Psyllid ID: psy10107

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MFMNMVPEYVGTEIYKATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKTDDDDDAIISDCDEKDKDDLMMDEEKMKQHHRMVKAVLGTSSILTFPCSIVKLTIPGNGSPGCGR
ccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccc
cccccccHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHccccHHHHHHHHcccccccccccEEEEEccccccccccc
mfmnmvpeyvGTEIYKATLKAWLNehkknpyptkgEKIMLAIITKMTLTQVSTWFANARRRLKKEnkmtwepknktdddddaiisdcdekdkddlmMDEEKMKQHHRMVKAVLgtssiltfpcsivkltipgngspgcgr
mfmnmvpeYVGTEIYKATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRrlkkenkmtwepknktdddddaiisdCDEKDKDDLMMDEEKMKQHHRMVKAVLGTSSILTFPCSIvkltipgngspgcgr
MFMNMVPEYVGTEIYKATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKTdddddaiisdcdekdkddlmmdeekmkQHHRMVKAVLGTSSILTFPCSIVKLTIPGNGSPGCGR
****MVPEYVGTEIYKATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANAR************************************************MVKAVLGTSSILTFPCSIVKLTI**********
*************IYKATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARR********************************************************************************
MFMNMVPEYVGTEIYKATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKTDDDDDAIISDCDEKDKDDLMMDEEKMKQHHRMVKAVLGTSSILTFPCSIVKLTIPGNGSPGCGR
**************YKATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWE*************************************VK**LGTSSILTFPCSIVKLTIPGNG***C**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFMNMVPEYVGTEIYKATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKTDDDDDAIISDCDEKDKDDLMMDEEKMKQHHRMVKAVLGTSSILTFPCSIVKLTIPGNGSPGCGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query140 2.2.26 [Sep-21-2011]
Q24248 717 Homeobox protein araucan yes N/A 0.557 0.108 0.936 3e-31
P54269 693 Homeobox protein caupolic no N/A 0.714 0.144 0.715 5e-30
Q9JKQ4 484 Iroquois-class homeodomai yes N/A 0.607 0.175 0.717 5e-30
P78411 483 Iroquois-class homeodomai yes N/A 0.607 0.175 0.717 8e-30
Q4LDQ3 482 Iroquois-class homeodomai yes N/A 0.628 0.182 0.727 1e-29
Q90XW5 474 Iroquois-class homeodomai N/A N/A 0.628 0.185 0.727 1e-29
P78412 446 Iroquois-class homeodomai no N/A 0.471 0.147 0.863 2e-29
P81067 507 Iroquois-class homeodomai no N/A 0.471 0.130 0.848 2e-29
P81066 474 Iroquois-class homeodomai no N/A 0.428 0.126 0.933 4e-29
P78415 501 Iroquois-class homeodomai no N/A 0.471 0.131 0.848 5e-29
>sp|Q24248|ARA_DROME Homeobox protein araucan OS=Drosophila melanogaster GN=ara PE=1 SV=2 Back     alignment and function desciption
 Score =  133 bits (334), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 74/79 (93%), Positives = 78/79 (98%), Gaps = 1/79 (1%)

Query: 17  ATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKT 76
           ATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKN+T
Sbjct: 268 ATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNRT 327

Query: 77  DDDDDAIISDCDEKDKDDL 95
           DDDDDA++SD DEKDK+DL
Sbjct: 328 DDDDDALVSD-DEKDKEDL 345
Controls proneural and vein forming genes. Positive transcriptional controler of AC-SC (achaete-scute). May act as an activator that interacts with the transcriptional complex assembled on the AC and SC promoters and participates in transcription initiation.
Drosophila melanogaster (taxid: 7227)
>sp|P54269|CAUP_DROME Homeobox protein caupolican OS=Drosophila melanogaster GN=caup PE=2 SV=2 Back     alignment and function description
>sp|Q9JKQ4|IRX5_MOUSE Iroquois-class homeodomain protein IRX-5 OS=Mus musculus GN=Irx5 PE=2 SV=1 Back     alignment and function description
>sp|P78411|IRX5_HUMAN Iroquois-class homeodomain protein IRX-5 OS=Homo sapiens GN=IRX5 PE=1 SV=3 Back     alignment and function description
>sp|Q4LDQ3|IRX5_XENTR Iroquois-class homeodomain protein irx-5 OS=Xenopus tropicalis GN=irx5 PE=2 SV=1 Back     alignment and function description
>sp|Q90XW5|IRX5_XENLA Iroquois-class homeodomain protein irx-5 OS=Xenopus laevis GN=irx5 PE=2 SV=1 Back     alignment and function description
>sp|P78412|IRX6_HUMAN Iroquois-class homeodomain protein IRX-6 OS=Homo sapiens GN=IRX6 PE=2 SV=3 Back     alignment and function description
>sp|P81067|IRX3_MOUSE Iroquois-class homeodomain protein IRX-3 OS=Mus musculus GN=Irx3 PE=1 SV=2 Back     alignment and function description
>sp|P81066|IRX2_MOUSE Iroquois-class homeodomain protein IRX-2 OS=Mus musculus GN=Irx2 PE=2 SV=2 Back     alignment and function description
>sp|P78415|IRX3_HUMAN Iroquois-class homeodomain protein IRX-3 OS=Homo sapiens GN=IRX3 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
357607497 456 putative iroquois-like protein [Danaus p 0.6 0.184 0.818 2e-34
328718930 585 PREDICTED: hypothetical protein LOC10016 0.607 0.145 0.873 7e-33
195378781 698 GJ11493 [Drosophila virilis] gi|19415531 0.542 0.108 0.868 1e-32
195126385 718 GI12262 [Drosophila mojavensis] gi|19391 0.5 0.097 0.928 1e-32
307177867 503 Homeobox protein caupolican [Camponotus 0.585 0.163 0.903 2e-32
345484618 725 PREDICTED: homeobox protein caupolican-l 0.607 0.117 0.860 4e-32
307197225 670 Homeobox protein araucan [Harpegnathos s 0.585 0.122 0.891 4e-32
332024321 643 Homeobox protein araucan [Acromyrmex ech 0.585 0.127 0.891 5e-32
110760661 677 PREDICTED: homeobox protein araucan-like 0.6 0.124 0.870 5e-32
340716548 653 PREDICTED: homeobox protein caupolican-l 0.6 0.128 0.870 6e-32
>gi|357607497|gb|EHJ65536.1| putative iroquois-like protein [Danaus plexippus] Back     alignment and taxonomy information
 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 72/88 (81%), Positives = 81/88 (92%), Gaps = 4/88 (4%)

Query: 17  ATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKT 76
           ATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKT
Sbjct: 200 ATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKT 259

Query: 77  DDDDDAIISDCDEKDKDDLM---MDEEK 101
           DDD+D ++SD +E+++DD +    DEE+
Sbjct: 260 DDDEDTMLSD-EEREQDDKIKANKDEER 286

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328718930|ref|XP_001946080.2| PREDICTED: hypothetical protein LOC100165521 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195378781|ref|XP_002048160.1| GJ11493 [Drosophila virilis] gi|194155318|gb|EDW70502.1| GJ11493 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195126385|ref|XP_002007651.1| GI12262 [Drosophila mojavensis] gi|193919260|gb|EDW18127.1| GI12262 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|307177867|gb|EFN66827.1| Homeobox protein caupolican [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345484618|ref|XP_001604958.2| PREDICTED: homeobox protein caupolican-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307197225|gb|EFN78544.1| Homeobox protein araucan [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332024321|gb|EGI64520.1| Homeobox protein araucan [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|110760661|ref|XP_396292.3| PREDICTED: homeobox protein araucan-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340716548|ref|XP_003396759.1| PREDICTED: homeobox protein caupolican-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
FB|FBgn0015904 717 ara "araucan" [Drosophila mela 0.428 0.083 0.983 1.3e-27
FB|FBgn0015919 693 caup "caupolican" [Drosophila 0.428 0.086 0.983 1.9e-27
UNIPROTKB|D6RH28206 IRX2 "Iroquois-class homeodoma 0.428 0.291 0.933 3.5e-27
RGD|1309834342 Irx2 "iroquois homeobox 2" [Ra 0.428 0.175 0.933 3.5e-27
UNIPROTKB|E1BPC7 445 IRX6 "Uncharacterized protein" 0.421 0.132 0.949 4.5e-27
UNIPROTKB|E2RP82 442 IRX6 "Uncharacterized protein" 0.421 0.133 0.949 4.5e-27
UNIPROTKB|P78412 446 IRX6 "Iroquois-class homeodoma 0.421 0.132 0.949 4.5e-27
UNIPROTKB|F1NQQ8129 IRX2 "Uncharacterized protein" 0.428 0.465 0.933 5.7e-27
UNIPROTKB|F1RF02 440 IRX6 "Uncharacterized protein" 0.421 0.134 0.949 5.7e-27
UNIPROTKB|Q9BZI1 471 IRX2 "Iroquois-class homeodoma 0.428 0.127 0.933 6e-27
FB|FBgn0015904 ara "araucan" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 318 (117.0 bits), Expect = 1.3e-27, P = 1.3e-27
 Identities = 59/60 (98%), Positives = 60/60 (100%)

Query:    17 ATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKT 76
             ATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKN+T
Sbjct:   268 ATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNRT 327
GO:0007474 "imaginal disc-derived wing vein specification" evidence=IGI
GO:0005634 "nucleus" evidence=IC;ISS;NAS
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP
GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0006352 "DNA-dependent transcription, initiation" evidence=NAS
GO:0035310 "notum cell fate specification" evidence=IMP
GO:0045317 "equator specification" evidence=TAS
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=NAS
GO:0001745 "compound eye morphogenesis" evidence=IMP
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0042693 "muscle cell fate commitment" evidence=IGI
FB|FBgn0015919 caup "caupolican" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|D6RH28 IRX2 "Iroquois-class homeodomain protein IRX-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1309834 Irx2 "iroquois homeobox 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BPC7 IRX6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RP82 IRX6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P78412 IRX6 "Iroquois-class homeodomain protein IRX-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQQ8 IRX2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RF02 IRX6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BZI1 IRX2 "Iroquois-class homeodomain protein IRX-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q93348IRX_CAEELNo assigned EC number0.72580.44280.1644yesN/A
Q9YGS0IRX4_CHICKNo assigned EC number0.87300.450.1298yesN/A
Q9BZI1IRX2_HUMANNo assigned EC number0.93330.42850.1273noN/A
Q9JKQ4IRX5_MOUSENo assigned EC number0.71760.60710.1756yesN/A
P81066IRX2_MOUSENo assigned EC number0.93330.42850.1265noN/A
Q4LDQ3IRX5_XENTRNo assigned EC number0.72720.62850.1825yesN/A
P78411IRX5_HUMANNo assigned EC number0.71760.60710.1759yesN/A
Q6DCQ1IRX2_XENLANo assigned EC number0.91660.42850.1318N/AN/A
Q24248ARA_DROMENo assigned EC number0.93670.55710.1087yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
pfam0592040 pfam05920, Homeobox_KN, Homeobox KN domain 2e-19
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 4e-12
smart0038957 smart00389, HOX, Homeodomain 6e-11
pfam0004657 pfam00046, Homeobox, Homeobox domain 2e-06
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 1e-04
>gnl|CDD|203350 pfam05920, Homeobox_KN, Homeobox KN domain Back     alignment and domain information 
 Score = 75.2 bits (186), Expect = 2e-19
 Identities = 21/40 (52%), Positives = 26/40 (65%)

Query: 22 WLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR 61
          WL EH  NPYP++ EK  LA  T ++  Q+  WF NARRR
Sbjct: 1  WLLEHLHNPYPSEEEKSELARQTGLSRKQIDNWFINARRR 40

This is a homeobox transcription factor KN domain conserved from fungi to human and plants. Length = 40
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 140
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 99.79
KOG0774|consensus334 99.74
KOG0775|consensus304 99.68
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.65
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.65
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.65
KOG0773|consensus342 99.54
KOG0489|consensus261 99.41
KOG0843|consensus197 99.39
KOG0487|consensus308 99.36
KOG0850|consensus245 99.29
KOG0493|consensus342 99.27
KOG0488|consensus309 99.24
KOG0842|consensus307 99.23
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.19
KOG0485|consensus268 99.19
KOG0492|consensus246 99.14
KOG0848|consensus317 99.14
COG5576156 Homeodomain-containing transcription factor [Trans 99.11
KOG0847|consensus288 99.09
KOG0483|consensus198 99.01
KOG0484|consensus125 98.99
KOG2251|consensus228 98.98
KOG0491|consensus194 98.96
KOG0494|consensus332 98.91
KOG0844|consensus408 98.88
KOG3802|consensus398 98.84
KOG2252|consensus558 98.8
KOG0486|consensus 351 98.67
KOG4577|consensus383 98.62
KOG0773|consensus 342 98.55
KOG0849|consensus354 98.4
KOG0490|consensus235 98.3
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 97.73
KOG1168|consensus385 97.69
KOG0490|consensus235 97.11
KOG1146|consensus 1406 95.08
KOG3623|consensus 1007 94.56
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 92.48
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 88.08
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 86.27
PRK04217110 hypothetical protein; Provisional 85.88
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 85.71
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and re 85.62
PRK06759154 RNA polymerase factor sigma-70; Validated 85.2
PRK09642160 RNA polymerase sigma factor SigW; Reviewed 82.41
PRK09646194 RNA polymerase sigma factor SigK; Reviewed 82.09
PRK09413121 IS2 repressor TnpA; Reviewed 81.99
PRK09644165 RNA polymerase sigma factor SigM; Provisional 81.89
PRK11924179 RNA polymerase sigma factor; Provisional 81.85
TIGR02939190 RpoE_Sigma70 RNA polymerase sigma factor RpoE. A s 81.45
TIGR02985161 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Ba 81.14
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information 
Probab=99.79  E-value=1e-19  Score=108.79  Aligned_cols=40  Identities=58%  Similarity=0.927  Sum_probs=36.4

Q ss_pred             HHHhhcCCCCCCHHHHHHHHHHhCCChhhHhHhhhhHHHh
Q psy10107         22 WLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR   61 (140)
Q Consensus        22 w~~~h~~nPYPs~~~k~~La~~tgLt~~QV~nWF~N~R~R   61 (140)
                      ||.+|..||||+.++|.+||.+|||+.+||++||.|+|+|
T Consensus         1 Wl~~h~~nPYPs~~ek~~L~~~tgls~~Qi~~WF~NaRrR   40 (40)
T PF05920_consen    1 WLLEHLHNPYPSKEEKEELAKQTGLSRKQISNWFINARRR   40 (40)
T ss_dssp             HHHHTTTSGS--HHHHHHHHHHHTS-HHHHHHHHHHHHHH
T ss_pred             CHHHHCCCCCCCHHHHHHHHHHcCCCHHHHHHHHHHhHcc
Confidence            8999999999999999999999999999999999999997

; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 3K2A_B 2LK2_A 1X2N_A 2DMN_A.
>KOG0774|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK04217 hypothetical protein; Provisional Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information
>PRK06759 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK09642 RNA polymerase sigma factor SigW; Reviewed Back     alignment and domain information
>PRK09646 RNA polymerase sigma factor SigK; Reviewed Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>PRK09644 RNA polymerase sigma factor SigM; Provisional Back     alignment and domain information
>PRK11924 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02939 RpoE_Sigma70 RNA polymerase sigma factor RpoE Back     alignment and domain information
>TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
1x2n_A73 Solution Structure Of The Homeobox Domain Of Human 4e-08
2lk2_A89 Solution Nmr Structure Of Homeobox Domain (171-248) 1e-07
3k2a_A67 Crystal Structure Of The Homeobox Domain Of Human H 5e-07
2dmn_A83 The Solution Structure Of The Homeobox Domain Of Hu 8e-07
4egc_A559 Crystal Structure Of Mbp-fused Human Six1 Bound To 3e-05
1lfu_P82 Nmr Solution Stucture Of The Extended Pbx Homeodoma 1e-04
1du6_A64 Solution Structure Of The Truncated Pbx Homeodomain 1e-04
1b72_B87 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 2e-04
1puf_B73 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 2e-04
1b8i_B63 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 2e-04
>pdb|1X2N|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Pknox1 Length = 73 Back     alignment and structure 
Iteration: 1

 Score = 53.5 bits (127), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (72%)
Query: 19 LKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL 62
          +++WL +H  +PYPT+ EK  +A  T +TL QV+ WF NARRR+
Sbjct: 22 MRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRI 65
>pdb|2LK2|A Chain A, Solution Nmr Structure Of Homeobox Domain (171-248) Of Human Homeobox Protein Tgif1, Northeast Structural Genomics Consortium Target Hr4411b Length = 89 Back     alignment and structure
>pdb|3K2A|A Chain A, Crystal Structure Of The Homeobox Domain Of Human Homeobox Protein Meis2 Length = 67 Back     alignment and structure
>pdb|2DMN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Tgif2lx Length = 83 Back     alignment and structure
>pdb|4EGC|A Chain A, Crystal Structure Of Mbp-fused Human Six1 Bound To Human Eya2 Eya Domain Length = 559 Back     alignment and structure
>pdb|1LFU|P Chain P, Nmr Solution Stucture Of The Extended Pbx Homeodomain Bound To Dna Length = 82 Back     alignment and structure
>pdb|1DU6|A Chain A, Solution Structure Of The Truncated Pbx Homeodomain Length = 64 Back     alignment and structure
>pdb|1B72|B Chain B, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 87 Back     alignment and structure
>pdb|1PUF|B Chain B, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 73 Back     alignment and structure
>pdb|1B8I|B Chain B, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 63 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 1e-25
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 8e-25
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 8e-25
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 2e-24
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 2e-24
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 2e-24
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 7e-24
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 5e-23
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 5e-23
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 2e-22
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 5e-10
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 6e-10
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-09
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 2e-09
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 2e-09
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-06
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 2e-06
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 4e-06
1e3o_C160 Octamer-binding transcription factor 1; transcript 4e-06
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 7e-06
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 9e-06
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-05
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-05
3d1n_I151 POU domain, class 6, transcription factor 1; prote 3e-05
3a01_A93 Homeodomain-containing protein; homeodomain, prote 3e-05
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 3e-05
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 6e-05
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 8e-05
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 8e-05
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 9e-05
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 1e-04
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 1e-04
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 1e-04
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-04
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 2e-04
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 2e-04
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-04
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 3e-04
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 4e-04
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 5e-04
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 8e-04
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 8e-04
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Length = 73 Back     alignment and structure
 Score = 91.3 bits (227), Expect = 1e-25
 Identities = 22/59 (37%), Positives = 28/59 (47%)

Query: 17 ATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNK 75
            L  +   H  NPYP++  K  LA    +T++QVS WF N R R KK      E  N 
Sbjct: 14 EILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANI 72
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Length = 87 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.85
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.84
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.84
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.83
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.82
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.82
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.82
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.81
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.8
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.79
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.77
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.73
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.73
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.72
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.72
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.71
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.71
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.71
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.71
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.71
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.71
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.7
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.7
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.7
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.7
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.7
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.7
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.7
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.69
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.69
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.69
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.69
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.69
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.69
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.68
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.68
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.68
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.68
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.68
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.68
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.68
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.68
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.67
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.67
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.67
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.66
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.66
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.66
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.66
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.66
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.65
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.65
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.64
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.64
2e19_A64 Transcription factor 8; homeobox domain, structura 99.64
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.64
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.63
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.63
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.61
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.6
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.59
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.59
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.57
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.56
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.55
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.55
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.54
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.54
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.53
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.51
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.5
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.49
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.49
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.36
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.34
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.33
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.32
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 97.58
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 96.64
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 90.25
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 88.16
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 87.24
3mzy_A164 RNA polymerase sigma-H factor; PSI, MCSG, structur 86.97
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 85.92
3c57_A95 Two component transcriptional regulatory protein; 85.23
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 83.56
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA 83.15
2rnj_A91 Response regulator protein VRAR; HTH LUXR-type dom 82.92
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 82.54
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-t 81.57
1je8_A82 Nitrate/nitrite response regulator protein NARL; p 81.31
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-tur 80.88
1s7o_A113 Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP 80.26
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 80.16
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 80.11
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
Probab=99.85  E-value=1.5e-21  Score=132.01  Aligned_cols=62  Identities=32%  Similarity=0.513  Sum_probs=59.2

Q ss_pred             CCCCCCCHHHHHHHHHHHHhhcCCCCCCHHHHHHHHHHhCCChhhHhHhhhhHHHhhhhccc
Q psy10107          6 VPEYVGTEIYKATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENK   67 (140)
Q Consensus         6 ~~R~~~~~~~~~~L~~w~~~h~~nPYPs~~~k~~La~~tgLt~~QV~nWF~N~R~R~k~~~~   67 (140)
                      .+|..|+++++.+|+.||.+|..||||+.++|.+||..|||++.||.+||+|+|+|.|+.+.
T Consensus         9 k~R~~~s~~q~~~L~~~f~~~~~~pYPs~~~r~~LA~~~gLs~~qV~~WFqNrR~r~k~~~~   70 (83)
T 2dmn_A            9 KRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDML   70 (83)
T ss_dssp             CCCSSCCHHHHHHHHHHHHHTTTTCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHTHHHHT
T ss_pred             CCCCcCCHHHHHHHHHHHHHhccCCCCCHHHHHHHHHHHCcCHHHhhHHhhhhHhhhcHHHH
Confidence            47889999999999999999999999999999999999999999999999999999998764
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Back     alignment and structure
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Back     alignment and structure
>2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Back     alignment and structure
>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} Back     alignment and structure
>1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 140
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 2e-17
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 1e-15
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 1e-14
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 5e-09
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 6e-09
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 1e-08
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-08
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 2e-08
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 3e-08
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 3e-08
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 6e-08
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6e-08
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 7e-08
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 1e-07
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 4e-07
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 4e-07
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 6e-07
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 7e-07
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 1e-06
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 2e-06
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 2e-06
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 2e-06
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 3e-06
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 3e-06
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 6e-06
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 7e-06
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 2e-05
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 2e-05
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 3e-05
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 5e-05
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 5e-05
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 2e-04
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein pknox1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 69.4 bits (170), Expect = 2e-17
 Identities = 22/53 (41%), Positives = 34/53 (64%)

Query: 12 TEIYKATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKK 64
           +     +++WL +H  +PYPT+ EK  +A  T +TL QV+ WF NARRR+ +
Sbjct: 10 PKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQ 62
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.87
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.87
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.78
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.77
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.76
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.75
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.75
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.75
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.75
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.74
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.74
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.74
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.74
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.73
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.73
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.73
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.73
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.73
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.73
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.73
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.73
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.72
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.71
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.71
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.69
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.67
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.66
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.66
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.64
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.61
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.57
d1hlva166 DNA-binding domain of centromere binding protein B 93.18
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 91.17
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 90.5
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 88.84
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 86.73
d1iufa178 Ars-binding protein 1, ABP1 {Fission yeast (Schizo 85.25
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein pknox1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.87  E-value=1.1e-22  Score=129.81  Aligned_cols=59  Identities=39%  Similarity=0.630  Sum_probs=56.0

Q ss_pred             CCCCCCCHHHHHHHHHHHHhhcCCCCCCHHHHHHHHHHhCCChhhHhHhhhhHHHhhhh
Q psy10107          6 VPEYVGTEIYKATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKK   64 (140)
Q Consensus         6 ~~R~~~~~~~~~~L~~w~~~h~~nPYPs~~~k~~La~~tgLt~~QV~nWF~N~R~R~k~   64 (140)
                      .+|..|+++++.+|+.||.+|..||||+.+++.+||.+|||+..||.|||+|+|+|+.+
T Consensus         4 rkR~~~~~~~~~iL~~wf~~~~~nPyPs~~e~~~La~~~~l~~~qI~~WF~N~R~R~lq   62 (62)
T d1x2na1           4 NKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQ   62 (62)
T ss_dssp             CSSCCCCHHHHHHHHHHHHHTTTSCCCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHHHHhccCCCcCHHHHHHHHHHHCcCHHHhHHHHHHHHHHhcC
Confidence            36788999999999999999999999999999999999999999999999999999753
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure