QYHQYGIKSSVPSPRSSEAIK--PSQYD-DDETDMEYLKVTDISHL-----MELPQNLQS 1095

Query:   635 LDIQRCNKIRTLTVEEGIQXXXXXXXXXXLLENLAISSCPSLTCIFSKNELPATLESLEV 694
             L I  C+ + +L   E +            L  L I +C SL   F  +  P TL++L +
Sbjct:  1096 LHIDSCDGLTSLP--ENLTESYPN------LHELLIIACHSLES-FPGSHPPTTLKTLYI 1146

Query:   695 G-----NLPPSVKVLDVYGCPKLESIAERLDNNTS--------LETINISNCENLKILS- 740
                   N   S++    Y   +   I     N  +        L +++I +CE+ K  S 
Sbjct:  1147 RDCKKLNFTESLQPTRSYSQLEYLFIGSSCSNLVNFPLSLFPKLRSLSIRDCESFKTFSI 1206

Query:   741 -SGLHXXXXXXXXXXXXXX-XXESFPEGGLPCAKLRRLEIYDCKRLEALPKGLHNLTSLQ 798
              +GL                  E+FP+GGLP  KL  + + +CK+L+ALP+ L  LTSL 
Sbjct:  1207 HAGLGDDRIALESLEIRDCPNLETFPQGGLPTPKLSSMLLSNCKKLQALPEKLFGLTSLL 1266

Query:   799 QLTIIG-GELPSLEEDGLPTNLHSLRIEGNMGIWKSMIERGR-GFHRFSSLRYLLIRGCD 856
              L II   E+ ++   G P+NL +L I     +   +  R   G     +LR L I G +
Sbjct:  1267 SLFIIKCPEIETIPGGGFPSNLRTLCIS----LCDKLTPRIEWGLRDLENLRNLEIDGGN 1322

Query:   857 DDMVSFPPEPEDRRXXXXXXXXXXXXXXXIAFFPNLESLS-SSIVDLQNLTKLTLYDCPK 915
             +D+ SFP E                    I+ F NL++L+     D + +  + +  C K
Sbjct:  1323 EDIESFPEE---------GLLPKSVFSLRISRFENLKTLNRKGFHDTKAIETMEISGCDK 1373

Query:   916 LKYFPEKGLPSSLLQLRIYRCPLIEEKCRKDGGQYWDLLTHIPYARIAGKWVFN 969
             L+   ++ LP  L  LRI  C L+ E   +   +++ +L +IPY  I G+ +F+
Sbjct:  1374 LQISIDEDLPP-LSCLRISSCSLLTETFAEVETEFFKVL-NIPYVEIDGE-IFS 1424




GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129236 SNC1 "SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117149 AT4G19050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query976
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-10
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-09
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-08
PLN032101153 PLN03210, PLN03210, Resistant to P 8e-06
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 0.003
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 64.5 bits (157), Expect = 2e-10
 Identities = 62/240 (25%), Positives = 100/240 (41%), Gaps = 44/240 (18%)

Query: 701 VKVLDVYGCPKLESIAERLDNNTSLETINISNCENLKILSSGLHNLCQLQQIGIGGCGNL 760
           ++ +D+ G   L+ I + L   T+LET+ +S+C +L  L S +  L +L+ + +  C NL
Sbjct: 636 LRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENL 694

Query: 761 ESFPEGGLPCAKLRRLEIYDCKRLEALPKGLHNLTSLQQLTIIGGELPSLEEDGLPTNLH 820
           E  P G +    L RL +  C RL++ P    N++ L     +     ++EE   P+NL 
Sbjct: 695 EILPTG-INLKSLYRLNLSGCSRLKSFPDISTNISWL----DLDET--AIEE--FPSNLR 745

Query: 821 SLRIEGNMGIWKSMIERGRGFHRFSSLRYLLIRGCDDDMVSFPPEPEDRRLGTTLPL--- 877
                                    +L  L+       +     E    R+    PL   
Sbjct: 746 -----------------------LENLDELI-------LCEMKSEKLWERVQPLTPLMTM 775

Query: 878 -PASLTSLSIAFFPNLESLSSSIVDLQNLTKLTLYDCPKLKYFPEKGLPSSLLQLRIYRC 936
              SLT L ++  P+L  L SSI +L  L  L + +C  L+  P      SL  L +  C
Sbjct: 776 LSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGC 835


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 976
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN032101153 Resistant to P. syringae 6; Provisional 99.97
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.96
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.94
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.66
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.64
KOG4237498 consensus Extracellular matrix protein slit, conta 99.6
KOG4237498 consensus Extracellular matrix protein slit, conta 99.56
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.52
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.51
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.48
KOG0617264 consensus Ras suppressor protein (contains leucine 99.47
KOG0617264 consensus Ras suppressor protein (contains leucine 99.45
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.16
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.15
KOG4341483 consensus F-box protein containing LRR [General fu 98.97
KOG4341483 consensus F-box protein containing LRR [General fu 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.93
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.79
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.77
PRK15386 426 type III secretion protein GogB; Provisional 98.72
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.69
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.64
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.64
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.61
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.6
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.57
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.57
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.48
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.38
PLN03150623 hypothetical protein; Provisional 98.34
PRK15386426 type III secretion protein GogB; Provisional 98.33
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.3
PLN03150623 hypothetical protein; Provisional 98.25
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.22
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.2
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.06
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.06
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.03
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.0
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.9
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.83
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.76
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.7
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.53
KOG18591096 consensus Leucine-rich repeat proteins [General fu 97.53
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.46
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.29
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.22
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.2
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.15
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.75
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.7
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.47
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.46
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.39
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.1
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.0
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.99
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.8
KOG0473326 consensus Leucine-rich repeat protein [Function un 95.36
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.32
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.31
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.57
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.57
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.52
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.75
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.62
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.59
smart0037026 LRR Leucine-rich repeats, outliers. 91.59
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.91
smart0037026 LRR Leucine-rich repeats, outliers. 85.91
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.1e-40  Score=416.59  Aligned_cols=301  Identities=16%  Similarity=0.131  Sum_probs=174.0

Q ss_pred             ccccEEEeeccCCcccCccccCCCCCccEEEeecCCCCCCCCC-cCCCCCCcEEEEccCCCCCCCCCccccCCCCcccEE
Q 048829          534 CRLEYLRLRYCEGLVKLPQSSLSLSSLKEIEIYKCSSLVSFPE-VALPSKLKKIEIRECDALKSLPEPWMCDTSSSLEIL  612 (976)
Q Consensus       534 ~~L~~L~L~~~~~l~~~~~~~~~l~~L~~L~l~~c~~l~~l~~-~~~~~~L~~L~l~~~~~l~~l~~~~~~~~l~~L~~L  612 (976)
                      ++|+.|++++|.....+|..+..+++|+.|++++|.....+|. ...+++|+.|++++|.....+|....  .+++|+.|
T Consensus       284 ~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~--~~~~L~~L  361 (968)
T PLN00113        284 QKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLG--KHNNLTVL  361 (968)
T ss_pred             cCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHh--CCCCCcEE
Confidence            5777777777777777887888888888888888544444443 34467788888888775445554433  56677777


Q ss_pred             EEecCCCCcccccc-cCCCCCcEEeeccCcCccccccccccccccccccCCCCcceEeecCCCCccccccCCCccccccc
Q 048829          613 KIWDCHSLTYIAEV-QLPLSLKRLDIQRCNKIRTLTVEEGIQSSSSRRYTSSLLENLAISSCPSLTCIFSKNELPATLES  691 (976)
Q Consensus       613 ~l~~~~~l~~~~~~-~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~  691 (976)
                      ++++|.....++.. ....+|+.|++++|...+.+  |..+..                                     
T Consensus       362 ~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~--p~~~~~-------------------------------------  402 (968)
T PLN00113        362 DLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEI--PKSLGA-------------------------------------  402 (968)
T ss_pred             ECCCCeeEeeCChhHhCcCCCCEEECcCCEecccC--CHHHhC-------------------------------------
Confidence            77766443333332 22344555555555432222  111111                                     


Q ss_pred             ccccCCCCCceEEEEcCCCcchhhhhhhcCCCCCceEEeecCCCcccccccccCCCCCcEEEccCCCCCCccCCCCCCCC
Q 048829          692 LEVGNLPPSVKVLDVYGCPKLESIAERLDNNTSLETINISNCENLKILSSGLHNLCQLQQIGIGGCGNLESFPEGGLPCA  771 (976)
Q Consensus       692 ~~~~~~~~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~l~~c~~l~~lp~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~  771 (976)
                           + ++|+.|++++|++.+.+|..+..+++|+.|++++|...+.+|..+..+++|+.|++++|...+.+|..+ ..+
T Consensus       403 -----~-~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~  475 (968)
T PLN00113        403 -----C-RSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSK  475 (968)
T ss_pred             -----C-CCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccc
Confidence                 0 556666666666666666666666667777776665555556555666667777777665555555432 345


Q ss_pred             CccEEEecCCcCcccCCCcCCCCCccceEEEeCCCCCCcccC--CCCCccceeeecCCCCccchhhhcCCcccccCcccE
Q 048829          772 KLRRLEIYDCKRLEALPKGLHNLTSLQQLTIIGGELPSLEED--GLPTNLHSLRIEGNMGIWKSMIERGRGFHRFSSLRY  849 (976)
Q Consensus       772 ~L~~L~l~~c~~l~~~~~~l~~l~~L~~L~l~~~~l~~~~~~--~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~L~~  849 (976)
                      +|+.|++++|...+.+|..+.++++|++|++++|.+....+.  ..+++|++|++++|.+....+    ..+..+++|+.
T Consensus       476 ~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p----~~~~~l~~L~~  551 (968)
T PLN00113        476 RLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIP----ASFSEMPVLSQ  551 (968)
T ss_pred             cceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCC----hhHhCcccCCE
Confidence            666667766666566666666666666666666666532211  234455555555555554444    23455555555


Q ss_pred             EEEeccCCCCccCCCCCcccccCCCCCCccccceeeccccCCCcccc
Q 048829          850 LLIRGCDDDMVSFPPEPEDRRLGTTLPLPASLTSLSIAFFPNLESLS  896 (976)
Q Consensus       850 L~l~~c~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~l~  896 (976)
                      |++++ |...+.+|...         ..+++|+.|++++|+..+.+|
T Consensus       552 L~Ls~-N~l~~~~p~~l---------~~l~~L~~l~ls~N~l~~~~p  588 (968)
T PLN00113        552 LDLSQ-NQLSGEIPKNL---------GNVESLVQVNISHNHLHGSLP  588 (968)
T ss_pred             EECCC-CcccccCChhH---------hcCcccCEEeccCCcceeeCC
Confidence            55555 33334444433         244555555555544444444



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query976
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-15
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-04
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 1e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-11
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-06
4fdw_A401 Leucine rich hypothetical protein; putative cell s 6e-09
4fdw_A401 Leucine rich hypothetical protein; putative cell s 3e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-06
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-04
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 2e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 1e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 88.5 bits (220), Expect = 5e-19
 Identities = 66/305 (21%), Positives = 102/305 (33%), Gaps = 36/305 (11%)

Query: 631 SLKRLDIQRCNKIRTLTVEEGIQS----SSSRRYTSSLLENLAISSCPSLTCIFSKNELP 686
             + L  Q    +R     + +       ++ R         A S+ P +    +   L 
Sbjct: 13  GRENLYFQGSTALRPY--HDVLSQWQRHYNADRNRWHSAWRQANSNNPQIETR-TGRALK 69

Query: 687 ATLESLEVGNLPPSVKVLDVYGCPKLESIAERLDNNTSLETINISNCENLKILSSGLHNL 746
           AT + LE    P     L++     L    ++    + L+ + I     L  L   +   
Sbjct: 70  ATADLLEDATQP-GRVALELRSV-PLPQFPDQAFRLSHLQHMTIDAA-GLMELPDTMQQF 126

Query: 747 CQLQQIGIGGCGNLESFPEGGLPCAKLRRLEIYDCKRLEALPKGL---------HNLTSL 797
             L+ + +     L + P       +LR L I  C  L  LP+ L           L +L
Sbjct: 127 AGLETLTLARN-PLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNL 185

Query: 798 QQLTIIGGELPSL-EEDGLPTNLHSLRIEGNMGIWKSMIERGRGFHRFSSLRYLLIRGCD 856
           Q L +    + SL        NL SL+I  +      +   G   H    L  L +RGC 
Sbjct: 186 QSLRLEWTGIRSLPASIANLQNLKSLKIRNS-----PLSALGPAIHHLPKLEELDLRGCT 240

Query: 857 DDMVSFPPEPEDRRLGTTLPLPASLTSLSIAFFPNLESLSSSIVDLQNLTKLTLYDCPKL 916
             + ++PP    R           L  L +    NL +L   I  L  L KL L  C  L
Sbjct: 241 A-LRNYPPIFGGRA---------PLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNL 290

Query: 917 KYFPE 921
              P 
Sbjct: 291 SRLPS 295


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query976
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.98
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.84
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.81
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.8
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.79
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.79
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.79
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.79
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.78
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.78
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.77
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.77
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.75
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.75
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.74
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.74
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.73
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.73
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.69
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.68
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.67
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.67
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.66
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.66
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.65
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.63
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.63
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.62
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.62
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.6
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.59
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.56
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.52
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.52
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.5
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.49
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.48
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.46
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.46
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.44
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.43
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.43
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.43
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.42
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.4
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.4
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.39
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.37
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.36
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.35
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.35
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.34
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.33
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.33
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.33
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.31
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.3
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.3
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.3
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.3
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.27
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.27
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.22
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.19
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.17
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.17
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.16
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.16
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.14
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.14
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.02
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.01
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.0
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.95
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.93
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.72
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.68
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.64
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.61
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.45
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.34
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.3
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.18
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.17
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.15
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.13
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.1
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.03
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.9
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.86
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.77
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.63
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.6
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.58
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.9
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.45
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 92.22
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 91.77
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 90.06
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 85.16
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 84.87
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=6.3e-53  Score=511.88  Aligned_cols=247  Identities=13%  Similarity=0.054  Sum_probs=148.9

Q ss_pred             CCceEEEEcCCCcchhhhhhhcCCCCCceEEeecCCCcccccccccCCCCCcEEEccCCCCCCccCCCCCCCCCccEEEe
Q 048829          699 PSVKVLDVYGCPKLESIAERLDNNTSLETINISNCENLKILSSGLHNLCQLQQIGIGGCGNLESFPEGGLPCAKLRRLEI  778 (976)
Q Consensus       699 ~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~l~~c~~l~~lp~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~L~~L~l  778 (976)
                      ++|++|++++|++.+.+|..++.+++|++|++++|...+.+|..+..+++|++|++++|+..+.+|..+..+..+..+++
T Consensus       490 ~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~  569 (768)
T 3rgz_A          490 TNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANF  569 (768)
T ss_dssp             TTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCST
T ss_pred             CCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhc
Confidence            44555555555555555555555555555555555444455555555555555555555444445544433333332222


Q ss_pred             cCCcCc----------------------ccCCCcCCCCCccceEEEeCCCCCCcc--cCCCCCccceeeecCCCCccchh
Q 048829          779 YDCKRL----------------------EALPKGLHNLTSLQQLTIIGGELPSLE--EDGLPTNLHSLRIEGNMGIWKSM  834 (976)
Q Consensus       779 ~~c~~l----------------------~~~~~~l~~l~~L~~L~l~~~~l~~~~--~~~~~~~L~~L~l~~~~~~~~~~  834 (976)
                      ..+...                      +..+..+..++.++.+++..+.+....  ..+.+++|+.|++++|.+...++
T Consensus       570 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip  649 (768)
T 3rgz_A          570 IAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIP  649 (768)
T ss_dssp             TCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCC
T ss_pred             cccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCC
Confidence            211000                      001111122222222222222222111  12345789999999999988877


Q ss_pred             hhcCCcccccCcccEEEEeccCCCCccCCCCCcccccCCCCCCccccceeeccccCCCccccccccCCCCCCeEeecCCC
Q 048829          835 IERGRGFHRFSSLRYLLIRGCDDDMVSFPPEPEDRRLGTTLPLPASLTSLSIAFFPNLESLSSSIVDLQNLTKLTLYDCP  914 (976)
Q Consensus       835 ~~~~~~~~~l~~L~~L~l~~c~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~l~~~l~~l~~L~~L~l~~c~  914 (976)
                          ..+.++++|+.|++++ |...+.+|...         ..+++|+.|++++|+.-+.+|..+..+++|++|++++|+
T Consensus       650 ----~~l~~l~~L~~L~Ls~-N~l~g~ip~~l---------~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~  715 (768)
T 3rgz_A          650 ----KEIGSMPYLFILNLGH-NDISGSIPDEV---------GDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNN  715 (768)
T ss_dssp             ----GGGGGCTTCCEEECCS-SCCCSCCCGGG---------GGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSE
T ss_pred             ----HHHhccccCCEEeCcC-CccCCCCChHH---------hCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCc
Confidence                5689999999999999 56777899887         589999999999966667999999999999999999988


Q ss_pred             CccccCCCCCcccccceeecCCcc-----hHHHHhccCCccccccccccEE
Q 048829          915 KLKYFPEKGLPSSLLQLRIYRCPL-----IEEKCRKDGGQYWDLLTHIPYA  960 (976)
Q Consensus       915 ~l~~i~~~~~~~~L~~L~i~~c~~-----l~~~~~~~~~~~~~~i~~~~~~  960 (976)
                      ..+.||..+...++....+.|||.     +. .|...++++|++|+|+|.+
T Consensus       716 l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~~~~~~~~~~~~~~  765 (768)
T 3rgz_A          716 LSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPSNADGYAHHQRSHHH  765 (768)
T ss_dssp             EEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSCC-------------
T ss_pred             ccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCCccCCCCCCCCcccc
Confidence            888999887777888888888763     34 7999999999999999985



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 976
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 44.3 bits (103), Expect = 4e-05
 Identities = 18/98 (18%), Positives = 35/98 (35%), Gaps = 3/98 (3%)

Query: 110 LAPSILPKLLKLQRLRVFSLRGYHISELPDSVGDLRYLRYLNLSGTNI--RTLPESVNKL 167
           L P +  +LL    +  F      + +          +++++LS + I   TL   +++ 
Sbjct: 12  LHPDVTGRLLSQG-VIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQC 70

Query: 168 YNLHSLLLEDCDRLKKLCADMGNLIKLHHLNNSNTDSL 205
             L +L LE       +   +     L  LN S     
Sbjct: 71  SKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGF 108


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query976
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.8
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.78
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.77
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.76
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.68
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.67
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.66
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.64
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.48
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.47
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.44
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.44
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.43
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.42
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.41
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.36
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.35
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.35
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.33
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.28
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.27
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.18
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.1
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.97
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.93
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.92
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.9
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.88
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.84
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.43
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.9
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.87
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.98
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.96
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.11
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.92
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.82  E-value=1.9e-19  Score=197.95  Aligned_cols=86  Identities=19%  Similarity=0.335  Sum_probs=73.7

Q ss_pred             cCCcccEEEccCCccccccccccCCCcccEEecCCCCccccchhhhccCCccEEecccccchhccchhhhccccCceeec
Q 048829          120 KLQRLRVFSLRGYHISELPDSVGDLRYLRYLNLSGTNIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLIKLHHLNN  199 (976)
Q Consensus       120 ~l~~Lr~L~Ls~~~i~~lp~~~~~L~~L~~L~L~~n~i~~lp~~i~~L~~L~~L~L~~~~~l~~lp~~i~~L~~L~~L~l  199 (976)
                      .+.+|++|++++++|+.+ +.++.|++|++|+|++|+|+.+|. |+++++|++|++++| .+..++ .++++++|+.|++
T Consensus        42 ~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n-~i~~i~-~l~~l~~L~~L~~  117 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNN-QIADIT-PLANLTNLTGLTL  117 (384)
T ss_dssp             HHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSS-CCCCCG-GGTTCTTCCEEEC
T ss_pred             HhCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCcCCCCcc-ccCCccccccccccc-cccccc-ccccccccccccc
Confidence            677899999999999987 578899999999999999999964 999999999999995 677775 4899999999999


Q ss_pred             CCCCCcccccc
Q 048829          200 SNTDSLEETPL  210 (976)
Q Consensus       200 ~~~~~~~~lp~  210 (976)
                      +++. ...++.
T Consensus       118 ~~~~-~~~~~~  127 (384)
T d2omza2         118 FNNQ-ITDIDP  127 (384)
T ss_dssp             CSSC-CCCCGG
T ss_pred             cccc-cccccc
Confidence            9887 555543



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure