Psyllid ID: psy10189
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 376 | ||||||
| 156548550 | 211 | PREDICTED: protein enhancer of sevenless | 0.481 | 0.857 | 0.927 | 1e-112 | |
| 66524277 | 211 | PREDICTED: protein enhancer of sevenless | 0.481 | 0.857 | 0.922 | 1e-112 | |
| 380012053 | 259 | PREDICTED: protein enhancer of sevenless | 0.478 | 0.694 | 0.926 | 1e-111 | |
| 91089049 | 211 | PREDICTED: similar to AGAP011768-PA [Tri | 0.481 | 0.857 | 0.922 | 1e-111 | |
| 242017402 | 211 | protein E, putative [Pediculus humanus c | 0.481 | 0.857 | 0.917 | 1e-111 | |
| 383865247 | 264 | PREDICTED: protein enhancer of sevenless | 0.545 | 0.776 | 0.904 | 1e-110 | |
| 158300944 | 211 | AGAP011768-PA [Anopheles gambiae str. PE | 0.481 | 0.857 | 0.917 | 1e-109 | |
| 332022831 | 280 | Protein E(sev)2B [Acromyrmex echinatior] | 0.545 | 0.732 | 0.856 | 1e-108 | |
| 289741843 | 211 | downstream of receptor kinase [Glossina | 0.481 | 0.857 | 0.893 | 1e-107 | |
| 17136708 | 211 | downstream of receptor kinase, isoform A | 0.547 | 0.976 | 0.893 | 1e-107 |
| >gi|156548550|ref|XP_001605040.1| PREDICTED: protein enhancer of sevenless 2B-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 411 bits (1056), Expect = e-112, Method: Compositional matrix adjust.
Identities = 191/206 (92%), Positives = 201/206 (97%)
Query: 1 MEAIAKHDFNATAEDELSFRKSQVLKILNMEDDMNWYRAELDGKEGLIPSNYIEMKNHDW 60
MEAIAKHDF ATAEDELSFR++QVLKILNMEDDMNWYRAELD +EGLIPSNYIEMKNHDW
Sbjct: 1 MEAIAKHDFTATAEDELSFRRNQVLKILNMEDDMNWYRAELDSREGLIPSNYIEMKNHDW 60
Query: 61 YYGRITRADAERLLSNKHEGAFLIRVSESSPGDFSLSVKCSDGVQHFKVLRDSSGKFFLW 120
YYGRITRADAERLL NKHEGAFLIR+SESSPGDFSLSVKCSDGVQHFKVLRD+ GKFFLW
Sbjct: 61 YYGRITRADAERLLMNKHEGAFLIRISESSPGDFSLSVKCSDGVQHFKVLRDAQGKFFLW 120
Query: 121 VVKFNSLNELVEYHRTASVSRSQDVKLRDMVPEECLVQALYDFTPQEPGELEFRRGDVIT 180
VVKF+SLNELVEYHRTASVSRSQDVKLRDMVPEECLVQALYDFTPQEPGELEFRRGDVIT
Sbjct: 121 VVKFSSLNELVEYHRTASVSRSQDVKLRDMVPEECLVQALYDFTPQEPGELEFRRGDVIT 180
Query: 181 VTDRSDQHWWHGEIGARKGLFPATYI 206
VTDR+DQHWWHGEIG R+GLFP+TY+
Sbjct: 181 VTDRADQHWWHGEIGNRRGLFPSTYV 206
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|66524277|ref|XP_623354.1| PREDICTED: protein enhancer of sevenless 2B [Apis mellifera] gi|340724886|ref|XP_003400809.1| PREDICTED: protein enhancer of sevenless 2B-like [Bombus terrestris] gi|350422009|ref|XP_003493027.1| PREDICTED: protein enhancer of sevenless 2B-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|380012053|ref|XP_003690104.1| PREDICTED: protein enhancer of sevenless 2B-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|91089049|ref|XP_969998.1| PREDICTED: similar to AGAP011768-PA [Tribolium castaneum] gi|270012400|gb|EFA08848.1| hypothetical protein TcasGA2_TC006549 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242017402|ref|XP_002429178.1| protein E, putative [Pediculus humanus corporis] gi|212514056|gb|EEB16440.1| protein E, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|383865247|ref|XP_003708086.1| PREDICTED: protein enhancer of sevenless 2B-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|158300944|ref|XP_320742.3| AGAP011768-PA [Anopheles gambiae str. PEST] gi|157013402|gb|EAA00404.4| AGAP011768-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|332022831|gb|EGI63104.1| Protein E(sev)2B [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|289741843|gb|ADD19669.1| downstream of receptor kinase [Glossina morsitans morsitans] | Back alignment and taxonomy information |
|---|
| >gi|17136708|ref|NP_476858.1| downstream of receptor kinase, isoform A [Drosophila melanogaster] gi|24653398|ref|NP_725302.1| downstream of receptor kinase, isoform B [Drosophila melanogaster] gi|24653400|ref|NP_725303.1| downstream of receptor kinase, isoform C [Drosophila melanogaster] gi|24653402|ref|NP_725304.1| downstream of receptor kinase, isoform D [Drosophila melanogaster] gi|24653404|ref|NP_725305.1| downstream of receptor kinase, isoform E [Drosophila melanogaster] gi|24653406|ref|NP_725306.1| downstream of receptor kinase, isoform F [Drosophila melanogaster] gi|195058409|ref|XP_001995447.1| GH22624 [Drosophila grimshawi] gi|195400535|ref|XP_002058872.1| GJ19679 [Drosophila virilis] gi|195425486|ref|XP_002061033.1| GK10660 [Drosophila willistoni] gi|195484967|ref|XP_002090896.1| GE13357 [Drosophila yakuba] gi|729368|sp|Q08012.1|DRK_DROME RecName: Full=Protein enhancer of sevenless 2B; Short=Protein E(sev)2B; AltName: Full=Downstream of receptor kinase; AltName: Full=SH2-SH3 adapter protein drk gi|52000619|sp|Q6YKA8.1|DRK_DROSI RecName: Full=Protein E(sev)2B; AltName: Full=Downstream of receptor kinase; AltName: Full=Protein enhancer of sevenless 2B; AltName: Full=SH2-SH3 adapter protein drk gi|304809|gb|AAA28898.1| downstream of receptor kinases (drk) [Drosophila melanogaster] gi|7303308|gb|AAF58368.1| downstream of receptor kinase, isoform A [Drosophila melanogaster] gi|16768942|gb|AAL28690.1| LD12029p [Drosophila melanogaster] gi|21627236|gb|AAM68581.1| downstream of receptor kinase, isoform B [Drosophila melanogaster] gi|21627237|gb|AAM68582.1| downstream of receptor kinase, isoform C [Drosophila melanogaster] gi|21627238|gb|AAM68583.1| downstream of receptor kinase, isoform D [Drosophila melanogaster] gi|21627239|gb|AAM68584.1| downstream of receptor kinase, isoform E [Drosophila melanogaster] gi|21627240|gb|AAM68585.1| downstream of receptor kinase, isoform F [Drosophila melanogaster] gi|23344808|gb|AAN17564.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344810|gb|AAN17565.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344812|gb|AAN17566.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344814|gb|AAN17567.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344816|gb|AAN17568.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344818|gb|AAN17569.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344820|gb|AAN17570.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344822|gb|AAN17571.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344824|gb|AAN17572.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344826|gb|AAN17573.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344828|gb|AAN17574.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344830|gb|AAN17575.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344832|gb|AAN17576.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344834|gb|AAN17577.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344836|gb|AAN17578.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344838|gb|AAN17579.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344840|gb|AAN17580.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344842|gb|AAN17581.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344844|gb|AAN17582.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344846|gb|AAN17583.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344848|gb|AAN17584.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344850|gb|AAN17585.1| downstream of receptor kinase [Drosophila melanogaster] gi|23344994|gb|AAN17586.1| downstream of receptor kinase [Drosophila simulans] gi|193899653|gb|EDV98519.1| GH22624 [Drosophila grimshawi] gi|194156223|gb|EDW71407.1| GJ19679 [Drosophila virilis] gi|194157118|gb|EDW72019.1| GK10660 [Drosophila willistoni] gi|194176997|gb|EDW90608.1| GE13357 [Drosophila yakuba] gi|220943096|gb|ACL84091.1| drk-PA [synthetic construct] gi|220952784|gb|ACL88935.1| drk-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 376 | ||||||
| FB|FBgn0004638 | 211 | drk "downstream of receptor ki | 0.547 | 0.976 | 0.893 | 1e-100 | |
| UNIPROTKB|Q6YKA8 | 211 | drk "Protein E(sev)2B" [Drosop | 0.547 | 0.976 | 0.893 | 1e-100 | |
| ZFIN|ZDB-GENE-041121-1 | 217 | grb2a "growth factor receptor- | 0.566 | 0.981 | 0.626 | 3.7e-71 | |
| UNIPROTKB|Q3T0F9 | 217 | GRB2 "Growth factor receptor-b | 0.547 | 0.949 | 0.642 | 7.7e-71 | |
| UNIPROTKB|P62993 | 217 | GRB2 "Growth factor receptor-b | 0.547 | 0.949 | 0.642 | 7.7e-71 | |
| UNIPROTKB|B6E241 | 217 | GRB2 "Uncharacterized protein" | 0.547 | 0.949 | 0.642 | 7.7e-71 | |
| UNIPROTKB|Q5R4J7 | 217 | GRB2 "Growth factor receptor-b | 0.547 | 0.949 | 0.642 | 7.7e-71 | |
| RGD|619758 | 217 | Grb2 "growth factor receptor b | 0.547 | 0.949 | 0.642 | 7.7e-71 | |
| MGI|MGI:95805 | 217 | Grb2 "growth factor receptor b | 0.547 | 0.949 | 0.638 | 1.6e-70 | |
| UNIPROTKB|A3R0S3 | 217 | GRB2 "Growth factor receptor-b | 0.547 | 0.949 | 0.638 | 1.6e-70 |
| FB|FBgn0004638 drk "downstream of receptor kinase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 999 (356.7 bits), Expect = 1.0e-100, P = 1.0e-100
Identities = 184/206 (89%), Positives = 198/206 (96%)
Query: 1 MEAIAKHDFNATAEDELSFRKSQVLKILNMEDDMNWYRAELDGKEGLIPSNYIEMKNHDW 60
MEAIAKHDF+ATA+DELSFRK+Q+LKILNMEDD NWYRAELDGKEGLIPSNYIEMKNHDW
Sbjct: 1 MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHDW 60
Query: 61 YYGRITRADAERLLSNKHEGAFLIRVSESSPGDFSLSVKCSDGVQHFKVLRDSSGKFFLW 120
YYGRITRADAE+LLSNKHEGAFLIR+SESSPGDFSLSVKC DGVQHFKVLRD+ KFFLW
Sbjct: 61 YYGRITRADAEKLLSNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLW 120
Query: 121 VVKFNSLNELVEYHRTASVSRSQDVKLRDMVPEECLVQALYDFTPQEPGELEFRRGDVIT 180
VVKFNSLNELVEYHRTASVSRSQDVKLRDM+PEE LVQALYDF PQE GEL+FRRGDVIT
Sbjct: 121 VVKFNSLNELVEYHRTASVSRSQDVKLRDMIPEEMLVQALYDFVPQESGELDFRRGDVIT 180
Query: 181 VTDRSDQHWWHGEIGARKGLFPATYI 206
VTDRSD++WW+GEIG RKG+FPATY+
Sbjct: 181 VTDRSDENWWNGEIGNRKGIFPATYV 206
|
|
| UNIPROTKB|Q6YKA8 drk "Protein E(sev)2B" [Drosophila simulans (taxid:7240)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041121-1 grb2a "growth factor receptor-bound protein 2a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T0F9 GRB2 "Growth factor receptor-bound protein 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P62993 GRB2 "Growth factor receptor-bound protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B6E241 GRB2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R4J7 GRB2 "Growth factor receptor-bound protein 2" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| RGD|619758 Grb2 "growth factor receptor bound protein 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:95805 Grb2 "growth factor receptor bound protein 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A3R0S3 GRB2 "Growth factor receptor-bound protein 2" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 376 | |||
| cd09941 | 95 | cd09941, SH2_Grb2_like, Src homology 2 domain foun | 2e-51 | |
| cd09941 | 95 | cd09941, SH2_Grb2_like, Src homology 2 domain foun | 2e-51 | |
| cd11804 | 52 | cd11804, SH3_GRB2_like_N, N-terminal Src homology | 2e-30 | |
| smart00252 | 84 | smart00252, SH2, Src homology 2 domains | 3e-30 | |
| smart00252 | 84 | smart00252, SH2, Src homology 2 domains | 3e-30 | |
| pfam00017 | 77 | pfam00017, SH2, SH2 domain | 2e-27 | |
| pfam00017 | 77 | pfam00017, SH2, SH2 domain | 2e-27 | |
| cd11805 | 53 | cd11805, SH3_GRB2_like_C, C-terminal Src homology | 8e-27 | |
| cd11946 | 56 | cd11946, SH3_GRB2_N, N-terminal Src homology 3 dom | 2e-23 | |
| cd00173 | 79 | cd00173, SH2, Src homology 2 (SH2) domain | 3e-23 | |
| cd00173 | 79 | cd00173, SH2, Src homology 2 (SH2) domain | 3e-23 | |
| cd09935 | 94 | cd09935, SH2_ABL, Src homology 2 (SH2) domain foun | 5e-20 | |
| cd09935 | 94 | cd09935, SH2_ABL, Src homology 2 (SH2) domain foun | 5e-20 | |
| cd11948 | 54 | cd11948, SH3_GRAP_N, N-terminal Src homology 3 dom | 2e-19 | |
| cd00174 | 51 | cd00174, SH3, Src Homology 3 domain superfamily | 7e-19 | |
| cd10369 | 96 | cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain | 1e-18 | |
| cd10369 | 96 | cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain | 1e-18 | |
| cd09933 | 101 | cd09933, SH2_Src_family, Src homology 2 (SH2) doma | 1e-18 | |
| cd09933 | 101 | cd09933, SH2_Src_family, Src homology 2 (SH2) doma | 1e-18 | |
| smart00326 | 56 | smart00326, SH3, Src homology 3 domains | 6e-18 | |
| cd10354 | 77 | cd10354, SH2_Cterm_RasGAP, C-terminal Src homology | 1e-17 | |
| cd10354 | 77 | cd10354, SH2_Cterm_RasGAP, C-terminal Src homology | 1e-17 | |
| cd11949 | 53 | cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom | 1e-17 | |
| cd09943 | 93 | cd09943, SH2_Nck_family, Src homology 2 (SH2) doma | 4e-17 | |
| cd09943 | 93 | cd09943, SH2_Nck_family, Src homology 2 (SH2) doma | 4e-17 | |
| cd09945 | 98 | cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 | 9e-17 | |
| cd09945 | 98 | cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 | 9e-17 | |
| cd11951 | 53 | cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom | 9e-17 | |
| cd11804 | 52 | cd11804, SH3_GRB2_like_N, N-terminal Src homology | 3e-16 | |
| cd10361 | 90 | cd10361, SH2_Fps_family, Src homology 2 (SH2) doma | 5e-16 | |
| cd10361 | 90 | cd10361, SH2_Fps_family, Src homology 2 (SH2) doma | 5e-16 | |
| cd11947 | 52 | cd11947, SH3_GRAP2_N, N-terminal Src homology 3 do | 6e-16 | |
| cd11841 | 54 | cd11841, SH3_SH3YL1_like, Src homology 3 domain of | 9e-16 | |
| cd11786 | 53 | cd11786, SH3_SH3RF_1, First Src Homology 3 domain | 1e-15 | |
| cd10408 | 97 | cd10408, SH2_Nck1, Src homology 2 (SH2) domain fou | 1e-15 | |
| cd10408 | 97 | cd10408, SH2_Nck1, Src homology 2 (SH2) domain fou | 1e-15 | |
| cd11803 | 55 | cd11803, SH3_Endophilin_A, Src homology 3 domain o | 2e-15 | |
| cd10409 | 98 | cd10409, SH2_Nck2, Src homology 2 (SH2) domain fou | 2e-15 | |
| cd10409 | 98 | cd10409, SH2_Nck2, Src homology 2 (SH2) domain fou | 2e-15 | |
| cd11842 | 55 | cd11842, SH3_Ysc84p_like, Src homology 3 domain of | 2e-15 | |
| cd11769 | 57 | cd11769, SH3_CSK, Src Homology 3 domain of C-termi | 4e-15 | |
| cd11950 | 53 | cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do | 8e-15 | |
| cd11782 | 53 | cd11782, SH3_Sorbs_2, Second Src Homology 3 domain | 1e-14 | |
| cd10347 | 81 | cd10347, SH2_Nterm_shark_like, N-terminal Src homo | 3e-14 | |
| cd10347 | 81 | cd10347, SH2_Nterm_shark_like, N-terminal Src homo | 3e-14 | |
| cd10370 | 96 | cd10370, SH2_Src_Src42, Src homology 2 (SH2) domai | 6e-14 | |
| cd10370 | 96 | cd10370, SH2_Src_Src42, Src homology 2 (SH2) domai | 6e-14 | |
| smart00326 | 56 | smart00326, SH3, Src homology 3 domains | 7e-14 | |
| pfam00018 | 47 | pfam00018, SH3_1, SH3 domain | 9e-14 | |
| cd09940 | 102 | cd09940, SH2_Vav_family, Src homology 2 (SH2) doma | 1e-13 | |
| cd09940 | 102 | cd09940, SH2_Vav_family, Src homology 2 (SH2) doma | 1e-13 | |
| cd10367 | 101 | cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain | 1e-13 | |
| cd10367 | 101 | cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain | 1e-13 | |
| cd11772 | 53 | cd11772, SH3_OSTF1, Src Homology 3 domain of metaz | 2e-13 | |
| cd09931 | 99 | cd09931, SH2_C-SH2_SHP_like, C-terminal Src homolo | 2e-13 | |
| cd09931 | 99 | cd09931, SH2_C-SH2_SHP_like, C-terminal Src homolo | 2e-13 | |
| cd11996 | 54 | cd11996, SH3_Intersectin2_5, Fifth Src homology 3 | 2e-13 | |
| cd11840 | 53 | cd11840, SH3_Intersectin_5, Fifth Src homology 3 d | 3e-13 | |
| cd11823 | 53 | cd11823, SH3_Nostrin, Src homology 3 domain of Nit | 3e-13 | |
| cd10358 | 100 | cd10358, SH2_PTK6_Brk, Src homology 2 domain found | 4e-13 | |
| cd10358 | 100 | cd10358, SH2_PTK6_Brk, Src homology 2 domain found | 4e-13 | |
| cd10360 | 79 | cd10360, SH2_Srm, Src homology 2 (SH2) domain foun | 4e-13 | |
| cd10360 | 79 | cd10360, SH2_Srm, Src homology 2 (SH2) domain foun | 4e-13 | |
| cd10362 | 101 | cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain | 4e-13 | |
| cd10362 | 101 | cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain | 4e-13 | |
| cd11833 | 53 | cd11833, SH3_Stac_1, First C-terminal Src homology | 4e-13 | |
| cd00174 | 51 | cd00174, SH3, Src Homology 3 domain superfamily | 6e-13 | |
| cd10340 | 99 | cd10340, SH2_N-SH2_SHP_like, N-terminal Src homolo | 6e-13 | |
| cd10340 | 99 | cd10340, SH2_N-SH2_SHP_like, N-terminal Src homolo | 6e-13 | |
| cd10392 | 98 | cd10392, SH2_SHF, Src homology 2 domain found in S | 6e-13 | |
| cd10392 | 98 | cd10392, SH2_SHF, Src homology 2 domain found in S | 6e-13 | |
| cd09930 | 104 | cd09930, SH2_cSH2_p85_like, C-terminal Src homolog | 7e-13 | |
| cd09930 | 104 | cd09930, SH2_cSH2_p85_like, C-terminal Src homolog | 7e-13 | |
| cd09937 | 98 | cd09937, SH2_csk_like, Src homology 2 (SH2) domain | 7e-13 | |
| cd09937 | 98 | cd09937, SH2_csk_like, Src homology 2 (SH2) domain | 7e-13 | |
| cd11948 | 54 | cd11948, SH3_GRAP_N, N-terminal Src homology 3 dom | 8e-13 | |
| cd11840 | 53 | cd11840, SH3_Intersectin_5, Fifth Src homology 3 d | 8e-13 | |
| cd11781 | 53 | cd11781, SH3_Sorbs_1, First Src Homology 3 domain | 8e-13 | |
| cd11838 | 52 | cd11838, SH3_Intersectin_3, Third Src homology 3 d | 1e-12 | |
| cd11820 | 54 | cd11820, SH3_STAM, Src homology 3 domain of Signal | 1e-12 | |
| cd10365 | 101 | cd10365, SH2_Src_Src, Src homology 2 (SH2) domain | 2e-12 | |
| cd10365 | 101 | cd10365, SH2_Src_Src, Src homology 2 (SH2) domain | 2e-12 | |
| cd11828 | 53 | cd11828, SH3_ARHGEF9_like, Src homology 3 domain o | 3e-12 | |
| cd11928 | 54 | cd11928, SH3_SH3RF3_1, First Src Homology 3 domain | 4e-12 | |
| cd11821 | 53 | cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP | 5e-12 | |
| cd10390 | 98 | cd10390, SH2_SHD, Src homology 2 domain found in S | 5e-12 | |
| cd10390 | 98 | cd10390, SH2_SHD, Src homology 2 domain found in S | 5e-12 | |
| cd10352 | 91 | cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 | 6e-12 | |
| cd10352 | 91 | cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 | 6e-12 | |
| pfam00018 | 47 | pfam00018, SH3_1, SH3 domain | 7e-12 | |
| cd10351 | 103 | cd10351, SH2_SH2D4B, Src homology 2 domain found i | 7e-12 | |
| cd10351 | 103 | cd10351, SH2_SH2D4B, Src homology 2 domain found i | 7e-12 | |
| pfam07653 | 53 | pfam07653, SH3_2, Variant SH3 domain | 9e-12 | |
| cd09932 | 104 | cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src | 1e-11 | |
| cd09932 | 104 | cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src | 1e-11 | |
| cd10391 | 98 | cd10391, SH2_SHE, Src homology 2 domain found in S | 1e-11 | |
| cd10391 | 98 | cd10391, SH2_SHE, Src homology 2 domain found in S | 1e-11 | |
| cd11964 | 55 | cd11964, SH3_STAM1, Src homology 3 domain of Signa | 1e-11 | |
| cd09946 | 102 | cd09946, SH2_HSH2_like, Src homology 2 domain foun | 1e-11 | |
| cd09946 | 102 | cd09946, SH2_HSH2_like, Src homology 2 domain foun | 1e-11 | |
| cd11927 | 54 | cd11927, SH3_SH3RF1_1, First Src Homology 3 domain | 1e-11 | |
| cd10418 | 101 | cd10418, SH2_Src_Fyn_isoform_a_like, Src homology | 2e-11 | |
| cd10418 | 101 | cd10418, SH2_Src_Fyn_isoform_a_like, Src homology | 2e-11 | |
| cd10355 | 92 | cd10355, SH2_DAPP1_BAM32_like, Src homology 2 doma | 2e-11 | |
| cd10355 | 92 | cd10355, SH2_DAPP1_BAM32_like, Src homology 2 doma | 2e-11 | |
| cd11996 | 54 | cd11996, SH3_Intersectin2_5, Fifth Src homology 3 | 3e-11 | |
| cd11995 | 54 | cd11995, SH3_Intersectin1_5, Fifth Src homology 3 | 3e-11 | |
| cd10337 | 136 | cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in | 3e-11 | |
| cd10337 | 136 | cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in | 3e-11 | |
| cd09923 | 81 | cd09923, SH2_SOCS_family, Src homology 2 (SH2) dom | 3e-11 | |
| cd09923 | 81 | cd09923, SH2_SOCS_family, Src homology 2 (SH2) dom | 3e-11 | |
| cd11985 | 53 | cd11985, SH3_Stac2_C, C-terminal Src homology 3 do | 3e-11 | |
| cd11946 | 56 | cd11946, SH3_GRB2_N, N-terminal Src homology 3 dom | 4e-11 | |
| cd11826 | 52 | cd11826, SH3_Abi, Src homology 3 domain of Abl Int | 4e-11 | |
| cd09925 | 104 | cd09925, SH2_SHC, Src homology 2 (SH2) domain foun | 5e-11 | |
| cd09925 | 104 | cd09925, SH2_SHC, Src homology 2 (SH2) domain foun | 5e-11 | |
| cd10366 | 101 | cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain | 5e-11 | |
| cd10366 | 101 | cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain | 5e-11 | |
| cd09944 | 108 | cd09944, SH2_Grb7_family, Src homology 2 (SH2) dom | 6e-11 | |
| cd09944 | 108 | cd09944, SH2_Grb7_family, Src homology 2 (SH2) dom | 6e-11 | |
| cd11956 | 55 | cd11956, SH3_srGAP4, Src homology 3 domain of Slit | 8e-11 | |
| cd11768 | 54 | cd11768, SH3_Tec_like, Src Homology 3 domain of Te | 9e-11 | |
| cd11995 | 54 | cd11995, SH3_Intersectin1_5, Fifth Src homology 3 | 1e-10 | |
| cd10344 | 104 | cd10344, SH2_SLAP, Src homology 2 domain found in | 1e-10 | |
| cd10344 | 104 | cd10344, SH2_SLAP, Src homology 2 domain found in | 1e-10 | |
| cd11875 | 55 | cd11875, SH3_CD2AP-like_3, Third Src Homology 3 do | 1e-10 | |
| cd11772 | 53 | cd11772, SH3_OSTF1, Src Homology 3 domain of metaz | 2e-10 | |
| cd11827 | 53 | cd11827, SH3_MyoIe_If_like, Src homology 3 domain | 2e-10 | |
| cd11817 | 50 | cd11817, SH3_Eve1_4, Fourth Src homology 3 domain | 2e-10 | |
| cd11870 | 53 | cd11870, SH3_p67phox-like_C, C-terminal Src Homolo | 2e-10 | |
| cd10363 | 104 | cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain | 2e-10 | |
| cd10363 | 104 | cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain | 2e-10 | |
| cd10350 | 103 | cd10350, SH2_SH2D4A, Src homology 2 domain found i | 2e-10 | |
| cd10350 | 103 | cd10350, SH2_SH2D4A, Src homology 2 domain found i | 2e-10 | |
| cd11843 | 53 | cd11843, SH3_PACSIN, Src homology 3 domain of Prot | 3e-10 | |
| cd09934 | 104 | cd09934, SH2_Tec_family, Src homology 2 (SH2) doma | 3e-10 | |
| cd09934 | 104 | cd09934, SH2_Tec_family, Src homology 2 (SH2) doma | 3e-10 | |
| cd11986 | 53 | cd11986, SH3_Stac3_1, First C-terminal Src homolog | 3e-10 | |
| cd10389 | 97 | cd10389, SH2_SHB, Src homology 2 domain found in S | 3e-10 | |
| cd10389 | 97 | cd10389, SH2_SHB, Src homology 2 domain found in S | 3e-10 | |
| cd11762 | 57 | cd11762, SH3_FCHSD_2, Second Src Homology 3 domain | 3e-10 | |
| cd11782 | 53 | cd11782, SH3_Sorbs_2, Second Src Homology 3 domain | 4e-10 | |
| cd10388 | 101 | cd10388, SH2_SOCS7, Src homology 2 (SH2) domain fo | 4e-10 | |
| cd10388 | 101 | cd10388, SH2_SOCS7, Src homology 2 (SH2) domain fo | 4e-10 | |
| cd11809 | 53 | cd11809, SH3_srGAP, Src homology 3 domain of Slit- | 4e-10 | |
| cd11845 | 52 | cd11845, SH3_Src_like, Src homology 3 domain of Sr | 5e-10 | |
| cd11824 | 53 | cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro | 5e-10 | |
| cd11963 | 57 | cd11963, SH3_STAM2, Src homology 3 domain of Signa | 5e-10 | |
| cd11992 | 52 | cd11992, SH3_Intersectin2_3, Third Src homology 3 | 8e-10 | |
| cd10356 | 113 | cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domai | 8e-10 | |
| cd10356 | 113 | cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domai | 8e-10 | |
| cd12142 | 55 | cd12142, SH3_D21-like, Src Homology 3 domain of SH | 9e-10 | |
| cd09938 | 104 | cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src | 9e-10 | |
| cd09938 | 104 | cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src | 9e-10 | |
| cd11769 | 57 | cd11769, SH3_CSK, Src Homology 3 domain of C-termi | 1e-09 | |
| cd10343 | 103 | cd10343, SH2_SHIP, Src homology 2 (SH2) domain fou | 1e-09 | |
| cd10343 | 103 | cd10343, SH2_SHIP, Src homology 2 (SH2) domain fou | 1e-09 | |
| cd11877 | 53 | cd11877, SH3_PIX, Src Homology 3 domain of Pak Int | 1e-09 | |
| cd11920 | 55 | cd11920, SH3_Sorbs2_1, First Src Homology 3 domain | 1e-09 | |
| cd10402 | 105 | cd10402, SH2_C-SH2_Zap70, C-terminal Src homology | 1e-09 | |
| cd10402 | 105 | cd10402, SH2_C-SH2_Zap70, C-terminal Src homology | 1e-09 | |
| cd10405 | 103 | cd10405, SH2_Vav1, Src homology 2 (SH2) domain fou | 1e-09 | |
| cd10405 | 103 | cd10405, SH2_Vav1, Src homology 2 (SH2) domain fou | 1e-09 | |
| cd11961 | 53 | cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src | 1e-09 | |
| cd11809 | 53 | cd11809, SH3_srGAP, Src homology 3 domain of Slit- | 2e-09 | |
| cd10353 | 103 | cd10353, SH2_Nterm_RasGAP, N-terminal Src homology | 2e-09 | |
| cd10353 | 103 | cd10353, SH2_Nterm_RasGAP, N-terminal Src homology | 2e-09 | |
| cd10368 | 101 | cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain | 2e-09 | |
| cd10368 | 101 | cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain | 2e-09 | |
| cd11812 | 52 | cd11812, SH3_AHI-1, Src Homology 3 domain of Abels | 2e-09 | |
| cd11929 | 54 | cd11929, SH3_SH3RF2_1, First Src Homology 3 domain | 2e-09 | |
| cd11849 | 53 | cd11849, SH3_SPIN90, Src homology 3 domain of SH3 | 3e-09 | |
| cd11883 | 55 | cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25 | 3e-09 | |
| cd09926 | 106 | cd09926, SH2_CRK_like, Src homology 2 domain found | 3e-09 | |
| cd09926 | 106 | cd09926, SH2_CRK_like, Src homology 2 domain found | 3e-09 | |
| cd11819 | 54 | cd11819, SH3_Cortactin_like, Src homology 3 domain | 3e-09 | |
| cd11830 | 54 | cd11830, SH3_VAV_2, C-terminal (or second) Src hom | 4e-09 | |
| cd09942 | 110 | cd09942, SH2_nSH2_p85_like, N-terminal Src homolog | 4e-09 | |
| cd09942 | 110 | cd09942, SH2_nSH2_p85_like, N-terminal Src homolog | 4e-09 | |
| cd11864 | 58 | cd11864, SH3_PEX13_eumet, Src Homology 3 domain of | 5e-09 | |
| cd11991 | 52 | cd11991, SH3_Intersectin1_3, Third Src homology 3 | 5e-09 | |
| cd11810 | 50 | cd11810, SH3_RUSC1_like, Src homology 3 domain of | 5e-09 | |
| cd10419 | 101 | cd10419, SH2_Src_Fyn_isoform_b_like, Src homology | 5e-09 | |
| cd10419 | 101 | cd10419, SH2_Src_Fyn_isoform_b_like, Src homology | 5e-09 | |
| cd11856 | 53 | cd11856, SH3_p47phox_like, Src homology 3 domains | 5e-09 | |
| cd11758 | 55 | cd11758, SH3_CRK_N, N-terminal Src Homology 3 doma | 6e-09 | |
| cd10417 | 102 | cd10417, SH2_SH2D7, Src homology 2 domain found in | 6e-09 | |
| cd10417 | 102 | cd10417, SH2_SH2D7, Src homology 2 domain found in | 6e-09 | |
| cd10364 | 101 | cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain | 6e-09 | |
| cd10364 | 101 | cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain | 6e-09 | |
| cd11842 | 55 | cd11842, SH3_Ysc84p_like, Src homology 3 domain of | 7e-09 | |
| cd10349 | 77 | cd10349, SH2_SH2D2A_SH2D7, Src homology 2 domain f | 9e-09 | |
| cd10349 | 77 | cd10349, SH2_SH2D2A_SH2D7, Src homology 2 domain f | 9e-09 | |
| pfam07653 | 53 | pfam07653, SH3_2, Variant SH3 domain | 1e-08 | |
| cd11830 | 54 | cd11830, SH3_VAV_2, C-terminal (or second) Src hom | 1e-08 | |
| cd11758 | 55 | cd11758, SH3_CRK_N, N-terminal Src Homology 3 doma | 1e-08 | |
| cd11771 | 60 | cd11771, SH3_Pex13p_fungal, Src Homology 3 domain | 1e-08 | |
| cd11873 | 53 | cd11873, SH3_CD2AP-like_1, First Src Homology 3 do | 1e-08 | |
| cd11959 | 53 | cd11959, SH3_Cortactin, Src homology 3 domain of C | 1e-08 | |
| cd11813 | 53 | cd11813, SH3_SGSM3, Src Homology 3 domain of Small | 1e-08 | |
| cd10406 | 103 | cd10406, SH2_Vav2, Src homology 2 (SH2) domain fou | 1e-08 | |
| cd10406 | 103 | cd10406, SH2_Vav2, Src homology 2 (SH2) domain fou | 1e-08 | |
| cd11763 | 55 | cd11763, SH3_SNX9_like, Src Homology 3 domain of S | 1e-08 | |
| cd11805 | 53 | cd11805, SH3_GRB2_like_C, C-terminal Src homology | 2e-08 | |
| cd11778 | 51 | cd11778, SH3_Bzz1_2, Second Src Homology 3 domain | 2e-08 | |
| cd12046 | 53 | cd12046, SH3_p67phox_C, C-terminal (or second) Src | 2e-08 | |
| cd11825 | 54 | cd11825, SH3_PLCgamma, Src homology 3 domain of Ph | 2e-08 | |
| cd12073 | 55 | cd12073, SH3_HS1, Src homology 3 domain of Hematop | 2e-08 | |
| cd12047 | 53 | cd12047, SH3_Noxa1_C, C-terminal Src Homology 3 do | 2e-08 | |
| cd11775 | 57 | cd11775, SH3_Sla1p_3, Third Src Homology 3 domain | 2e-08 | |
| cd11875 | 55 | cd11875, SH3_CD2AP-like_3, Third Src Homology 3 do | 3e-08 | |
| cd11877 | 53 | cd11877, SH3_PIX, Src Homology 3 domain of Pak Int | 3e-08 | |
| cd11844 | 56 | cd11844, SH3_CAS, Src homology 3 domain of CAS (Cr | 3e-08 | |
| cd11884 | 56 | cd11884, SH3_MYO15, Src Homology 3 domain of Myosi | 3e-08 | |
| cd11829 | 52 | cd11829, SH3_GAS7, Src homology 3 domain of Growth | 3e-08 | |
| cd11787 | 53 | cd11787, SH3_SH3RF_2, Second Src Homology 3 domain | 3e-08 | |
| cd10341 | 99 | cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src | 3e-08 | |
| cd10341 | 99 | cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src | 3e-08 | |
| cd11843 | 53 | cd11843, SH3_PACSIN, Src homology 3 domain of Prot | 4e-08 | |
| cd11766 | 53 | cd11766, SH3_Nck_2, Second Src Homology 3 domain o | 4e-08 | |
| cd11827 | 53 | cd11827, SH3_MyoIe_If_like, Src homology 3 domain | 5e-08 | |
| cd11907 | 55 | cd11907, SH3_TXK, Src Homology 3 domain of TXK, al | 5e-08 | |
| cd11836 | 55 | cd11836, SH3_Intersectin_1, First Src homology 3 d | 5e-08 | |
| cd11976 | 54 | cd11976, SH3_VAV1_2, C-terminal (or second) Src ho | 6e-08 | |
| cd11818 | 50 | cd11818, SH3_Eve1_5, Fifth Src homology 3 domain o | 6e-08 | |
| cd12054 | 55 | cd12054, SH3_CD2AP_2, Second Src Homology 3 domain | 6e-08 | |
| cd11796 | 51 | cd11796, SH3_DNMBP_N3, Third N-terminal Src homolo | 6e-08 | |
| cd11959 | 53 | cd11959, SH3_Cortactin, Src homology 3 domain of C | 7e-08 | |
| cd12003 | 62 | cd12003, SH3_EFS, Src homology 3 domain of CAS (Cr | 7e-08 | |
| cd11882 | 54 | cd11882, SH3_GRAF-like, Src Homology 3 domain of G | 7e-08 | |
| cd12012 | 62 | cd12012, SH3_RIM-BP_2, Second Src homology 3 domai | 8e-08 | |
| cd10397 | 106 | cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain | 8e-08 | |
| cd10397 | 106 | cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain | 8e-08 | |
| cd11826 | 52 | cd11826, SH3_Abi, Src homology 3 domain of Abl Int | 9e-08 | |
| cd11950 | 53 | cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do | 1e-07 | |
| cd11766 | 53 | cd11766, SH3_Nck_2, Second Src Homology 3 domain o | 1e-07 | |
| cd11808 | 53 | cd11808, SH3_Alpha_Spectrin, Src homology 3 domain | 1e-07 | |
| cd11966 | 56 | cd11966, SH3_ASAP2, Src homology 3 domain of ArfGA | 1e-07 | |
| cd10371 | 100 | cd10371, SH2_Src_Blk, Src homology 2 (SH2) domain | 1e-07 | |
| cd10371 | 100 | cd10371, SH2_Src_Blk, Src homology 2 (SH2) domain | 1e-07 | |
| cd10399 | 106 | cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain | 1e-07 | |
| cd10399 | 106 | cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain | 1e-07 | |
| cd11970 | 60 | cd11970, SH3_PLCgamma1, Src homology 3 domain of P | 1e-07 | |
| cd11866 | 53 | cd11866, SH3_SKAP1-like, Src Homology 3 domain of | 1e-07 | |
| cd11895 | 58 | cd11895, SH3_FCHSD1_2, Second Src Homology 3 domai | 1e-07 | |
| cd11805 | 53 | cd11805, SH3_GRB2_like_C, C-terminal Src homology | 2e-07 | |
| cd11781 | 53 | cd11781, SH3_Sorbs_1, First Src Homology 3 domain | 2e-07 | |
| cd11976 | 54 | cd11976, SH3_VAV1_2, C-terminal (or second) Src ho | 2e-07 | |
| cd11882 | 54 | cd11882, SH3_GRAF-like, Src Homology 3 domain of G | 2e-07 | |
| cd11924 | 56 | cd11924, SH3_Vinexin_2, Second Src Homology 3 doma | 2e-07 | |
| cd11919 | 55 | cd11919, SH3_Sorbs1_1, First Src Homology 3 domain | 2e-07 | |
| cd11770 | 54 | cd11770, SH3_Nephrocystin, Src Homology 3 domain o | 2e-07 | |
| cd11770 | 54 | cd11770, SH3_Nephrocystin, Src Homology 3 domain o | 2e-07 | |
| cd11876 | 58 | cd11876, SH3_MLK, Src Homology 3 domain of Mixed L | 2e-07 | |
| cd12000 | 57 | cd12000, SH3_CASS4, Src homology 3 domain of CAS ( | 2e-07 | |
| cd11977 | 58 | cd11977, SH3_VAV2_2, C-terminal (or second) Src ho | 2e-07 | |
| cd10415 | 108 | cd10415, SH2_Grb10, Src homology 2 (SH2) domain fo | 2e-07 | |
| cd10415 | 108 | cd10415, SH2_Grb10, Src homology 2 (SH2) domain fo | 2e-07 | |
| cd09919 | 115 | cd09919, SH2_STAT_family, Src homology 2 (SH2) dom | 2e-07 | |
| cd09919 | 115 | cd09919, SH2_STAT_family, Src homology 2 (SH2) dom | 2e-07 | |
| cd11999 | 56 | cd11999, SH3_PACSIN_like, Src homology 3 domain of | 2e-07 | |
| cd11851 | 62 | cd11851, SH3_RIM-BP, Src homology 3 domains of Rab | 2e-07 | |
| cd12013 | 61 | cd12013, SH3_RIM-BP_3, Third Src homology 3 domain | 3e-07 | |
| cd12056 | 57 | cd12056, SH3_CD2AP_3, Third Src Homology 3 domain | 3e-07 | |
| cd10383 | 103 | cd10383, SH2_SOCS2, Src homology 2 (SH2) domain fo | 3e-07 | |
| cd10383 | 103 | cd10383, SH2_SOCS2, Src homology 2 (SH2) domain fo | 3e-07 | |
| cd10407 | 103 | cd10407, SH2_Vav3, Src homology 2 (SH2) domain fou | 3e-07 | |
| cd10407 | 103 | cd10407, SH2_Vav3, Src homology 2 (SH2) domain fou | 3e-07 | |
| cd11793 | 55 | cd11793, SH3_ephexin1_like, Src homology 3 domain | 3e-07 | |
| cd12052 | 53 | cd12052, SH3_CIN85_1, First Src Homology 3 domain | 3e-07 | |
| cd11960 | 54 | cd11960, SH3_Abp1_eu, Src homology 3 domain of eum | 3e-07 | |
| cd10413 | 108 | cd10413, SH2_Grb7, Src homology 2 (SH2) domain fou | 3e-07 | |
| cd10413 | 108 | cd10413, SH2_Grb7, Src homology 2 (SH2) domain fou | 3e-07 | |
| cd12061 | 54 | cd12061, SH3_betaPIX, Src Homology 3 domain of bet | 3e-07 | |
| cd12058 | 58 | cd12058, SH3_MLK4, Src Homology 3 domain of Mixed | 3e-07 | |
| cd11773 | 57 | cd11773, SH3_Sla1p_1, First Src Homology 3 domain | 3e-07 | |
| cd11973 | 73 | cd11973, SH3_ASEF, Src homology 3 domain of APC-St | 3e-07 | |
| cd11957 | 52 | cd11957, SH3_RUSC2, Src homology 3 domain of RUN a | 3e-07 | |
| cd11956 | 55 | cd11956, SH3_srGAP4, Src homology 3 domain of Slit | 4e-07 | |
| cd11817 | 50 | cd11817, SH3_Eve1_4, Fourth Src homology 3 domain | 4e-07 | |
| cd12002 | 57 | cd12002, SH3_NEDD9, Src homology 3 domain of CAS ( | 4e-07 | |
| cd12060 | 58 | cd12060, SH3_alphaPIX, Src Homology 3 domain of al | 4e-07 | |
| cd10398 | 106 | cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain | 4e-07 | |
| cd10398 | 106 | cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain | 4e-07 | |
| cd10348 | 86 | cd10348, SH2_Cterm_shark_like, C-terminal Src homo | 4e-07 | |
| cd10348 | 86 | cd10348, SH2_Cterm_shark_like, C-terminal Src homo | 4e-07 | |
| cd10414 | 108 | cd10414, SH2_Grb14, Src homology 2 (SH2) domain fo | 4e-07 | |
| cd10414 | 108 | cd10414, SH2_Grb14, Src homology 2 (SH2) domain fo | 4e-07 | |
| cd11887 | 60 | cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 a | 4e-07 | |
| cd11819 | 54 | cd11819, SH3_Cortactin_like, Src homology 3 domain | 5e-07 | |
| cd12055 | 53 | cd12055, SH3_CIN85_2, Second Src Homology 3 domain | 5e-07 | |
| cd11803 | 55 | cd11803, SH3_Endophilin_A, Src homology 3 domain o | 6e-07 | |
| cd12142 | 55 | cd12142, SH3_D21-like, Src Homology 3 domain of SH | 6e-07 | |
| cd11873 | 53 | cd11873, SH3_CD2AP-like_1, First Src Homology 3 do | 6e-07 | |
| cd11975 | 62 | cd11975, SH3_ARHGEF9, Src homology 3 domain of the | 6e-07 | |
| cd11972 | 61 | cd11972, SH3_Abi2, Src homology 3 domain of Abl In | 6e-07 | |
| cd11965 | 57 | cd11965, SH3_ASAP1, Src homology 3 domain of ArfGA | 6e-07 | |
| cd12073 | 55 | cd12073, SH3_HS1, Src homology 3 domain of Hematop | 7e-07 | |
| cd12013 | 61 | cd12013, SH3_RIM-BP_3, Third Src homology 3 domain | 7e-07 | |
| cd11839 | 58 | cd11839, SH3_Intersectin_4, Fourth Src homology 3 | 7e-07 | |
| cd11989 | 52 | cd11989, SH3_Intersectin1_2, Second Src homology 3 | 7e-07 | |
| cd11916 | 59 | cd11916, SH3_Sorbs1_3, Third (or C-terminal) Src H | 8e-07 | |
| cd12057 | 56 | cd12057, SH3_CIN85_3, Third Src Homology 3 domain | 8e-07 | |
| cd11820 | 54 | cd11820, SH3_STAM, Src homology 3 domain of Signal | 9e-07 | |
| cd11869 | 54 | cd11869, SH3_p40phox, Src Homology 3 domain of the | 9e-07 | |
| cd12001 | 68 | cd12001, SH3_BCAR1, Src homology 3 domain of the C | 9e-07 | |
| cd12141 | 57 | cd12141, SH3_DNMBP_C2, Second C-terminal Src homol | 9e-07 | |
| cd11786 | 53 | cd11786, SH3_SH3RF_1, First Src Homology 3 domain | 1e-06 | |
| cd11845 | 52 | cd11845, SH3_Src_like, Src homology 3 domain of Sr | 1e-06 | |
| cd11824 | 53 | cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro | 1e-06 | |
| cd12061 | 54 | cd12061, SH3_betaPIX, Src Homology 3 domain of bet | 1e-06 | |
| cd11972 | 61 | cd11972, SH3_Abi2, Src homology 3 domain of Abl In | 1e-06 | |
| cd10357 | 87 | cd10357, SH2_ShkD_ShkE, Src homology 2 (SH2) domai | 1e-06 | |
| cd10357 | 87 | cd10357, SH2_ShkD_ShkE, Src homology 2 (SH2) domai | 1e-06 | |
| cd11917 | 61 | cd11917, SH3_Sorbs2_3, Third (or C-terminal) Src H | 1e-06 | |
| cd11974 | 54 | cd11974, SH3_ASEF2, Src homology 3 domain of APC-S | 1e-06 | |
| cd11878 | 54 | cd11878, SH3_Bem1p_1, First Src Homology 3 domain | 1e-06 | |
| cd11978 | 56 | cd11978, SH3_VAV3_2, C-terminal (or second) Src ho | 1e-06 | |
| cd11978 | 56 | cd11978, SH3_VAV3_2, C-terminal (or second) Src ho | 1e-06 | |
| cd11921 | 55 | cd11921, SH3_Vinexin_1, First Src Homology 3 domai | 1e-06 | |
| cd11800 | 57 | cd11800, SH3_DNMBP_C2_like, Second C-terminal Src | 1e-06 | |
| cd11800 | 57 | cd11800, SH3_DNMBP_C2_like, Second C-terminal Src | 1e-06 | |
| cd10346 | 97 | cd10346, SH2_SH2B_family, Src homology 2 (SH2) dom | 1e-06 | |
| cd10346 | 97 | cd10346, SH2_SH2B_family, Src homology 2 (SH2) dom | 1e-06 | |
| cd11778 | 51 | cd11778, SH3_Bzz1_2, Second Src Homology 3 domain | 2e-06 | |
| cd10396 | 108 | cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain | 2e-06 | |
| cd10396 | 108 | cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain | 2e-06 | |
| cd11807 | 57 | cd11807, SH3_ASPP, Src homology 3 domain of Apopto | 2e-06 | |
| cd11806 | 53 | cd11806, SH3_PRMT2, Src homology 3 domain of Prote | 2e-06 | |
| cd11932 | 57 | cd11932, SH3_SH3RF2_2, Second Src Homology 3 domai | 2e-06 | |
| cd11874 | 53 | cd11874, SH3_CD2AP-like_2, Second Src Homology 3 d | 2e-06 | |
| cd12059 | 58 | cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixe | 2e-06 | |
| cd11923 | 57 | cd11923, SH3_Sorbs2_2, Second Src Homology 3 domai | 2e-06 | |
| cd11780 | 55 | cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Ho | 2e-06 | |
| cd11949 | 53 | cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom | 3e-06 | |
| cd12059 | 58 | cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixe | 3e-06 | |
| cd11906 | 55 | cd11906, SH3_BTK, Src Homology 3 domain of Bruton' | 3e-06 | |
| cd11962 | 54 | cd11962, SH3_Abp1_fungi_C1, First C-terminal Src h | 3e-06 | |
| cd11767 | 56 | cd11767, SH3_Nck_3, Third Src Homology 3 domain of | 3e-06 | |
| cd12060 | 58 | cd12060, SH3_alphaPIX, Src Homology 3 domain of al | 4e-06 | |
| cd11774 | 52 | cd11774, SH3_Sla1p_2, Second Src Homology 3 domain | 4e-06 | |
| cd11905 | 56 | cd11905, SH3_Tec, Src Homology 3 domain of Tec (Ty | 4e-06 | |
| cd10384 | 101 | cd10384, SH2_SOCS3, Src homology 2 (SH2) domain fo | 4e-06 | |
| cd10384 | 101 | cd10384, SH2_SOCS3, Src homology 2 (SH2) domain fo | 4e-06 | |
| cd11998 | 56 | cd11998, SH3_PACSIN1-2, Src homology 3 domain of P | 4e-06 | |
| cd11837 | 53 | cd11837, SH3_Intersectin_2, Second Src homology 3 | 4e-06 | |
| cd11794 | 51 | cd11794, SH3_DNMBP_N1, First N-terminal Src homolo | 4e-06 | |
| cd11816 | 51 | cd11816, SH3_Eve1_3, Third Src homology 3 domain o | 4e-06 | |
| cd11990 | 52 | cd11990, SH3_Intersectin2_2, Second Src homology 3 | 4e-06 | |
| cd11947 | 52 | cd11947, SH3_GRAP2_N, N-terminal Src homology 3 do | 5e-06 | |
| cd11823 | 53 | cd11823, SH3_Nostrin, Src homology 3 domain of Nit | 5e-06 | |
| cd11763 | 55 | cd11763, SH3_SNX9_like, Src Homology 3 domain of S | 5e-06 | |
| cd11923 | 57 | cd11923, SH3_Sorbs2_2, Second Src Homology 3 domai | 5e-06 | |
| cd11998 | 56 | cd11998, SH3_PACSIN1-2, Src homology 3 domain of P | 5e-06 | |
| cd11997 | 56 | cd11997, SH3_PACSIN3, Src homology 3 domain of Pro | 5e-06 | |
| cd11922 | 58 | cd11922, SH3_Sorbs1_2, Second Src Homology 3 domai | 5e-06 | |
| cd11797 | 50 | cd11797, SH3_DNMBP_N4, Fourth N-terminal Src homol | 5e-06 | |
| cd10345 | 95 | cd10345, SH2_C-SH2_Zap70_Syk_like, C-terminal Src | 5e-06 | |
| cd10345 | 95 | cd10345, SH2_C-SH2_Zap70_Syk_like, C-terminal Src | 5e-06 | |
| cd12045 | 53 | cd12045, SH3_SKAP2, Src Homology 3 domain of Src K | 5e-06 | |
| cd11878 | 54 | cd11878, SH3_Bem1p_1, First Src Homology 3 domain | 6e-06 | |
| cd11971 | 59 | cd11971, SH3_Abi1, Src homology 3 domain of Abl In | 6e-06 | |
| cd11969 | 55 | cd11969, SH3_PLCgamma2, Src homology 3 domain of P | 6e-06 | |
| cd10400 | 103 | cd10400, SH2_SAP1a, Src homology 2 (SH2) domain fo | 6e-06 | |
| cd10400 | 103 | cd10400, SH2_SAP1a, Src homology 2 (SH2) domain fo | 6e-06 | |
| cd12000 | 57 | cd12000, SH3_CASS4, Src homology 3 domain of CAS ( | 7e-06 | |
| cd11806 | 53 | cd11806, SH3_PRMT2, Src homology 3 domain of Prote | 7e-06 | |
| cd10401 | 99 | cd10401, SH2_C-SH2_Syk_like, C-terminal Src homolo | 7e-06 | |
| cd10401 | 99 | cd10401, SH2_C-SH2_Syk_like, C-terminal Src homolo | 7e-06 | |
| cd11832 | 50 | cd11832, SH3_Shank, Src homology 3 domain of SH3 a | 7e-06 | |
| cd11841 | 54 | cd11841, SH3_SH3YL1_like, Src homology 3 domain of | 8e-06 | |
| cd11844 | 56 | cd11844, SH3_CAS, Src homology 3 domain of CAS (Cr | 8e-06 | |
| cd11767 | 56 | cd11767, SH3_Nck_3, Third Src Homology 3 domain of | 8e-06 | |
| cd11961 | 53 | cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src | 9e-06 | |
| cd11922 | 58 | cd11922, SH3_Sorbs1_2, Second Src Homology 3 domai | 9e-06 | |
| cd11920 | 55 | cd11920, SH3_Sorbs2_1, First Src Homology 3 domain | 1e-05 | |
| cd11812 | 52 | cd11812, SH3_AHI-1, Src Homology 3 domain of Abels | 1e-05 | |
| cd11856 | 53 | cd11856, SH3_p47phox_like, Src homology 3 domains | 1e-05 | |
| cd12052 | 53 | cd12052, SH3_CIN85_1, First Src Homology 3 domain | 1e-05 | |
| cd11971 | 59 | cd11971, SH3_Abi1, Src homology 3 domain of Abl In | 1e-05 | |
| cd12053 | 56 | cd12053, SH3_CD2AP_1, First Src Homology 3 domain | 1e-05 | |
| cd11912 | 55 | cd11912, SH3_Bzz1_1, First Src Homology 3 domain o | 1e-05 | |
| cd12009 | 54 | cd12009, SH3_Blk, Src homology 3 domain of Blk Pro | 1e-05 | |
| cd11791 | 59 | cd11791, SH3_UBASH3, Src homology 3 domain of Ubiq | 1e-05 | |
| cd11897 | 55 | cd11897, SH3_SNX18, Src Homology 3 domain of Sorti | 1e-05 | |
| cd11935 | 58 | cd11935, SH3_Nebulette_C, C-terminal Src Homology | 1e-05 | |
| cd10387 | 100 | cd10387, SH2_SOCS6, Src homology 2 (SH2) domain fo | 1e-05 | |
| cd10387 | 100 | cd10387, SH2_SOCS6, Src homology 2 (SH2) domain fo | 1e-05 | |
| cd12017 | 53 | cd12017, SH3_Tks_3, Third Src homology 3 domain of | 1e-05 | |
| cd10416 | 102 | cd10416, SH2_SH2D2A, Src homology 2 domain found i | 1e-05 | |
| cd10416 | 102 | cd10416, SH2_SH2D2A, Src homology 2 domain found i | 1e-05 | |
| cd11951 | 53 | cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom | 2e-05 | |
| cd11771 | 60 | cd11771, SH3_Pex13p_fungal, Src Homology 3 domain | 2e-05 | |
| cd11876 | 58 | cd11876, SH3_MLK, Src Homology 3 domain of Mixed L | 2e-05 | |
| cd11851 | 62 | cd11851, SH3_RIM-BP, Src homology 3 domains of Rab | 2e-05 | |
| cd11783 | 55 | cd11783, SH3_SH3RF_3, Third Src Homology 3 domain | 2e-05 | |
| cd12004 | 56 | cd12004, SH3_Lyn, Src homology 3 domain of Lyn Pro | 2e-05 | |
| cd11958 | 51 | cd11958, SH3_RUSC1, Src homology 3 domain of RUN a | 2e-05 | |
| cd11855 | 55 | cd11855, SH3_Sho1p, Src homology 3 domain of High | 2e-05 | |
| cd10718 | 88 | cd10718, SH2_CIS, Src homology 2 (SH2) domain foun | 2e-05 | |
| cd10718 | 88 | cd10718, SH2_CIS, Src homology 2 (SH2) domain foun | 2e-05 | |
| cd11858 | 55 | cd11858, SH3_Myosin-I_fungi, Src homology 3 domain | 2e-05 | |
| cd11765 | 51 | cd11765, SH3_Nck_1, First Src Homology 3 domain of | 2e-05 | |
| cd11964 | 55 | cd11964, SH3_STAM1, Src homology 3 domain of Signa | 3e-05 | |
| cd11762 | 57 | cd11762, SH3_FCHSD_2, Second Src Homology 3 domain | 3e-05 | |
| cd11864 | 58 | cd11864, SH3_PEX13_eumet, Src Homology 3 domain of | 3e-05 | |
| cd12003 | 62 | cd12003, SH3_EFS, Src homology 3 domain of CAS (Cr | 3e-05 | |
| cd11866 | 53 | cd11866, SH3_SKAP1-like, Src Homology 3 domain of | 3e-05 | |
| cd11924 | 56 | cd11924, SH3_Vinexin_2, Second Src Homology 3 doma | 3e-05 | |
| cd12057 | 56 | cd12057, SH3_CIN85_3, Third Src Homology 3 domain | 3e-05 | |
| cd11807 | 57 | cd11807, SH3_ASPP, Src homology 3 domain of Apopto | 3e-05 | |
| cd12005 | 54 | cd12005, SH3_Lck, Src homology 3 domain of Lck Pro | 3e-05 | |
| cd12006 | 56 | cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn | 3e-05 | |
| cd11954 | 57 | cd11954, SH3_ASPP1, Src Homology 3 domain of Apopt | 3e-05 | |
| cd11949 | 53 | cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom | 4e-05 | |
| cd11813 | 53 | cd11813, SH3_SGSM3, Src Homology 3 domain of Small | 4e-05 | |
| cd11921 | 55 | cd11921, SH3_Vinexin_1, First Src Homology 3 domai | 4e-05 | |
| cd11862 | 61 | cd11862, SH3_MPP, Src Homology 3 domain of Membran | 4e-05 | |
| cd11955 | 53 | cd11955, SH3_srGAP1-3, Src homology 3 domain of Sl | 4e-05 | |
| cd11815 | 52 | cd11815, SH3_Eve1_2, Second Src homology 3 domain | 4e-05 | |
| cd11818 | 50 | cd11818, SH3_Eve1_5, Fifth Src homology 3 domain o | 5e-05 | |
| cd11906 | 55 | cd11906, SH3_BTK, Src Homology 3 domain of Bruton' | 5e-05 | |
| cd11905 | 56 | cd11905, SH3_Tec, Src Homology 3 domain of Tec (Ty | 5e-05 | |
| cd11997 | 56 | cd11997, SH3_PACSIN3, Src homology 3 domain of Pro | 5e-05 | |
| cd11952 | 56 | cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of | 5e-05 | |
| cd11930 | 55 | cd11930, SH3_SH3RF1_2, Second Src Homology 3 domai | 5e-05 | |
| cd11796 | 51 | cd11796, SH3_DNMBP_N3, Third N-terminal Src homolo | 6e-05 | |
| cd11919 | 55 | cd11919, SH3_Sorbs1_1, First Src Homology 3 domain | 6e-05 | |
| cd12058 | 58 | cd12058, SH3_MLK4, Src Homology 3 domain of Mixed | 6e-05 | |
| cd11952 | 56 | cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of | 6e-05 | |
| cd09927 | 116 | cd09927, SH2_Tensin_like, Src homology 2 domain fo | 6e-05 | |
| cd09927 | 116 | cd09927, SH2_Tensin_like, Src homology 2 domain fo | 6e-05 | |
| cd11953 | 57 | cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of | 6e-05 | |
| cd11879 | 56 | cd11879, SH3_Bem1p_2, Second Src Homology 3 domain | 6e-05 | |
| cd11894 | 56 | cd11894, SH3_FCHSD2_2, Second Src Homology 3 domai | 6e-05 | |
| cd11908 | 56 | cd11908, SH3_ITK, Src Homology 3 domain of Interle | 6e-05 | |
| cd11925 | 57 | cd11925, SH3_SH3RF3_3, Third Src Homology 3 domain | 6e-05 | |
| cd11977 | 58 | cd11977, SH3_VAV2_2, C-terminal (or second) Src ho | 7e-05 | |
| cd11885 | 55 | cd11885, SH3_SH3TC, Src Homology 3 domain of SH3 d | 7e-05 | |
| cd11885 | 55 | cd11885, SH3_SH3TC, Src Homology 3 domain of SH3 d | 8e-05 | |
| cd10411 | 97 | cd10411, SH2_SH2B2, Src homology 2 (SH2) domain fo | 8e-05 | |
| cd10411 | 97 | cd10411, SH2_SH2B2, Src homology 2 (SH2) domain fo | 8e-05 | |
| cd11886 | 55 | cd11886, SH3_BOI, Src Homology 3 domain of fungal | 8e-05 | |
| cd12034 | 61 | cd12034, SH3_MPP4, Src Homology 3 domain of Membra | 8e-05 | |
| cd11918 | 58 | cd11918, SH3_Vinexin_3, Third (or C-terminal) Src | 9e-05 | |
| cd12008 | 56 | cd12008, SH3_Src, Src homology 3 domain of Src Pro | 9e-05 | |
| cd11889 | 53 | cd11889, SH3_Cyk3p-like, Src Homology 3 domain of | 9e-05 | |
| cd11768 | 54 | cd11768, SH3_Tec_like, Src Homology 3 domain of Te | 1e-04 | |
| cd11810 | 50 | cd11810, SH3_RUSC1_like, Src homology 3 domain of | 1e-04 | |
| cd11825 | 54 | cd11825, SH3_PLCgamma, Src homology 3 domain of Ph | 1e-04 | |
| cd11775 | 57 | cd11775, SH3_Sla1p_3, Third Src Homology 3 domain | 1e-04 | |
| cd11773 | 57 | cd11773, SH3_Sla1p_1, First Src Homology 3 domain | 1e-04 | |
| cd11816 | 51 | cd11816, SH3_Eve1_3, Third Src homology 3 domain o | 1e-04 | |
| cd12017 | 53 | cd12017, SH3_Tks_3, Third Src homology 3 domain of | 1e-04 | |
| cd11855 | 55 | cd11855, SH3_Sho1p, Src homology 3 domain of High | 1e-04 | |
| cd11789 | 55 | cd11789, SH3_Nebulin_family_C, C-terminal Src Homo | 1e-04 | |
| cd12036 | 63 | cd12036, SH3_MPP5, Src Homology 3 domain of Membra | 1e-04 | |
| cd11984 | 52 | cd11984, SH3_Shank3, Src homology 3 domain of SH3 | 1e-04 | |
| cd12007 | 58 | cd12007, SH3_Yes, Src homology 3 domain of Yes Pro | 1e-04 | |
| cd12044 | 53 | cd12044, SH3_SKAP1, Src Homology 3 domain of Src K | 1e-04 | |
| cd11931 | 55 | cd11931, SH3_SH3RF3_2, Second Src Homology 3 domai | 1e-04 | |
| cd11963 | 57 | cd11963, SH3_STAM2, Src homology 3 domain of Signa | 2e-04 | |
| cd11999 | 56 | cd11999, SH3_PACSIN_like, Src homology 3 domain of | 2e-04 | |
| cd11793 | 55 | cd11793, SH3_ephexin1_like, Src homology 3 domain | 2e-04 | |
| cd11874 | 53 | cd11874, SH3_CD2AP-like_2, Second Src Homology 3 d | 2e-04 | |
| cd11837 | 53 | cd11837, SH3_Intersectin_2, Second Src homology 3 | 2e-04 | |
| cd11912 | 55 | cd11912, SH3_Bzz1_1, First Src Homology 3 domain o | 2e-04 | |
| cd11862 | 61 | cd11862, SH3_MPP, Src Homology 3 domain of Membran | 2e-04 | |
| cd11894 | 56 | cd11894, SH3_FCHSD2_2, Second Src Homology 3 domai | 2e-04 | |
| cd11835 | 54 | cd11835, SH3_ARHGAP32_33, Src homology 3 domain of | 2e-04 | |
| cd11764 | 54 | cd11764, SH3_Eps8, Src Homology 3 domain of Epider | 2e-04 | |
| cd12039 | 62 | cd12039, SH3_MPP3, Src Homology 3 domain of Membra | 2e-04 | |
| cd11790 | 64 | cd11790, SH3_Amphiphysin, Src Homology 3 domain of | 2e-04 | |
| cd12012 | 62 | cd12012, SH3_RIM-BP_2, Second Src homology 3 domai | 3e-04 | |
| cd11954 | 57 | cd11954, SH3_ASPP1, Src Homology 3 domain of Apopt | 3e-04 | |
| cd11955 | 53 | cd11955, SH3_srGAP1-3, Src homology 3 domain of Sl | 3e-04 | |
| cd11815 | 52 | cd11815, SH3_Eve1_2, Second Src homology 3 domain | 3e-04 | |
| cd11789 | 55 | cd11789, SH3_Nebulin_family_C, C-terminal Src Homo | 3e-04 | |
| cd11933 | 58 | cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 | 3e-04 | |
| cd11850 | 56 | cd11850, SH3_Abl, Src homology 3 domain of the Pro | 3e-04 | |
| cd12033 | 61 | cd12033, SH3_MPP7, Src Homology 3 domain of Membra | 3e-04 | |
| cd11911 | 55 | cd11911, SH3_CIP4-like, Src Homology 3 domain of C | 3e-04 | |
| cd11927 | 54 | cd11927, SH3_SH3RF1_1, First Src Homology 3 domain | 4e-04 | |
| cd11960 | 54 | cd11960, SH3_Abp1_eu, Src homology 3 domain of eum | 4e-04 | |
| cd11900 | 59 | cd11900, SH3_Nck1_1, First Src Homology 3 domain o | 4e-04 | |
| cd12021 | 53 | cd12021, SH3_p47phox_1, First or N-terminal Src ho | 4e-04 | |
| cd11865 | 55 | cd11865, SH3_Nbp2-like, Src Homology 3 domain of S | 4e-04 | |
| cd11795 | 54 | cd11795, SH3_DNMBP_N2, Second N-terminal Src homol | 4e-04 | |
| cd11970 | 60 | cd11970, SH3_PLCgamma1, Src homology 3 domain of P | 5e-04 | |
| cd12001 | 68 | cd12001, SH3_BCAR1, Src homology 3 domain of the C | 5e-04 | |
| cd11962 | 54 | cd11962, SH3_Abp1_fungi_C1, First C-terminal Src h | 5e-04 | |
| cd11934 | 59 | cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 do | 5e-04 | |
| cd11757 | 52 | cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 | 5e-04 | |
| cd11808 | 53 | cd11808, SH3_Alpha_Spectrin, Src homology 3 domain | 6e-04 | |
| cd11958 | 51 | cd11958, SH3_RUSC1, Src homology 3 domain of RUN a | 6e-04 | |
| cd12011 | 55 | cd12011, SH3_SLAP2, Src homology 3 domain of Src-L | 6e-04 | |
| cd12015 | 53 | cd12015, SH3_Tks_1, First Src homology 3 domain of | 6e-04 | |
| cd11926 | 55 | cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain | 6e-04 | |
| cd11904 | 57 | cd11904, SH3_Nck1_3, Third Src Homology 3 domain o | 6e-04 | |
| cd12046 | 53 | cd12046, SH3_p67phox_C, C-terminal (or second) Src | 7e-04 | |
| cd12064 | 56 | cd12064, SH3_GRAF, Src Homology 3 domain of GTPase | 7e-04 | |
| cd11811 | 59 | cd11811, SH3_CHK, Src Homology 3 domain of CSK hom | 7e-04 | |
| cd10342 | 103 | cd10342, SH2_SAP1, Src homology 2 (SH2) domain fou | 7e-04 | |
| cd10342 | 103 | cd10342, SH2_SAP1, Src homology 2 (SH2) domain fou | 7e-04 | |
| cd11928 | 54 | cd11928, SH3_SH3RF3_1, First Src Homology 3 domain | 8e-04 | |
| cd11887 | 60 | cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 a | 8e-04 | |
| cd12045 | 53 | cd12045, SH3_SKAP2, Src Homology 3 domain of Src K | 8e-04 | |
| cd11904 | 57 | cd11904, SH3_Nck1_3, Third Src Homology 3 domain o | 9e-04 | |
| cd11836 | 55 | cd11836, SH3_Intersectin_1, First Src homology 3 d | 0.001 | |
| cd12009 | 54 | cd12009, SH3_Blk, Src homology 3 domain of Blk Pro | 0.001 | |
| cd11935 | 58 | cd11935, SH3_Nebulette_C, C-terminal Src Homology | 0.001 | |
| cd11858 | 55 | cd11858, SH3_Myosin-I_fungi, Src homology 3 domain | 0.001 | |
| cd11953 | 57 | cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of | 0.001 | |
| cd11941 | 57 | cd11941, SH3_ARHGEF37_C2, Second C-terminal Src ho | 0.001 | |
| cd11901 | 55 | cd11901, SH3_Nck1_2, Second Src Homology 3 domain | 0.001 | |
| cd11899 | 58 | cd11899, SH3_Nck2_1, First Src Homology 3 domain o | 0.001 | |
| cd11940 | 55 | cd11940, SH3_ARHGEF5_19, Src homology 3 domain of | 0.001 | |
| smart00326 | 56 | smart00326, SH3, Src homology 3 domains | 0.002 | |
| cd11828 | 53 | cd11828, SH3_ARHGEF9_like, Src homology 3 domain o | 0.002 | |
| cd11870 | 53 | cd11870, SH3_p67phox-like_C, C-terminal Src Homolo | 0.002 | |
| cd12056 | 57 | cd12056, SH3_CD2AP_3, Third Src Homology 3 domain | 0.002 | |
| cd11765 | 51 | cd11765, SH3_Nck_1, First Src Homology 3 domain of | 0.002 | |
| cd12044 | 53 | cd12044, SH3_SKAP1, Src Homology 3 domain of Src K | 0.002 | |
| cd11785 | 55 | cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homo | 0.002 | |
| cd11784 | 55 | cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain | 0.002 | |
| cd12065 | 54 | cd12065, SH3_GRAF2, Src Homology 3 domain of GTPas | 0.002 | |
| cd12014 | 62 | cd12014, SH3_RIM-BP_1, First Src homology 3 domain | 0.002 | |
| cd11788 | 59 | cd11788, SH3_RasGAP, Src Homology 3 domain of Ras | 0.002 | |
| cd11939 | 55 | cd11939, SH3_ephexin1, Src homology 3 domain of th | 0.002 | |
| cd11993 | 65 | cd11993, SH3_Intersectin1_4, Fourth Src homology 3 | 0.002 | |
| cd11847 | 58 | cd11847, SH3_Brk, Src homology 3 domain of Brk (Br | 0.002 | |
| cd10410 | 97 | cd10410, SH2_SH2B1, Src homology 2 (SH2) domain fo | 0.002 | |
| cd10410 | 97 | cd10410, SH2_SH2B1, Src homology 2 (SH2) domain fo | 0.002 | |
| cd11802 | 52 | cd11802, SH3_Endophilin_B, Src homology 3 domain o | 0.002 | |
| cd00174 | 51 | cd00174, SH3, Src Homology 3 domain superfamily | 0.003 | |
| cd11929 | 54 | cd11929, SH3_SH3RF2_1, First Src Homology 3 domain | 0.003 | |
| cd11907 | 55 | cd11907, SH3_TXK, Src Homology 3 domain of TXK, al | 0.003 | |
| cd11774 | 52 | cd11774, SH3_Sla1p_2, Second Src Homology 3 domain | 0.003 | |
| cd11934 | 59 | cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 do | 0.003 | |
| cd09918 | 85 | cd09918, SH2_Nterm_SPT6_like, N-terminal Src homol | 0.003 | |
| cd09918 | 85 | cd09918, SH2_Nterm_SPT6_like, N-terminal Src homol | 0.003 | |
| cd12066 | 55 | cd12066, SH3_GRAF3, Src Homology 3 domain of GTPas | 0.003 | |
| cd12054 | 55 | cd12054, SH3_CD2AP_2, Second Src Homology 3 domain | 0.004 | |
| cd11957 | 52 | cd11957, SH3_RUSC2, Src homology 3 domain of RUN a | 0.004 | |
| cd11839 | 58 | cd11839, SH3_Intersectin_4, Fourth Src homology 3 | 0.004 | |
| cd12033 | 61 | cd12033, SH3_MPP7, Src Homology 3 domain of Membra | 0.004 | |
| cd11901 | 55 | cd11901, SH3_Nck1_2, Second Src Homology 3 domain | 0.004 | |
| cd11871 | 54 | cd11871, SH3_p67phox_N, N-terminal (or first) Src | 0.004 | |
| cd11846 | 55 | cd11846, SH3_Srms, Src homology 3 domain of Srms P | 0.004 | |
| cd10412 | 97 | cd10412, SH2_SH2B3, Src homology 2 (SH2) domain fo | 0.004 | |
| cd10412 | 97 | cd10412, SH2_SH2B3, Src homology 2 (SH2) domain fo | 0.004 | |
| cd11943 | 55 | cd11943, SH3_JIP1, Src homology 3 domain of JNK-in | 0.004 |
| >gnl|CDD|199828 cd09941, SH2_Grb2_like, Src homology 2 domain found in Growth factor receptor-bound protein 2 (Grb2) and similar proteins | Back alignment and domain information |
|---|
Score = 166 bits (422), Expect = 2e-51
Identities = 67/95 (70%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
Query: 56 KNHDWYYGRITRADAERLLSN-KHEGAFLIRVSESSPGDFSLSVKCSDGVQHFKVLRDSS 114
K H W++G+I+RA+AE +L N + +GAFLIR SESSPGDFSLSVK + VQHFKVLRD +
Sbjct: 1 KPHPWFHGKISRAEAEEILMNQRPDGAFLIRESESSPGDFSLSVKFGNDVQHFKVLRDGA 60
Query: 115 GKFFLWVVKFNSLNELVEYHRTASVSRSQDVKLRD 149
GK+FLWVVKFNSLNELV+YHRT SVSR+Q + LRD
Sbjct: 61 GKYFLWVVKFNSLNELVDYHRTTSVSRNQQIFLRD 95
|
The adaptor proteins here include homologs Grb2 in humans, Sex muscle abnormal protein 5 (Sem-5) in Caenorhabditis elegans, and Downstream of receptor kinase (drk) in Drosophila melanogaster. They are composed of one SH2 and two SH3 domains. Grb2/Sem-5/drk regulates the Ras pathway by linking the tyrosine kinases to the Ras guanine nucleotide releasing protein Sos, which converts Ras to the active GTP-bound state. The SH2 domain of Grb2/Sem-5/drk binds class II phosphotyrosyl peptides while its SH3 domain binds to Sos and Sos-derived, proline-rich peptides. Besides it function in Ras signaling, Grb2 is also thought to play a role in apoptosis. Unlike most SH2 structures in which the peptide binds in an extended conformation (such that the +3 peptide residue occupies a hydrophobic pocket in the protein, conferring a modest degree of selectivity), Grb2 forms several hydrogen bonds via main chain atoms with the side chain of +2 Asn. In general SH2 domains are involved in signal transduction. They typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites. Length = 95 |
| >gnl|CDD|199828 cd09941, SH2_Grb2_like, Src homology 2 domain found in Growth factor receptor-bound protein 2 (Grb2) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214585 smart00252, SH2, Src homology 2 domains | Back alignment and domain information |
|---|
| >gnl|CDD|214585 smart00252, SH2, Src homology 2 domains | Back alignment and domain information |
|---|
| >gnl|CDD|215658 pfam00017, SH2, SH2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|215658 pfam00017, SH2, SH2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212879 cd11946, SH3_GRB2_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain | Back alignment and domain information |
|---|
| >gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain | Back alignment and domain information |
|---|
| >gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson murine lymphosarcoma virus (ABL) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson murine lymphosarcoma virus (ABL) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|199831 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain found in the Fyn-related kinase (Frk) | Back alignment and domain information |
|---|
| >gnl|CDD|199831 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain found in the Fyn-related kinase (Frk) | Back alignment and domain information |
|---|
| >gnl|CDD|199827 cd09933, SH2_Src_family, Src homology 2 (SH2) domain found in the Src family of non-receptor tyrosine kinases | Back alignment and domain information |
|---|
| >gnl|CDD|199827 cd09933, SH2_Src_family, Src homology 2 (SH2) domain found in the Src family of non-receptor tyrosine kinases | Back alignment and domain information |
|---|
| >gnl|CDD|214620 smart00326, SH3, Src homology 3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) | Back alignment and domain information |
|---|
| >gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) | Back alignment and domain information |
|---|
| >gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the Nck family | Back alignment and domain information |
|---|
| >gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the Nck family | Back alignment and domain information |
|---|
| >gnl|CDD|198198 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 domain found in SH2 domain-containing adapter proteins B, D, E, and F (SHB, SHD, SHE, SHF) | Back alignment and domain information |
|---|
| >gnl|CDD|198198 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 domain found in SH2 domain-containing adapter proteins B, D, E, and F (SHB, SHD, SHE, SHF) | Back alignment and domain information |
|---|
| >gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198224 cd10361, SH2_Fps_family, Src homology 2 (SH2) domain found in feline sarcoma, Fujinami poultry sarcoma, and fes-related (Fes/Fps/Fer) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198224 cd10361, SH2_Fps_family, Src homology 2 (SH2) domain found in feline sarcoma, Fujinami poultry sarcoma, and fes-related (Fes/Fps/Fer) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212880 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein | Back alignment and domain information |
|---|
| >gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain containing ring finger proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198271 cd10408, SH2_Nck1, Src homology 2 (SH2) domain found in Nck | Back alignment and domain information |
|---|
| >gnl|CDD|198271 cd10408, SH2_Nck1, Src homology 2 (SH2) domain found in Nck | Back alignment and domain information |
|---|
| >gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A | Back alignment and domain information |
|---|
| >gnl|CDD|198272 cd10409, SH2_Nck2, Src homology 2 (SH2) domain found in Nck | Back alignment and domain information |
|---|
| >gnl|CDD|198272 cd10409, SH2_Nck2, Src homology 2 (SH2) domain found in Nck | Back alignment and domain information |
|---|
| >gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|198210 cd10347, SH2_Nterm_shark_like, N-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198210 cd10347, SH2_Nterm_shark_like, N-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198233 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domain found in the Src oncogene at 42A (Src42) | Back alignment and domain information |
|---|
| >gnl|CDD|198233 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domain found in the Src oncogene at 42A (Src42) | Back alignment and domain information |
|---|
| >gnl|CDD|214620 smart00326, SH3, Src homology 3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|215659 pfam00018, SH3_1, SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|198193 cd09940, SH2_Vav_family, Src homology 2 (SH2) domain found in the Vav family | Back alignment and domain information |
|---|
| >gnl|CDD|198193 cd09940, SH2_Vav_family, Src homology 2 (SH2) domain found in the Vav family | Back alignment and domain information |
|---|
| >gnl|CDD|198230 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain found in Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, Fgr | Back alignment and domain information |
|---|
| >gnl|CDD|198230 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain found in Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, Fgr | Back alignment and domain information |
|---|
| >gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|198185 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homology 2 (C-SH2) domain found in SH2 domain Phosphatases (SHP) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198185 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homology 2 (C-SH2) domain found in SH2 domain Phosphatases (SHP) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer | Back alignment and domain information |
|---|
| >gnl|CDD|198221 cd10358, SH2_PTK6_Brk, Src homology 2 domain found in protein-tyrosine kinase-6 (PTK6) which is also known as breast tumor kinase (Brk) | Back alignment and domain information |
|---|
| >gnl|CDD|198221 cd10358, SH2_PTK6_Brk, Src homology 2 domain found in protein-tyrosine kinase-6 (PTK6) which is also known as breast tumor kinase (Brk) | Back alignment and domain information |
|---|
| >gnl|CDD|198223 cd10360, SH2_Srm, Src homology 2 (SH2) domain found in Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristoylation sites (srm) | Back alignment and domain information |
|---|
| >gnl|CDD|198223 cd10360, SH2_Srm, Src homology 2 (SH2) domain found in Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristoylation sites (srm) | Back alignment and domain information |
|---|
| >gnl|CDD|198225 cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain in lymphocyte cell kinase (Lck) | Back alignment and domain information |
|---|
| >gnl|CDD|198225 cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain in lymphocyte cell kinase (Lck) | Back alignment and domain information |
|---|
| >gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing (Stac) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|198203 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homology 2 (N-SH2) domain found in SH2 domain Phosphatases (SHP) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198203 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homology 2 (N-SH2) domain found in SH2 domain Phosphatases (SHP) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198255 cd10392, SH2_SHF, Src homology 2 domain found in SH2 domain-containing adapter protein F (SHF) | Back alignment and domain information |
|---|
| >gnl|CDD|198255 cd10392, SH2_SHF, Src homology 2 domain found in SH2 domain-containing adapter protein F (SHF) | Back alignment and domain information |
|---|
| >gnl|CDD|198184 cd09930, SH2_cSH2_p85_like, C-terminal Src homology 2 (cSH2) domain found in p85 | Back alignment and domain information |
|---|
| >gnl|CDD|198184 cd09930, SH2_cSH2_p85_like, C-terminal Src homology 2 (cSH2) domain found in p85 | Back alignment and domain information |
|---|
| >gnl|CDD|198190 cd09937, SH2_csk_like, Src homology 2 (SH2) domain found in Carboxyl-Terminal Src Kinase (Csk) | Back alignment and domain information |
|---|
| >gnl|CDD|198190 cd09937, SH2_csk_like, Src homology 2 (SH2) domain found in Carboxyl-Terminal Src Kinase (Csk) | Back alignment and domain information |
|---|
| >gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212715 cd11781, SH3_Sorbs_1, First Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules | Back alignment and domain information |
|---|
| >gnl|CDD|198228 cd10365, SH2_Src_Src, Src homology 2 (SH2) domain found in tyrosine kinase sarcoma (Src) | Back alignment and domain information |
|---|
| >gnl|CDD|198228 cd10365, SH2_Src_Src, Src homology 2 (SH2) domain found in tyrosine kinase sarcoma (Src) | Back alignment and domain information |
|---|
| >gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like Rho guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212861 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212755 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198253 cd10390, SH2_SHD, Src homology 2 domain found in SH2 domain-containing adapter proteins D (SHD) | Back alignment and domain information |
|---|
| >gnl|CDD|198253 cd10390, SH2_SHD, Src homology 2 domain found in SH2 domain-containing adapter proteins D (SHD) | Back alignment and domain information |
|---|
| >gnl|CDD|198215 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 (SH2) domain found in alpha2-chimerin and beta2-chimerin proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198215 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 (SH2) domain found in alpha2-chimerin and beta2-chimerin proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215659 pfam00018, SH3_1, SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|198214 cd10351, SH2_SH2D4B, Src homology 2 domain found in the SH2 domain containing protein 4B (SH2D4B) | Back alignment and domain information |
|---|
| >gnl|CDD|198214 cd10351, SH2_SH2D4B, Src homology 2 domain found in the SH2 domain containing protein 4B (SH2D4B) | Back alignment and domain information |
|---|
| >gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2 (C-SH2) domain in Phospholipase C gamma | Back alignment and domain information |
|---|
| >gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2 (C-SH2) domain in Phospholipase C gamma | Back alignment and domain information |
|---|
| >gnl|CDD|198254 cd10391, SH2_SHE, Src homology 2 domain found in SH2 domain-containing adapter protein E (SHE) | Back alignment and domain information |
|---|
| >gnl|CDD|198254 cd10391, SH2_SHE, Src homology 2 domain found in SH2 domain-containing adapter protein E (SHE) | Back alignment and domain information |
|---|
| >gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 | Back alignment and domain information |
|---|
| >gnl|CDD|198199 cd09946, SH2_HSH2_like, Src homology 2 domain found in hematopoietic SH2 (HSH2) protein | Back alignment and domain information |
|---|
| >gnl|CDD|198199 cd09946, SH2_HSH2_like, Src homology 2 domain found in hematopoietic SH2 (HSH2) protein | Back alignment and domain information |
|---|
| >gnl|CDD|212860 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|198281 cd10418, SH2_Src_Fyn_isoform_a_like, Src homology 2 (SH2) domain found in Fyn isoform a like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198281 cd10418, SH2_Src_Fyn_isoform_a_like, Src homology 2 (SH2) domain found in Fyn isoform a like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198218 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 domain found in dual adaptor for phosphotyrosine and 3-phosphoinositides ( DAPP1)/B lymphocyte adaptor molecule of 32 kDa (Bam32)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198218 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 domain found in dual adaptor for phosphotyrosine and 3-phosphoinositides ( DAPP1)/B lymphocyte adaptor molecule of 32 kDa (Bam32)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|198200 cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in the Breast Cancer Anti-estrogen Resistance protein 3 | Back alignment and domain information |
|---|
| >gnl|CDD|198200 cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in the Breast Cancer Anti-estrogen Resistance protein 3 | Back alignment and domain information |
|---|
| >gnl|CDD|198178 cd09923, SH2_SOCS_family, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) family | Back alignment and domain information |
|---|
| >gnl|CDD|198178 cd09923, SH2_SOCS_family, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) family | Back alignment and domain information |
|---|
| >gnl|CDD|212918 cd11985, SH3_Stac2_C, C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 2 (Stac2) | Back alignment and domain information |
|---|
| >gnl|CDD|212879 cd11946, SH3_GRB2_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198179 cd09925, SH2_SHC, Src homology 2 (SH2) domain found in SH2 adaptor protein C (SHC) | Back alignment and domain information |
|---|
| >gnl|CDD|198179 cd09925, SH2_SHC, Src homology 2 (SH2) domain found in SH2 adaptor protein C (SHC) | Back alignment and domain information |
|---|
| >gnl|CDD|198229 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain found in Yes | Back alignment and domain information |
|---|
| >gnl|CDD|198229 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain found in Yes | Back alignment and domain information |
|---|
| >gnl|CDD|198197 cd09944, SH2_Grb7_family, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198197 cd09944, SH2_Grb7_family, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212889 cd11956, SH3_srGAP4, Src homology 3 domain of Slit-Robo GTPase Activating Protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212702 cd11768, SH3_Tec_like, Src Homology 3 domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|198207 cd10344, SH2_SLAP, Src homology 2 domain found in Src-like adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198207 cd10344, SH2_SLAP, Src homology 2 domain found in Src-like adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie, If, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212803 cd11870, SH3_p67phox-like_C, C-terminal Src Homology 3 domain of the p67phox subunit of NADPH oxidase and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198226 cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain found in HCK | Back alignment and domain information |
|---|
| >gnl|CDD|198226 cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain found in HCK | Back alignment and domain information |
|---|
| >gnl|CDD|198213 cd10350, SH2_SH2D4A, Src homology 2 domain found in the SH2 domain containing protein 4A (SH2D4A) | Back alignment and domain information |
|---|
| >gnl|CDD|198213 cd10350, SH2_SH2D4A, Src homology 2 domain found in the SH2 domain containing protein 4A (SH2D4A) | Back alignment and domain information |
|---|
| >gnl|CDD|212777 cd11843, SH3_PACSIN, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198188 cd09934, SH2_Tec_family, Src homology 2 (SH2) domain found in Tec-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198188 cd09934, SH2_Tec_family, Src homology 2 (SH2) domain found in Tec-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 3 (Stac3) | Back alignment and domain information |
|---|
| >gnl|CDD|198252 cd10389, SH2_SHB, Src homology 2 domain found in SH2 domain-containing adapter protein B (SHB) | Back alignment and domain information |
|---|
| >gnl|CDD|198252 cd10389, SH2_SHB, Src homology 2 domain found in SH2 domain-containing adapter protein B (SHB) | Back alignment and domain information |
|---|
| >gnl|CDD|212696 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain of FCH and double SH3 domains proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|198251 cd10388, SH2_SOCS7, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198251 cd10388, SH2_SOCS7, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase Activating Proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212925 cd11992, SH3_Intersectin2_3, Third Src homology 3 domain (or SH3C) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|198219 cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domain found in SH2 domain-bearing protein kinases A and C (ShkA and ShkC) | Back alignment and domain information |
|---|
| >gnl|CDD|198219 cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domain found in SH2 domain-bearing protein kinases A and C (ShkA and ShkC) | Back alignment and domain information |
|---|
| >gnl|CDD|213018 cd12142, SH3_D21-like, Src Homology 3 domain of SH3 domain-containing protein 21 (SH3D21) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198191 cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) and Spleen tyrosine kinase (Syk) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198191 cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) and Spleen tyrosine kinase (Syk) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase | Back alignment and domain information |
|---|
| >gnl|CDD|198206 cd10343, SH2_SHIP, Src homology 2 (SH2) domain found in SH2-containing inositol-5'-phosphatase (SHIP) and SLAM-associated protein (SAP) | Back alignment and domain information |
|---|
| >gnl|CDD|198206 cd10343, SH2_SHIP, Src homology 2 (SH2) domain found in SH2-containing inositol-5'-phosphatase (SHIP) and SLAM-associated protein (SAP) | Back alignment and domain information |
|---|
| >gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive eXchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) | Back alignment and domain information |
|---|
| >gnl|CDD|198265 cd10402, SH2_C-SH2_Zap70, C-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) | Back alignment and domain information |
|---|
| >gnl|CDD|198265 cd10402, SH2_C-SH2_Zap70, C-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) | Back alignment and domain information |
|---|
| >gnl|CDD|198268 cd10405, SH2_Vav1, Src homology 2 (SH2) domain found in the Vav1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198268 cd10405, SH2_Vav1, Src homology 2 (SH2) domain found in the Vav1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase Activating Proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198216 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) | Back alignment and domain information |
|---|
| >gnl|CDD|198216 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) | Back alignment and domain information |
|---|
| >gnl|CDD|198231 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain found in Fyn | Back alignment and domain information |
|---|
| >gnl|CDD|198231 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain found in Fyn | Back alignment and domain information |
|---|
| >gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper integration site-1 (AHI-1) | Back alignment and domain information |
|---|
| >gnl|CDD|212862 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain of SH3 domain containing ring finger 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212783 cd11849, SH3_SPIN90, Src homology 3 domain of SH3 protein interacting with Nck, 90 kDa (SPIN90) | Back alignment and domain information |
|---|
| >gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|198180 cd09926, SH2_CRK_like, Src homology 2 domain found in cancer-related signaling adaptor protein CRK | Back alignment and domain information |
|---|
| >gnl|CDD|198180 cd09926, SH2_CRK_like, Src homology 2 domain found in cancer-related signaling adaptor protein CRK | Back alignment and domain information |
|---|
| >gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain of VAV proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198195 cd09942, SH2_nSH2_p85_like, N-terminal Src homology 2 (nSH2) domain found in p85 | Back alignment and domain information |
|---|
| >gnl|CDD|198195 cd09942, SH2_nSH2_p85_like, N-terminal Src homology 2 (nSH2) domain found in p85 | Back alignment and domain information |
|---|
| >gnl|CDD|212798 cd11864, SH3_PEX13_eumet, Src Homology 3 domain of eumetazoan Peroxisomal biogenesis factor 13 | Back alignment and domain information |
|---|
| >gnl|CDD|212924 cd11991, SH3_Intersectin1_3, Third Src homology 3 domain (or SH3C) of Intersectin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212744 cd11810, SH3_RUSC1_like, Src homology 3 domain of RUN and SH3 domain-containing proteins 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|198282 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 2 (SH2) domain found in Fyn isoform b like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198282 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 2 (SH2) domain found in Fyn isoform b like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199832 cd10417, SH2_SH2D7, Src homology 2 domain found in the SH2 domain containing protein 7 (SH2D7) | Back alignment and domain information |
|---|
| >gnl|CDD|199832 cd10417, SH2_SH2D7, Src homology 2 domain found in the SH2 domain containing protein 7 (SH2D7) | Back alignment and domain information |
|---|
| >gnl|CDD|198227 cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain found in Lyn | Back alignment and domain information |
|---|
| >gnl|CDD|198227 cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain found in Lyn | Back alignment and domain information |
|---|
| >gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199830 cd10349, SH2_SH2D2A_SH2D7, Src homology 2 domain found in the SH2 domain containing protein 2A and 7 (SH2D2A and SH2D7) | Back alignment and domain information |
|---|
| >gnl|CDD|199830 cd10349, SH2_SH2D2A_SH2D7, Src homology 2 domain found in the SH2 domain containing protein 2A and 7 (SH2D2A and SH2D7) | Back alignment and domain information |
|---|
| >gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain of VAV proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal peroxisomal membrane protein Pex13p | Back alignment and domain information |
|---|
| >gnl|CDD|212806 cd11873, SH3_CD2AP-like_1, First Src Homology 3 domain (SH3A) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212892 cd11959, SH3_Cortactin, Src homology 3 domain of Cortactin | Back alignment and domain information |
|---|
| >gnl|CDD|212747 cd11813, SH3_SGSM3, Src Homology 3 domain of Small G protein Signaling Modulator 3 | Back alignment and domain information |
|---|
| >gnl|CDD|198269 cd10406, SH2_Vav2, Src homology 2 (SH2) domain found in the Vav2 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198269 cd10406, SH2_Vav2, Src homology 2 (SH2) domain found in the Vav2 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212712 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain of Bzz1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3 domain of the p67phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|212759 cd11825, SH3_PLCgamma, Src homology 3 domain of Phospholipase C (PLC) gamma | Back alignment and domain information |
|---|
| >gnl|CDD|213006 cd12073, SH3_HS1, Src homology 3 domain of Hematopoietic lineage cell-specific protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212980 cd12047, SH3_Noxa1_C, C-terminal Src Homology 3 domain of NADPH oxidase activator 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212709 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive eXchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212778 cd11844, SH3_CAS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212817 cd11884, SH3_MYO15, Src Homology 3 domain of Myosin XV | Back alignment and domain information |
|---|
| >gnl|CDD|212763 cd11829, SH3_GAS7, Src homology 3 domain of Growth Arrest Specific protein 7 | Back alignment and domain information |
|---|
| >gnl|CDD|212721 cd11787, SH3_SH3RF_2, Second Src Homology 3 domain of SH3 domain containing ring finger proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2 (N-SH2) domain in Phospholipase C gamma | Back alignment and domain information |
|---|
| >gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2 (N-SH2) domain in Phospholipase C gamma | Back alignment and domain information |
|---|
| >gnl|CDD|212777 cd11843, SH3_PACSIN, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie, If, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212840 cd11907, SH3_TXK, Src Homology 3 domain of TXK, also called Resting lymphocyte kinase (Rlk) | Back alignment and domain information |
|---|
| >gnl|CDD|212770 cd11836, SH3_Intersectin_1, First Src homology 3 domain (or SH3A) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain of VAV1 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212752 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212987 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|212730 cd11796, SH3_DNMBP_N3, Third N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba | Back alignment and domain information |
|---|
| >gnl|CDD|212892 cd11959, SH3_Cortactin, Src homology 3 domain of Cortactin | Back alignment and domain information |
|---|
| >gnl|CDD|212936 cd12003, SH3_EFS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Embryonal Fyn-associated Substrate | Back alignment and domain information |
|---|
| >gnl|CDD|212815 cd11882, SH3_GRAF-like, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212945 cd12012, SH3_RIM-BP_2, Second Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198260 cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain found in Tec protein, Bruton's tyrosine kinase (Btk) | Back alignment and domain information |
|---|
| >gnl|CDD|198260 cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain found in Tec protein, Bruton's tyrosine kinase (Btk) | Back alignment and domain information |
|---|
| >gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212742 cd11808, SH3_Alpha_Spectrin, Src homology 3 domain of Alpha Spectrin | Back alignment and domain information |
|---|
| >gnl|CDD|212899 cd11966, SH3_ASAP2, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|198234 cd10371, SH2_Src_Blk, Src homology 2 (SH2) domain found in B lymphoid kinase (Blk) | Back alignment and domain information |
|---|
| >gnl|CDD|198234 cd10371, SH2_Src_Blk, Src homology 2 (SH2) domain found in B lymphoid kinase (Blk) | Back alignment and domain information |
|---|
| >gnl|CDD|198262 cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain found in Tec protein, Bmx | Back alignment and domain information |
|---|
| >gnl|CDD|198262 cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain found in Tec protein, Bmx | Back alignment and domain information |
|---|
| >gnl|CDD|212903 cd11970, SH3_PLCgamma1, Src homology 3 domain of Phospholipase C (PLC) gamma 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212800 cd11866, SH3_SKAP1-like, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212828 cd11895, SH3_FCHSD1_2, Second Src Homology 3 domain of FCH and double SH3 domains protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212715 cd11781, SH3_Sorbs_1, First Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain of VAV1 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212815 cd11882, SH3_GRAF-like, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212857 cd11924, SH3_Vinexin_2, Second Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) | Back alignment and domain information |
|---|
| >gnl|CDD|212852 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin | Back alignment and domain information |
|---|
| >gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin (or Nephrocystin-1) | Back alignment and domain information |
|---|
| >gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin (or Nephrocystin-1) | Back alignment and domain information |
|---|
| >gnl|CDD|212809 cd11876, SH3_MLK, Src Homology 3 domain of Mixed Lineage Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212933 cd12000, SH3_CASS4, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212910 cd11977, SH3_VAV2_2, C-terminal (or second) Src homology 3 domain of VAV2 protein | Back alignment and domain information |
|---|
| >gnl|CDD|198278 cd10415, SH2_Grb10, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 10 (Grb10) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198278 cd10415, SH2_Grb10, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 10 (Grb10) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198175 cd09919, SH2_STAT_family, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) family | Back alignment and domain information |
|---|
| >gnl|CDD|198175 cd09919, SH2_STAT_family, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) family | Back alignment and domain information |
|---|
| >gnl|CDD|212932 cd11999, SH3_PACSIN_like, Src homology 3 domain of an unknown subfamily of proteins with similarity to Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212785 cd11851, SH3_RIM-BP, Src homology 3 domains of Rab3-interacting molecules (RIMs) binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212946 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212989 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|198246 cd10383, SH2_SOCS2, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198246 cd10383, SH2_SOCS2, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198270 cd10407, SH2_Vav3, Src homology 2 (SH2) domain found in the Vav3 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198270 cd10407, SH2_Vav3, Src homology 2 (SH2) domain found in the Vav3 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212727 cd11793, SH3_ephexin1_like, Src homology 3 domain of ephexin-1-like SH3 domain containing Rho guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212985 cd12052, SH3_CIN85_1, First Src Homology 3 domain (SH3A) of Cbl-interacting protein of 85 kDa | Back alignment and domain information |
|---|
| >gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|198276 cd10413, SH2_Grb7, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198276 cd10413, SH2_Grb7, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor | Back alignment and domain information |
|---|
| >gnl|CDD|212991 cd12058, SH3_MLK4, Src Homology 3 domain of Mixed Lineage Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212906 cd11973, SH3_ASEF, Src homology 3 domain of APC-Stimulated guanine nucleotide Exchange Factor | Back alignment and domain information |
|---|
| >gnl|CDD|212890 cd11957, SH3_RUSC2, Src homology 3 domain of RUN and SH3 domain-containing protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212889 cd11956, SH3_srGAP4, Src homology 3 domain of Slit-Robo GTPase Activating Protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212935 cd12002, SH3_NEDD9, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Neural precursor cell Expressed, Developmentally Down-regulated 9 | Back alignment and domain information |
|---|
| >gnl|CDD|212993 cd12060, SH3_alphaPIX, Src Homology 3 domain of alpha-Pak Interactive eXchange factor | Back alignment and domain information |
|---|
| >gnl|CDD|198261 cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain found in Tec protein, Txk | Back alignment and domain information |
|---|
| >gnl|CDD|198261 cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain found in Tec protein, Txk | Back alignment and domain information |
|---|
| >gnl|CDD|198211 cd10348, SH2_Cterm_shark_like, C-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198211 cd10348, SH2_Cterm_shark_like, C-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198277 cd10414, SH2_Grb14, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 14 (Grb14) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198277 cd10414, SH2_Grb14, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 14 (Grb14) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212820 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212988 cd12055, SH3_CIN85_2, Second Src Homology 3 domain (SH3B) of Cbl-interacting protein of 85 kDa | Back alignment and domain information |
|---|
| >gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A | Back alignment and domain information |
|---|
| >gnl|CDD|213018 cd12142, SH3_D21-like, Src Homology 3 domain of SH3 domain-containing protein 21 (SH3D21) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212806 cd11873, SH3_CD2AP-like_1, First Src Homology 3 domain (SH3A) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212908 cd11975, SH3_ARHGEF9, Src homology 3 domain of the Rho guanine nucleotide exchange factor ARHGEF9 | Back alignment and domain information |
|---|
| >gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212898 cd11965, SH3_ASAP1, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|213006 cd12073, SH3_HS1, Src homology 3 domain of Hematopoietic lineage cell-specific protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212946 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212773 cd11839, SH3_Intersectin_4, Fourth Src homology 3 domain (or SH3D) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212922 cd11989, SH3_Intersectin1_2, Second Src homology 3 domain (or SH3B) of Intersectin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212849 cd11916, SH3_Sorbs1_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin | Back alignment and domain information |
|---|
| >gnl|CDD|212990 cd12057, SH3_CIN85_3, Third Src Homology 3 domain (SH3C) of Cbl-interacting protein of 85 kDa | Back alignment and domain information |
|---|
| >gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules | Back alignment and domain information |
|---|
| >gnl|CDD|212802 cd11869, SH3_p40phox, Src Homology 3 domain of the p40phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|212934 cd12001, SH3_BCAR1, Src homology 3 domain of the CAS (Crk-Associated Substrate) scaffolding protein family member, Breast Cancer Anti-estrogen Resistance 1 | Back alignment and domain information |
|---|
| >gnl|CDD|213017 cd12141, SH3_DNMBP_C2, Second C-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain containing ring finger proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor | Back alignment and domain information |
|---|
| >gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|198220 cd10357, SH2_ShkD_ShkE, Src homology 2 (SH2) domain found in SH2 domain-bearing protein kinases D and E (ShkD and ShkE) | Back alignment and domain information |
|---|
| >gnl|CDD|198220 cd10357, SH2_ShkD_ShkE, Src homology 2 (SH2) domain found in SH2 domain-bearing protein kinases D and E (ShkD and ShkE) | Back alignment and domain information |
|---|
| >gnl|CDD|212850 cd11917, SH3_Sorbs2_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) | Back alignment and domain information |
|---|
| >gnl|CDD|212907 cd11974, SH3_ASEF2, Src homology 3 domain of APC-Stimulated guanine nucleotide Exchange Factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212811 cd11878, SH3_Bem1p_1, First Src Homology 3 domain of Bud emergence protein 1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212911 cd11978, SH3_VAV3_2, C-terminal (or second) Src homology 3 domain of VAV3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212911 cd11978, SH3_VAV3_2, C-terminal (or second) Src homology 3 domain of VAV3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212854 cd11921, SH3_Vinexin_1, First Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) | Back alignment and domain information |
|---|
| >gnl|CDD|212734 cd11800, SH3_DNMBP_C2_like, Second C-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212734 cd11800, SH3_DNMBP_C2_like, Second C-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|198209 cd10346, SH2_SH2B_family, Src homology 2 (SH2) domain found in SH2B adapter protein family | Back alignment and domain information |
|---|
| >gnl|CDD|198209 cd10346, SH2_SH2B_family, Src homology 2 (SH2) domain found in SH2B adapter protein family | Back alignment and domain information |
|---|
| >gnl|CDD|212712 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain of Bzz1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|198259 cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain found in Tec protein, IL2-inducible T-cell kinase (Itk) | Back alignment and domain information |
|---|
| >gnl|CDD|198259 cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain found in Tec protein, IL2-inducible T-cell kinase (Itk) | Back alignment and domain information |
|---|
| >gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating of p53 proteins (ASPP) | Back alignment and domain information |
|---|
| >gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine N-methyltransferase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212865 cd11932, SH3_SH3RF2_2, Second Src Homology 3 domain of SH3 domain containing ring finger 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212992 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixed Lineage Kinases 1, 2, and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212856 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) | Back alignment and domain information |
|---|
| >gnl|CDD|212714 cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212992 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixed Lineage Kinases 1, 2, and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212839 cd11906, SH3_BTK, Src Homology 3 domain of Bruton's tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212895 cd11962, SH3_Abp1_fungi_C1, First C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212993 cd12060, SH3_alphaPIX, Src Homology 3 domain of alpha-Pak Interactive eXchange factor | Back alignment and domain information |
|---|
| >gnl|CDD|212708 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212838 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Tyrosine kinase expressed in hepatocellular carcinoma) | Back alignment and domain information |
|---|
| >gnl|CDD|198247 cd10384, SH2_SOCS3, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198247 cd10384, SH2_SOCS3, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212931 cd11998, SH3_PACSIN1-2, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 1 (PACSIN1) and PACSIN 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212771 cd11837, SH3_Intersectin_2, Second Src homology 3 domain (or SH3B) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212728 cd11794, SH3_DNMBP_N1, First N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba | Back alignment and domain information |
|---|
| >gnl|CDD|212750 cd11816, SH3_Eve1_3, Third Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212923 cd11990, SH3_Intersectin2_2, Second Src homology 3 domain (or SH3B) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212880 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer | Back alignment and domain information |
|---|
| >gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212856 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) | Back alignment and domain information |
|---|
| >gnl|CDD|212931 cd11998, SH3_PACSIN1-2, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 1 (PACSIN1) and PACSIN 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212930 cd11997, SH3_PACSIN3, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 3 (PACSIN3) | Back alignment and domain information |
|---|
| >gnl|CDD|212855 cd11922, SH3_Sorbs1_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin | Back alignment and domain information |
|---|
| >gnl|CDD|212731 cd11797, SH3_DNMBP_N4, Fourth N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba | Back alignment and domain information |
|---|
| >gnl|CDD|198208 cd10345, SH2_C-SH2_Zap70_Syk_like, C-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) and Spleen tyrosine kinase (Syk) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198208 cd10345, SH2_C-SH2_Zap70_Syk_like, C-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) and Spleen tyrosine kinase (Syk) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212978 cd12045, SH3_SKAP2, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212811 cd11878, SH3_Bem1p_1, First Src Homology 3 domain of Bud emergence protein 1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212904 cd11971, SH3_Abi1, Src homology 3 domain of Abl Interactor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212902 cd11969, SH3_PLCgamma2, Src homology 3 domain of Phospholipase C (PLC) gamma 2 | Back alignment and domain information |
|---|
| >gnl|CDD|198263 cd10400, SH2_SAP1a, Src homology 2 (SH2) domain found in SLAM-associated protein (SAP) 1a | Back alignment and domain information |
|---|
| >gnl|CDD|198263 cd10400, SH2_SAP1a, Src homology 2 (SH2) domain found in SLAM-associated protein (SAP) 1a | Back alignment and domain information |
|---|
| >gnl|CDD|212933 cd12000, SH3_CASS4, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine N-methyltransferase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|198264 cd10401, SH2_C-SH2_Syk_like, C-terminal Src homology 2 (SH2) domain found in Spleen tyrosine kinase (Syk) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198264 cd10401, SH2_C-SH2_Syk_like, C-terminal Src homology 2 (SH2) domain found in Spleen tyrosine kinase (Syk) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212766 cd11832, SH3_Shank, Src homology 3 domain of SH3 and multiple ankyrin repeat domains (Shank) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein | Back alignment and domain information |
|---|
| >gnl|CDD|212778 cd11844, SH3_CAS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212855 cd11922, SH3_Sorbs1_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin | Back alignment and domain information |
|---|
| >gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) | Back alignment and domain information |
|---|
| >gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper integration site-1 (AHI-1) | Back alignment and domain information |
|---|
| >gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212985 cd12052, SH3_CIN85_1, First Src Homology 3 domain (SH3A) of Cbl-interacting protein of 85 kDa | Back alignment and domain information |
|---|
| >gnl|CDD|212904 cd11971, SH3_Abi1, Src homology 3 domain of Abl Interactor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212986 cd12053, SH3_CD2AP_1, First Src Homology 3 domain (SH3A) of CD2-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|212845 cd11912, SH3_Bzz1_1, First Src Homology 3 domain of Bzz1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212942 cd12009, SH3_Blk, Src homology 3 domain of Blk Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212725 cd11791, SH3_UBASH3, Src homology 3 domain of Ubiquitin-associated and SH3 domain-containing proteins, also called TULA (T cell Ubiquitin LigAnd) family of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212830 cd11897, SH3_SNX18, Src Homology 3 domain of Sorting nexin 18 | Back alignment and domain information |
|---|
| >gnl|CDD|212868 cd11935, SH3_Nebulette_C, C-terminal Src Homology 3 domain of Nebulette and LIM-nebulette (or Lasp2) | Back alignment and domain information |
|---|
| >gnl|CDD|198250 cd10387, SH2_SOCS6, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198250 cd10387, SH2_SOCS6, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212950 cd12017, SH3_Tks_3, Third Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198279 cd10416, SH2_SH2D2A, Src homology 2 domain found in the SH2 domain containing protein 2A (SH2D2A) | Back alignment and domain information |
|---|
| >gnl|CDD|198279 cd10416, SH2_SH2D2A, Src homology 2 domain found in the SH2 domain containing protein 2A (SH2D2A) | Back alignment and domain information |
|---|
| >gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal peroxisomal membrane protein Pex13p | Back alignment and domain information |
|---|
| >gnl|CDD|212809 cd11876, SH3_MLK, Src Homology 3 domain of Mixed Lineage Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212785 cd11851, SH3_RIM-BP, Src homology 3 domains of Rab3-interacting molecules (RIMs) binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212717 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212937 cd12004, SH3_Lyn, Src homology 3 domain of Lyn Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212891 cd11958, SH3_RUSC1, Src homology 3 domain of RUN and SH3 domain-containing protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212789 cd11855, SH3_Sho1p, Src homology 3 domain of High osmolarity signaling protein Sho1p | Back alignment and domain information |
|---|
| >gnl|CDD|198285 cd10718, SH2_CIS, Src homology 2 (SH2) domain found in cytokine-inducible SH2-containing protein (CIS) | Back alignment and domain information |
|---|
| >gnl|CDD|198285 cd10718, SH2_CIS, Src homology 2 (SH2) domain found in cytokine-inducible SH2-containing protein (CIS) | Back alignment and domain information |
|---|
| >gnl|CDD|212792 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain of Type I fungal Myosins | Back alignment and domain information |
|---|
| >gnl|CDD|212699 cd11765, SH3_Nck_1, First Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212696 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain of FCH and double SH3 domains proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212798 cd11864, SH3_PEX13_eumet, Src Homology 3 domain of eumetazoan Peroxisomal biogenesis factor 13 | Back alignment and domain information |
|---|
| >gnl|CDD|212936 cd12003, SH3_EFS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Embryonal Fyn-associated Substrate | Back alignment and domain information |
|---|
| >gnl|CDD|212800 cd11866, SH3_SKAP1-like, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212857 cd11924, SH3_Vinexin_2, Second Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) | Back alignment and domain information |
|---|
| >gnl|CDD|212990 cd12057, SH3_CIN85_3, Third Src Homology 3 domain (SH3C) of Cbl-interacting protein of 85 kDa | Back alignment and domain information |
|---|
| >gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating of p53 proteins (ASPP) | Back alignment and domain information |
|---|
| >gnl|CDD|212938 cd12005, SH3_Lck, Src homology 3 domain of Lck Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212887 cd11954, SH3_ASPP1, Src Homology 3 domain of Apoptosis Stimulating of p53 protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212747 cd11813, SH3_SGSM3, Src Homology 3 domain of Small G protein Signaling Modulator 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212854 cd11921, SH3_Vinexin_1, First Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) | Back alignment and domain information |
|---|
| >gnl|CDD|212796 cd11862, SH3_MPP, Src Homology 3 domain of Membrane Protein, Palmitoylated (or MAGUK p55 subfamily member) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212888 cd11955, SH3_srGAP1-3, Src homology 3 domain of Slit-Robo GTPase Activating Proteins 1, 2, and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212749 cd11815, SH3_Eve1_2, Second Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212752 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212839 cd11906, SH3_BTK, Src Homology 3 domain of Bruton's tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212838 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Tyrosine kinase expressed in hepatocellular carcinoma) | Back alignment and domain information |
|---|
| >gnl|CDD|212930 cd11997, SH3_PACSIN3, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 3 (PACSIN3) | Back alignment and domain information |
|---|
| >gnl|CDD|212885 cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of Inhibitor of ASPP protein (iASPP) | Back alignment and domain information |
|---|
| >gnl|CDD|212863 cd11930, SH3_SH3RF1_2, Second Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212730 cd11796, SH3_DNMBP_N3, Third N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba | Back alignment and domain information |
|---|
| >gnl|CDD|212852 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin | Back alignment and domain information |
|---|
| >gnl|CDD|212991 cd12058, SH3_MLK4, Src Homology 3 domain of Mixed Lineage Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212885 cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of Inhibitor of ASPP protein (iASPP) | Back alignment and domain information |
|---|
| >gnl|CDD|198181 cd09927, SH2_Tensin_like, Src homology 2 domain found in Tensin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198181 cd09927, SH2_Tensin_like, Src homology 2 domain found in Tensin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212886 cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of Apoptosis Stimulating of p53 protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212812 cd11879, SH3_Bem1p_2, Second Src Homology 3 domain of Bud emergence protein 1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212827 cd11894, SH3_FCHSD2_2, Second Src Homology 3 domain of FCH and double SH3 domains protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212841 cd11908, SH3_ITK, Src Homology 3 domain of Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212858 cd11925, SH3_SH3RF3_3, Third Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212910 cd11977, SH3_VAV2_2, C-terminal (or second) Src homology 3 domain of VAV2 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212818 cd11885, SH3_SH3TC, Src Homology 3 domain of SH3 domain and tetratricopeptide repeat-containing (SH3TC) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212818 cd11885, SH3_SH3TC, Src Homology 3 domain of SH3 domain and tetratricopeptide repeat-containing (SH3TC) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|198274 cd10411, SH2_SH2B2, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) | Back alignment and domain information |
|---|
| >gnl|CDD|198274 cd10411, SH2_SH2B2, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) | Back alignment and domain information |
|---|
| >gnl|CDD|212819 cd11886, SH3_BOI, Src Homology 3 domain of fungal BOI-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212967 cd12034, SH3_MPP4, Src Homology 3 domain of Membrane Protein, Palmitoylated 4 (or MAGUK p55 subfamily member 4) | Back alignment and domain information |
|---|
| >gnl|CDD|212851 cd11918, SH3_Vinexin_3, Third (or C-terminal) Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) | Back alignment and domain information |
|---|
| >gnl|CDD|212941 cd12008, SH3_Src, Src homology 3 domain of Src Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212822 cd11889, SH3_Cyk3p-like, Src Homology 3 domain of Cytokinesis protein 3 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212702 cd11768, SH3_Tec_like, Src Homology 3 domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212744 cd11810, SH3_RUSC1_like, Src homology 3 domain of RUN and SH3 domain-containing proteins 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212759 cd11825, SH3_PLCgamma, Src homology 3 domain of Phospholipase C (PLC) gamma | Back alignment and domain information |
|---|
| >gnl|CDD|212709 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212750 cd11816, SH3_Eve1_3, Third Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212950 cd12017, SH3_Tks_3, Third Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212789 cd11855, SH3_Sho1p, Src homology 3 domain of High osmolarity signaling protein Sho1p | Back alignment and domain information |
|---|
| >gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain of the Nebulin family of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212969 cd12036, SH3_MPP5, Src Homology 3 domain of Membrane Protein, Palmitoylated 5 (or MAGUK p55 subfamily member 5) | Back alignment and domain information |
|---|
| >gnl|CDD|212917 cd11984, SH3_Shank3, Src homology 3 domain of SH3 and multiple ankyrin repeat domains protein 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212940 cd12007, SH3_Yes, Src homology 3 domain of Yes Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212977 cd12044, SH3_SKAP1, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212864 cd11931, SH3_SH3RF3_2, Second Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212932 cd11999, SH3_PACSIN_like, Src homology 3 domain of an unknown subfamily of proteins with similarity to Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212727 cd11793, SH3_ephexin1_like, Src homology 3 domain of ephexin-1-like SH3 domain containing Rho guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212771 cd11837, SH3_Intersectin_2, Second Src homology 3 domain (or SH3B) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212845 cd11912, SH3_Bzz1_1, First Src Homology 3 domain of Bzz1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212796 cd11862, SH3_MPP, Src Homology 3 domain of Membrane Protein, Palmitoylated (or MAGUK p55 subfamily member) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212827 cd11894, SH3_FCHSD2_2, Second Src Homology 3 domain of FCH and double SH3 domains protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212769 cd11835, SH3_ARHGAP32_33, Src homology 3 domain of Rho GTPase-activating proteins 32 and 33, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212698 cd11764, SH3_Eps8, Src Homology 3 domain of Epidermal growth factor receptor kinase substrate 8 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212972 cd12039, SH3_MPP3, Src Homology 3 domain of Membrane Protein, Palmitoylated 3 (or MAGUK p55 subfamily member 3) | Back alignment and domain information |
|---|
| >gnl|CDD|212724 cd11790, SH3_Amphiphysin, Src Homology 3 domain of Amphiphysin and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|212945 cd12012, SH3_RIM-BP_2, Second Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212887 cd11954, SH3_ASPP1, Src Homology 3 domain of Apoptosis Stimulating of p53 protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212888 cd11955, SH3_srGAP1-3, Src homology 3 domain of Slit-Robo GTPase Activating Proteins 1, 2, and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212749 cd11815, SH3_Eve1_2, Second Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain of the Nebulin family of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212866 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 domain of Nebulin | Back alignment and domain information |
|---|
| >gnl|CDD|212784 cd11850, SH3_Abl, Src homology 3 domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212966 cd12033, SH3_MPP7, Src Homology 3 domain of Membrane Protein, Palmitoylated 7 (or MAGUK p55 subfamily member 7) | Back alignment and domain information |
|---|
| >gnl|CDD|212844 cd11911, SH3_CIP4-like, Src Homology 3 domain of Cdc42-Interacting Protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212860 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212833 cd11900, SH3_Nck1_1, First Src Homology 3 domain of Nck1 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212954 cd12021, SH3_p47phox_1, First or N-terminal Src homology 3 domain of the p47phox subunit of NADPH oxidase, also called Neutrophil Cytosolic Factor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212799 cd11865, SH3_Nbp2-like, Src Homology 3 domain of Saccharomyces cerevisiae Nap1-binding protein 2 and similar fungal proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212729 cd11795, SH3_DNMBP_N2, Second N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba | Back alignment and domain information |
|---|
| >gnl|CDD|212903 cd11970, SH3_PLCgamma1, Src homology 3 domain of Phospholipase C (PLC) gamma 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212934 cd12001, SH3_BCAR1, Src homology 3 domain of the CAS (Crk-Associated Substrate) scaffolding protein family member, Breast Cancer Anti-estrogen Resistance 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212895 cd11962, SH3_Abp1_fungi_C1, First C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212867 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 domain of LIM and SH3 domain protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212691 cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 domain-binding protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212742 cd11808, SH3_Alpha_Spectrin, Src homology 3 domain of Alpha Spectrin | Back alignment and domain information |
|---|
| >gnl|CDD|212891 cd11958, SH3_RUSC1, Src homology 3 domain of RUN and SH3 domain-containing protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212944 cd12011, SH3_SLAP2, Src homology 3 domain of Src-Like Adaptor Protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212948 cd12015, SH3_Tks_1, First Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212859 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212837 cd11904, SH3_Nck1_3, Third Src Homology 3 domain of Nck1 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3 domain of the p67phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|212997 cd12064, SH3_GRAF, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212745 cd11811, SH3_CHK, Src Homology 3 domain of CSK homologous kinase | Back alignment and domain information |
|---|
| >gnl|CDD|198205 cd10342, SH2_SAP1, Src homology 2 (SH2) domain found in SLAM-associated protein (SAP)1 | Back alignment and domain information |
|---|
| >gnl|CDD|198205 cd10342, SH2_SAP1, Src homology 2 (SH2) domain found in SLAM-associated protein (SAP)1 | Back alignment and domain information |
|---|
| >gnl|CDD|212861 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212820 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212978 cd12045, SH3_SKAP2, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212837 cd11904, SH3_Nck1_3, Third Src Homology 3 domain of Nck1 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212770 cd11836, SH3_Intersectin_1, First Src homology 3 domain (or SH3A) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212942 cd12009, SH3_Blk, Src homology 3 domain of Blk Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212868 cd11935, SH3_Nebulette_C, C-terminal Src Homology 3 domain of Nebulette and LIM-nebulette (or Lasp2) | Back alignment and domain information |
|---|
| >gnl|CDD|212792 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain of Type I fungal Myosins | Back alignment and domain information |
|---|
| >gnl|CDD|212886 cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of Apoptosis Stimulating of p53 protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212874 cd11941, SH3_ARHGEF37_C2, Second C-terminal Src homology 3 domain of Rho guanine nucleotide exchange factor 37 | Back alignment and domain information |
|---|
| >gnl|CDD|212834 cd11901, SH3_Nck1_2, Second Src Homology 3 domain of Nck1 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212832 cd11899, SH3_Nck2_1, First Src Homology 3 domain of Nck2 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212873 cd11940, SH3_ARHGEF5_19, Src homology 3 domain of the Rho guanine nucleotide exchange factors ARHGEF5 and ARHGEF19 | Back alignment and domain information |
|---|
| >gnl|CDD|214620 smart00326, SH3, Src homology 3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like Rho guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212803 cd11870, SH3_p67phox-like_C, C-terminal Src Homology 3 domain of the p67phox subunit of NADPH oxidase and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212989 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|212699 cd11765, SH3_Nck_1, First Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212977 cd12044, SH3_SKAP1, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212719 cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212718 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain of SH3 domain containing ring finger 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212998 cd12065, SH3_GRAF2, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212947 cd12014, SH3_RIM-BP_1, First Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212722 cd11788, SH3_RasGAP, Src Homology 3 domain of Ras GTPase-Activating Protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212872 cd11939, SH3_ephexin1, Src homology 3 domain of the Rho guanine nucleotide exchange factor, ephexin-1 (also called NGEF or ARHGEF27) | Back alignment and domain information |
|---|
| >gnl|CDD|212926 cd11993, SH3_Intersectin1_4, Fourth Src homology 3 domain (or SH3D) of Intersectin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212781 cd11847, SH3_Brk, Src homology 3 domain of Brk (Breast tumor kinase) Protein Tyrosine Kinase (PTK), also called PTK6 | Back alignment and domain information |
|---|
| >gnl|CDD|198273 cd10410, SH2_SH2B1, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) | Back alignment and domain information |
|---|
| >gnl|CDD|198273 cd10410, SH2_SH2B1, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) | Back alignment and domain information |
|---|
| >gnl|CDD|212736 cd11802, SH3_Endophilin_B, Src homology 3 domain of Endophilin-B | Back alignment and domain information |
|---|
| >gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|212862 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain of SH3 domain containing ring finger 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212840 cd11907, SH3_TXK, Src Homology 3 domain of TXK, also called Resting lymphocyte kinase (Rlk) | Back alignment and domain information |
|---|
| >gnl|CDD|212708 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212867 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 domain of LIM and SH3 domain protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|198174 cd09918, SH2_Nterm_SPT6_like, N-terminal Src homology 2 (SH2) domain found in Spt6 | Back alignment and domain information |
|---|
| >gnl|CDD|198174 cd09918, SH2_Nterm_SPT6_like, N-terminal Src homology 2 (SH2) domain found in Spt6 | Back alignment and domain information |
|---|
| >gnl|CDD|212999 cd12066, SH3_GRAF3, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212987 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|212890 cd11957, SH3_RUSC2, Src homology 3 domain of RUN and SH3 domain-containing protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212773 cd11839, SH3_Intersectin_4, Fourth Src homology 3 domain (or SH3D) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212966 cd12033, SH3_MPP7, Src Homology 3 domain of Membrane Protein, Palmitoylated 7 (or MAGUK p55 subfamily member 7) | Back alignment and domain information |
|---|
| >gnl|CDD|212834 cd11901, SH3_Nck1_2, Second Src Homology 3 domain of Nck1 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212804 cd11871, SH3_p67phox_N, N-terminal (or first) Src Homology 3 domain of the p67phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|212780 cd11846, SH3_Srms, Src homology 3 domain of Srms Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|198275 cd10412, SH2_SH2B3, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) | Back alignment and domain information |
|---|
| >gnl|CDD|198275 cd10412, SH2_SH2B3, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) | Back alignment and domain information |
|---|
| >gnl|CDD|212876 cd11943, SH3_JIP1, Src homology 3 domain of JNK-interacting protein 1 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 376 | |||
| KOG4226|consensus | 379 | 100.0 | ||
| KOG1264|consensus | 1267 | 100.0 | ||
| KOG3601|consensus | 222 | 100.0 | ||
| KOG4278|consensus | 1157 | 100.0 | ||
| KOG0790|consensus | 600 | 99.95 | ||
| KOG2996|consensus | 865 | 99.95 | ||
| KOG0197|consensus | 468 | 99.95 | ||
| KOG2996|consensus | 865 | 99.94 | ||
| KOG4226|consensus | 379 | 99.94 | ||
| KOG4637|consensus | 464 | 99.94 | ||
| KOG1029|consensus | 1118 | 99.93 | ||
| KOG3601|consensus | 222 | 99.92 | ||
| KOG4278|consensus | 1157 | 99.91 | ||
| KOG4792|consensus | 293 | 99.89 | ||
| KOG4225|consensus | 489 | 99.86 | ||
| cd00173 | 94 | SH2 Src homology 2 domains; Signal transduction, i | 99.85 | |
| KOG4792|consensus | 293 | 99.85 | ||
| smart00252 | 84 | SH2 Src homology 2 domains. Src homology 2 domains | 99.85 | |
| KOG4348|consensus | 627 | 99.84 | ||
| KOG4348|consensus | 627 | 99.84 | ||
| KOG1264|consensus | 1267 | 99.83 | ||
| PF00017 | 77 | SH2: SH2 domain; InterPro: IPR000980 The Src homol | 99.82 | |
| KOG1029|consensus | 1118 | 99.82 | ||
| KOG0197|consensus | 468 | 99.79 | ||
| KOG0194|consensus | 474 | 99.69 | ||
| KOG4637|consensus | 464 | 99.68 | ||
| KOG4225|consensus | 489 | 99.65 | ||
| PF14604 | 49 | SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 | 99.63 | |
| smart00252 | 84 | SH2 Src homology 2 domains. Src homology 2 domains | 99.61 | |
| PF00017 | 77 | SH2: SH2 domain; InterPro: IPR000980 The Src homol | 99.58 | |
| cd00173 | 94 | SH2 Src homology 2 domains; Signal transduction, i | 99.57 | |
| PF14604 | 49 | SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 | 99.45 | |
| PF07653 | 55 | SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 | 99.45 | |
| PF00018 | 48 | SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho | 99.38 | |
| KOG3632|consensus | 1335 | 99.33 | ||
| KOG0790|consensus | 600 | 99.26 | ||
| KOG2199|consensus | 462 | 99.23 | ||
| PF07653 | 55 | SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 | 99.21 | |
| smart00326 | 58 | SH3 Src homology 3 domains. Src homology 3 (SH3) d | 99.18 | |
| KOG2070|consensus | 661 | 99.18 | ||
| cd00174 | 54 | SH3 Src homology 3 domains; SH3 domains bind to pr | 99.16 | |
| KOG2199|consensus | 462 | 99.15 | ||
| KOG1930|consensus | 483 | 99.12 | ||
| KOG1118|consensus | 366 | 99.11 | ||
| PF00018 | 48 | SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho | 99.11 | |
| KOG2070|consensus | 661 | 98.99 | ||
| KOG0515|consensus | 752 | 98.94 | ||
| KOG1118|consensus | 366 | 98.86 | ||
| cd00174 | 54 | SH3 Src homology 3 domains; SH3 domains bind to pr | 98.83 | |
| smart00326 | 58 | SH3 Src homology 3 domains. Src homology 3 (SH3) d | 98.8 | |
| PF14633 | 220 | SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ | 98.73 | |
| KOG0162|consensus | 1106 | 98.71 | ||
| KOG2546|consensus | 483 | 98.68 | ||
| KOG3875|consensus | 362 | 98.49 | ||
| KOG2856|consensus | 472 | 98.34 | ||
| KOG0515|consensus | 752 | 98.33 | ||
| KOG1930|consensus | 483 | 98.32 | ||
| KOG2546|consensus | 483 | 98.28 | ||
| KOG0194|consensus | 474 | 98.23 | ||
| KOG3697|consensus | 345 | 98.17 | ||
| KOG3875|consensus | 362 | 98.01 | ||
| KOG3751|consensus | 622 | 97.97 | ||
| KOG3655|consensus | 484 | 97.94 | ||
| KOG1702|consensus | 264 | 97.9 | ||
| KOG2528|consensus | 490 | 97.8 | ||
| KOG3523|consensus | 695 | 97.75 | ||
| KOG1843|consensus | 473 | 97.75 | ||
| PF14633 | 220 | SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ | 97.72 | |
| KOG1856|consensus | 1299 | 97.71 | ||
| KOG3557|consensus | 721 | 97.7 | ||
| KOG2222|consensus | 848 | 97.66 | ||
| KOG3771|consensus | 460 | 97.41 | ||
| KOG3632|consensus | 1335 | 97.4 | ||
| KOG4773|consensus | 386 | 97.34 | ||
| KOG4773|consensus | 386 | 97.27 | ||
| KOG0609|consensus | 542 | 97.24 | ||
| KOG4575|consensus | 874 | 97.2 | ||
| KOG2222|consensus | 848 | 97.11 | ||
| KOG3523|consensus | 695 | 97.05 | ||
| KOG3751|consensus | 622 | 96.67 | ||
| KOG3557|consensus | 721 | 96.51 | ||
| KOG4429|consensus | 421 | 96.45 | ||
| PF08239 | 55 | SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S | 96.4 | |
| KOG4566|consensus | 258 | 96.35 | ||
| KOG0609|consensus | 542 | 96.24 | ||
| KOG3565|consensus | 640 | 96.23 | ||
| KOG3775|consensus | 482 | 96.08 | ||
| KOG1451|consensus | 812 | 95.91 | ||
| KOG2528|consensus | 490 | 95.86 | ||
| KOG3771|consensus | 460 | 95.76 | ||
| KOG4575|consensus | 874 | 95.76 | ||
| KOG3508|consensus | 932 | 95.63 | ||
| KOG3697|consensus | 345 | 95.41 | ||
| KOG3725|consensus | 375 | 95.13 | ||
| PF14603 | 89 | hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. | 95.1 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 95.06 | |
| smart00287 | 63 | SH3b Bacterial SH3 domain homologues. | 94.55 | |
| KOG3775|consensus | 482 | 94.52 | ||
| KOG0199|consensus | 1039 | 94.33 | ||
| PF14603 | 89 | hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. | 93.62 | |
| KOG1856|consensus | 1299 | 93.26 | ||
| KOG0040|consensus | 2399 | 93.02 | ||
| PF06347 | 55 | SH3_4: Bacterial SH3 domain; InterPro: IPR010466 S | 92.14 | |
| PF08239 | 55 | SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S | 91.82 | |
| KOG0040|consensus | 2399 | 90.34 | ||
| KOG0199|consensus | 1039 | 90.05 | ||
| COG3103 | 205 | SH3 domain protein [Signal transduction mechanisms | 89.53 | |
| KOG3565|consensus | 640 | 89.38 | ||
| smart00287 | 63 | SH3b Bacterial SH3 domain homologues. | 88.7 | |
| KOG4566|consensus | 258 | 87.84 | ||
| KOG3812|consensus | 475 | 87.17 | ||
| PF02762 | 86 | Cbl_N3: CBL proto-oncogene N-terminus, SH2-like do | 86.83 | |
| KOG0162|consensus | 1106 | 86.32 | ||
| KOG3705|consensus | 580 | 86.3 | ||
| KOG2856|consensus | 472 | 86.08 | ||
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 84.39 | |
| PRK13914 | 481 | invasion associated secreted endopeptidase; Provis | 83.42 | |
| KOG3705|consensus | 580 | 82.24 | ||
| PF12913 | 54 | SH3_6: SH3 domain of the SH3b1 type; PDB: 3M1U_B. | 81.96 |
| >KOG4226|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.7e-44 Score=298.80 Aligned_cols=256 Identities=33% Similarity=0.576 Sum_probs=198.8
Q ss_pred CEEEEeecCCCCCCCCccccCCCEEEEEeccCCccceeeccCCccceeccccccccccccccccCCHHHHHHHhcCCCCc
Q psy10189 1 MEAIAKHDFNATAEDELSFRKSQVLKILNMEDDMNWYRAELDGKEGLIPSNYIEMKNHDWYYGRITRADAERLLSNKHEG 80 (376)
Q Consensus 1 ~~~~al~~y~~~~~~eLsf~~Gd~i~v~~~~~~~~W~~~~~~g~~G~vP~nyve~~~~~w~~g~isr~~ae~~l~~~~~G 80 (376)
|.+++.|.|+|+.++||++-+|+.|.|+++ ..+|||.|..+|+.||||+||+...... .....+
T Consensus 108 t~AvVKf~Y~a~~eDELsLtKGtrv~vmEK-ssDGWWrG~~ng~VGWFPSNYv~E~~ds---------------~~gd~~ 171 (379)
T KOG4226|consen 108 TPAVVKFNYVAEREDELSLTKGTRVTVMEK-SSDGWWRGSYNGQVGWFPSNYVTEEVDS---------------AAGDSP 171 (379)
T ss_pred CceEEEEeeccccccccccccCcEEEEEEe-ccCcceecccCCeeccccccceehhccc---------------cccCCc
Confidence 358899999999999999999999999998 6679999999999999999999743321 001223
Q ss_pred cEEEeecC----CCCCceEEEEEeCCeeEEEEEEEcCCCcEEEeceeecchhhhHhhhhcccccccccccccCCCchhhh
Q psy10189 81 AFLIRVSE----SSPGDFSLSVKCSDGVQHFKVLRDSSGKFFLWVVKFNSLNELVEYHRTASVSRSQDVKLRDMVPEECL 156 (376)
Q Consensus 81 ~flvR~s~----~~~~~~~Ls~~~~~~v~h~~I~~~~~~~~~~~~~~f~sl~~li~~~~~~~~~~~~~~~~~~~~~~~~~ 156 (376)
+|+-+... +.++.++| ..
T Consensus 172 s~~~~~~~A~a~n~~~s~vl----------------------------------------------------------~v 193 (379)
T KOG4226|consen 172 SFLSLRKAASASNGQGSRVL----------------------------------------------------------HV 193 (379)
T ss_pred cceecchhhcccCCCCceEE----------------------------------------------------------EE
Confidence 33322110 00010110 24
Q ss_pred hhhcccCCCCCCCceeccCCCEEEEEec--CCCcceeeee-CCeeeeeecccccccccCcchhhhc----cCCCCCCccc
Q psy10189 157 VQALYDFTPQEPGELEFRRGDVITVTDR--SDQHWWHGEI-GARKGLFPATYILNMEDDMNWYRAE----LDGKEGLIPS 229 (376)
Q Consensus 157 ~~al~~~~~~~~~eL~~~~g~~i~v~~~--~~~~w~~~~~-~~~~G~~P~~~v~~~~~~~~~~~~~----~~~~~g~~p~ 229 (376)
+.|||.|.+..+.||+|.+|+.+.|+++ .+++||.++. +|++|+||.|||..+..++.--.+. .....|.-|+
T Consensus 194 VvaLYsFsssndeELsFeKGerleivd~Pe~DPdWwkarn~~G~vGLVPrNYv~vl~d~~~ts~~~~~s~~pq~sgn~p~ 273 (379)
T KOG4226|consen 194 VVALYSFSSSNDEELSFEKGERLEIVDKPENDPDWWKARNARGQVGLVPRNYVVVLSDGPSTSKALHPSHAPQISGNGPS 273 (379)
T ss_pred EEEEecccCCChhhcccccCceeEeccCCCCCchHHhhcccCCccceeecceEEEeccCccccccCCccccccccCCCCC
Confidence 6799999999999999999999999987 5778999995 8999999999999876543221111 1123444455
Q ss_pred cccccccccccccccChHHHHHhhc-CCCCCceEEeecCCCCCceEEEEEeCCeeEEEEEEEcCCCcEEEeccccCCHHH
Q psy10189 230 NYIEMKNHDWYYGRITRADAERLLS-NKHEGAFLIRVSESSPGDFSLSVKCSDGVQHFKVLRDSSGKFFLWVVKFNSLNE 308 (376)
Q Consensus 230 ~~~~~~~~~w~~g~i~r~~ae~~L~-~~~~G~flvR~s~~~~~~~~ls~~~~~~v~h~~I~~~~~~~~~~~~~~f~sl~~ 308 (376)
....+...|||+|.|+|.+||..|. ...+|.||||+|++++|+|++|++..++-+||++.. .++-|.|+.+.|-++.+
T Consensus 274 ~sg~~ag~~WYyG~itR~qae~~Ln~hG~eGdFLiRDSEsnpgD~SvSlka~grNKHFkVq~-~d~~ycIGqRkF~tmd~ 352 (379)
T KOG4226|consen 274 SSGRFAGRPWYYGNITRHQAECALNEHGHEGDFLIRDSESNPGDFSVSLKASGRNKHFKVQL-VDNVYCIGQRKFHTMDE 352 (379)
T ss_pred ccccccCCcceeccccHHHHHHHHhccCccCceEEecCCCCCcceeEEeeccCCCcceEEEE-ecceEEeccceeccHHH
Confidence 4445788999999999999999996 467899999999999999999999999999999965 56889999999999999
Q ss_pred HHHHHhhCCcCCcc---eeeeCCCCC
Q psy10189 309 LVEYHRTASVSRSQ---DVKLRDMVP 331 (376)
Q Consensus 309 lv~~y~~~~~~~~~---~~~L~~p~~ 331 (376)
||+||++.++..+. .+-|..++|
T Consensus 353 Lv~HY~kaPIfts~qgEKLyLvr~Lp 378 (379)
T KOG4226|consen 353 LVEHYKKAPIFTSEQGEKLYLVRALP 378 (379)
T ss_pred HHHhhhcCCceecCCCceEEEeccCC
Confidence 99999999887653 333444443
|
|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG4637|consensus | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >KOG4225|consensus | Back alignment and domain information |
|---|
| >cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >smart00252 SH2 Src homology 2 domains | Back alignment and domain information |
|---|
| >KOG4348|consensus | Back alignment and domain information |
|---|
| >KOG4348|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >KOG0194|consensus | Back alignment and domain information |
|---|
| >KOG4637|consensus | Back alignment and domain information |
|---|
| >KOG4225|consensus | Back alignment and domain information |
|---|
| >PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A | Back alignment and domain information |
|---|
| >smart00252 SH2 Src homology 2 domains | Back alignment and domain information |
|---|
| >PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] | Back alignment and domain information |
|---|
| >cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) | Back alignment and domain information |
|---|
| >PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A | Back alignment and domain information |
|---|
| >PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >KOG2199|consensus | Back alignment and domain information |
|---|
| >PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >smart00326 SH3 Src homology 3 domains | Back alignment and domain information |
|---|
| >KOG2070|consensus | Back alignment and domain information |
|---|
| >cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies | Back alignment and domain information |
|---|
| >KOG2199|consensus | Back alignment and domain information |
|---|
| >KOG1930|consensus | Back alignment and domain information |
|---|
| >KOG1118|consensus | Back alignment and domain information |
|---|
| >PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG2070|consensus | Back alignment and domain information |
|---|
| >KOG0515|consensus | Back alignment and domain information |
|---|
| >KOG1118|consensus | Back alignment and domain information |
|---|
| >cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies | Back alignment and domain information |
|---|
| >smart00326 SH3 Src homology 3 domains | Back alignment and domain information |
|---|
| >PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A | Back alignment and domain information |
|---|
| >KOG0162|consensus | Back alignment and domain information |
|---|
| >KOG2546|consensus | Back alignment and domain information |
|---|
| >KOG3875|consensus | Back alignment and domain information |
|---|
| >KOG2856|consensus | Back alignment and domain information |
|---|
| >KOG0515|consensus | Back alignment and domain information |
|---|
| >KOG1930|consensus | Back alignment and domain information |
|---|
| >KOG2546|consensus | Back alignment and domain information |
|---|
| >KOG0194|consensus | Back alignment and domain information |
|---|
| >KOG3697|consensus | Back alignment and domain information |
|---|
| >KOG3875|consensus | Back alignment and domain information |
|---|
| >KOG3751|consensus | Back alignment and domain information |
|---|
| >KOG3655|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG2528|consensus | Back alignment and domain information |
|---|
| >KOG3523|consensus | Back alignment and domain information |
|---|
| >KOG1843|consensus | Back alignment and domain information |
|---|
| >PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A | Back alignment and domain information |
|---|
| >KOG1856|consensus | Back alignment and domain information |
|---|
| >KOG3557|consensus | Back alignment and domain information |
|---|
| >KOG2222|consensus | Back alignment and domain information |
|---|
| >KOG3771|consensus | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >KOG4773|consensus | Back alignment and domain information |
|---|
| >KOG4773|consensus | Back alignment and domain information |
|---|
| >KOG0609|consensus | Back alignment and domain information |
|---|
| >KOG4575|consensus | Back alignment and domain information |
|---|
| >KOG2222|consensus | Back alignment and domain information |
|---|
| >KOG3523|consensus | Back alignment and domain information |
|---|
| >KOG3751|consensus | Back alignment and domain information |
|---|
| >KOG3557|consensus | Back alignment and domain information |
|---|
| >KOG4429|consensus | Back alignment and domain information |
|---|
| >PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG4566|consensus | Back alignment and domain information |
|---|
| >KOG0609|consensus | Back alignment and domain information |
|---|
| >KOG3565|consensus | Back alignment and domain information |
|---|
| >KOG3775|consensus | Back alignment and domain information |
|---|
| >KOG1451|consensus | Back alignment and domain information |
|---|
| >KOG2528|consensus | Back alignment and domain information |
|---|
| >KOG3771|consensus | Back alignment and domain information |
|---|
| >KOG4575|consensus | Back alignment and domain information |
|---|
| >KOG3508|consensus | Back alignment and domain information |
|---|
| >KOG3697|consensus | Back alignment and domain information |
|---|
| >KOG3725|consensus | Back alignment and domain information |
|---|
| >PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >smart00287 SH3b Bacterial SH3 domain homologues | Back alignment and domain information |
|---|
| >KOG3775|consensus | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A | Back alignment and domain information |
|---|
| >KOG1856|consensus | Back alignment and domain information |
|---|
| >KOG0040|consensus | Back alignment and domain information |
|---|
| >PF06347 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG0040|consensus | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >COG3103 SH3 domain protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3565|consensus | Back alignment and domain information |
|---|
| >smart00287 SH3b Bacterial SH3 domain homologues | Back alignment and domain information |
|---|
| >KOG4566|consensus | Back alignment and domain information |
|---|
| >KOG3812|consensus | Back alignment and domain information |
|---|
| >PF02762 Cbl_N3: CBL proto-oncogene N-terminus, SH2-like domain; InterPro: IPR014742 Cbl (Casitas B-lineage lymphoma) is an adaptor protein that functions as a negative regulator of many signalling pathways that start from receptors at the cell surface | Back alignment and domain information |
|---|
| >KOG0162|consensus | Back alignment and domain information |
|---|
| >KOG3705|consensus | Back alignment and domain information |
|---|
| >KOG2856|consensus | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK13914 invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >KOG3705|consensus | Back alignment and domain information |
|---|
| >PF12913 SH3_6: SH3 domain of the SH3b1 type; PDB: 3M1U_B | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 376 | ||||
| 1gri_A | 217 | Grb2 Length = 217 | 6e-76 | ||
| 1gri_A | 217 | Grb2 Length = 217 | 2e-56 | ||
| 1bmb_A | 123 | Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-9 | 1e-40 | ||
| 1bmb_A | 123 | Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-9 | 1e-40 | ||
| 1bm2_A | 117 | Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acet | 2e-38 | ||
| 1bm2_A | 117 | Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acet | 2e-38 | ||
| 1fyr_A | 114 | Dimer Formation Through Domain Swapping In The Crys | 3e-37 | ||
| 1fyr_A | 114 | Dimer Formation Through Domain Swapping In The Crys | 3e-37 | ||
| 3n84_A | 112 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 4e-36 | ||
| 3n84_A | 112 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 4e-36 | ||
| 3ove_A | 117 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 4e-36 | ||
| 3ove_A | 117 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 4e-36 | ||
| 3imd_A | 117 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 4e-36 | ||
| 3imd_A | 117 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 4e-36 | ||
| 1fhs_A | 112 | The Three-Dimensional Solution Structure Of The Src | 5e-36 | ||
| 1fhs_A | 112 | The Three-Dimensional Solution Structure Of The Src | 5e-36 | ||
| 2h46_E | 116 | Native Domain-Swapped Dimer Crystal Structure Of Th | 8e-36 | ||
| 2h46_E | 116 | Native Domain-Swapped Dimer Crystal Structure Of Th | 8e-36 | ||
| 2aoa_A | 99 | Crystal Structures Of A High-affinity Macrocyclic P | 5e-34 | ||
| 2aoa_A | 99 | Crystal Structures Of A High-affinity Macrocyclic P | 5e-34 | ||
| 1tze_E | 98 | Signal Transduction Adaptor Growth Factor, Grb2 Sh2 | 5e-34 | ||
| 1tze_E | 98 | Signal Transduction Adaptor Growth Factor, Grb2 Sh2 | 5e-34 | ||
| 3mxc_A | 101 | Structures Of Grb2-Sh2 Domain And Aicd Peptide Comp | 6e-34 | ||
| 3mxc_A | 101 | Structures Of Grb2-Sh2 Domain And Aicd Peptide Comp | 6e-34 | ||
| 1x0n_A | 104 | Nmr Structure Of Growth Factor Receptor Binding Pro | 1e-33 | ||
| 1x0n_A | 104 | Nmr Structure Of Growth Factor Receptor Binding Pro | 1e-33 | ||
| 1zfp_E | 98 | Growth Factor Receptor Binding Protein Sh2 Domain C | 2e-33 | ||
| 1zfp_E | 98 | Growth Factor Receptor Binding Protein Sh2 Domain C | 2e-33 | ||
| 1cj1_A | 96 | Growth Factor Receptor Binding Protein Sh2 Domain ( | 7e-33 | ||
| 1cj1_A | 96 | Growth Factor Receptor Binding Protein Sh2 Domain ( | 7e-33 | ||
| 1ghu_A | 107 | Nmr Solution Structure Of Growth Factor Receptor-Bo | 9e-33 | ||
| 1ghu_A | 107 | Nmr Solution Structure Of Growth Factor Receptor-Bo | 9e-33 | ||
| 1jyq_A | 96 | Xray Structure Of Grb2 Sh2 Domain Complexed With A | 3e-32 | ||
| 1jyq_A | 96 | Xray Structure Of Grb2 Sh2 Domain Complexed With A | 3e-32 | ||
| 2a36_A | 59 | Solution Structure Of The N-Terminal Sh3 Domain Of | 1e-26 | ||
| 2a36_A | 59 | Solution Structure Of The N-Terminal Sh3 Domain Of | 3e-13 | ||
| 2a37_A | 59 | Solution Structure Of The T22g Mutant Of N-Terminal | 2e-26 | ||
| 2a37_A | 59 | Solution Structure Of The T22g Mutant Of N-Terminal | 4e-14 | ||
| 1r1p_A | 100 | Structural Basis For Differential Recognition Of Ty | 1e-24 | ||
| 1r1p_A | 100 | Structural Basis For Differential Recognition Of Ty | 1e-24 | ||
| 1k9a_A | 450 | Crystal Structure Analysis Of Full-Length Carboxyl- | 1e-24 | ||
| 1k9a_A | 450 | Crystal Structure Analysis Of Full-Length Carboxyl- | 5e-18 | ||
| 1opl_A | 537 | Structural Basis For The Auto-Inhibition Of C-Abl T | 8e-22 | ||
| 1opl_A | 537 | Structural Basis For The Auto-Inhibition Of C-Abl T | 6e-17 | ||
| 2fo0_A | 495 | Organization Of The Sh3-Sh2 Unit In Active And Inac | 8e-22 | ||
| 2fo0_A | 495 | Organization Of The Sh3-Sh2 Unit In Active And Inac | 6e-17 | ||
| 2abl_A | 163 | Sh3-Sh2 Domain Fragment Of Human Bcr-Abl Tyrosine K | 8e-22 | ||
| 2abl_A | 163 | Sh3-Sh2 Domain Fragment Of Human Bcr-Abl Tyrosine K | 7e-17 | ||
| 1opk_A | 495 | Structural Basis For The Auto-Inhibition Of C-Abl T | 8e-22 | ||
| 1opk_A | 495 | Structural Basis For The Auto-Inhibition Of C-Abl T | 6e-17 | ||
| 2h8h_A | 535 | Src Kinase In Complex With A Quinazoline Inhibitor | 3e-19 | ||
| 2h8h_A | 535 | Src Kinase In Complex With A Quinazoline Inhibitor | 3e-16 | ||
| 1ksw_A | 452 | Structure Of Human C-Src Tyrosine Kinase (Thr338gly | 3e-19 | ||
| 1ksw_A | 452 | Structure Of Human C-Src Tyrosine Kinase (Thr338gly | 2e-16 | ||
| 1fmk_A | 452 | Crystal Structure Of Human Tyrosine-Protein Kinase | 3e-19 | ||
| 1fmk_A | 452 | Crystal Structure Of Human Tyrosine-Protein Kinase | 2e-16 | ||
| 1y57_A | 452 | Structure Of Unphosphorylated C-Src In Complex With | 3e-19 | ||
| 1y57_A | 452 | Structure Of Unphosphorylated C-Src In Complex With | 2e-16 | ||
| 4gbq_A | 74 | Solution Nmr Structure Of The Grb2 N-Terminal Sh3 D | 1e-18 | ||
| 4gbq_A | 74 | Solution Nmr Structure Of The Grb2 N-Terminal Sh3 D | 2e-09 | ||
| 2ptk_A | 453 | Chicken Src Tyrosine Kinase Length = 453 | 2e-18 | ||
| 2ptk_A | 453 | Chicken Src Tyrosine Kinase Length = 453 | 7e-16 | ||
| 1g83_A | 165 | Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | 4e-18 | ||
| 1g83_A | 165 | Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | 4e-15 | ||
| 3uf4_A | 164 | Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn P | 1e-17 | ||
| 3uf4_A | 164 | Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn P | 1e-14 | ||
| 2dvj_A | 230 | Phosphorylated Crk-Ii Length = 230 | 1e-16 | ||
| 2dvj_A | 230 | Phosphorylated Crk-Ii Length = 230 | 9e-09 | ||
| 1aze_A | 56 | Nmr Structure Of The Complex Between The C32s-Y7v M | 1e-16 | ||
| 1aze_A | 56 | Nmr Structure Of The Complex Between The C32s-Y7v M | 2e-07 | ||
| 2eyz_A | 304 | Ct10-Regulated Kinase Isoform Ii Length = 304 | 3e-16 | ||
| 2eyz_A | 304 | Ct10-Regulated Kinase Isoform Ii Length = 304 | 6e-08 | ||
| 1lck_A | 175 | Sh3-Sh2 Domain Fragment Of Human P56-Lck Tyrosine K | 4e-16 | ||
| 1lck_A | 175 | Sh3-Sh2 Domain Fragment Of Human P56-Lck Tyrosine K | 3e-14 | ||
| 4d8k_A | 175 | Crystal Structure Of A Sh3-Sh2 Domains Of A Lymphoc | 4e-16 | ||
| 4d8k_A | 175 | Crystal Structure Of A Sh3-Sh2 Domains Of A Lymphoc | 3e-14 | ||
| 2eyy_A | 204 | Ct10-Regulated Kinase Isoform I Length = 204 | 4e-16 | ||
| 2eyy_A | 204 | Ct10-Regulated Kinase Isoform I Length = 204 | 4e-08 | ||
| 1x27_A | 167 | Crystal Structure Of Lck Sh2-Sh3 With Sh2 Binding S | 5e-16 | ||
| 1x27_A | 167 | Crystal Structure Of Lck Sh2-Sh3 With Sh2 Binding S | 3e-14 | ||
| 1ad5_A | 438 | Src Family Kinase Hck-Amp-Pnp Complex Length = 438 | 6e-15 | ||
| 1ad5_A | 438 | Src Family Kinase Hck-Amp-Pnp Complex Length = 438 | 2e-14 | ||
| 1qcf_A | 454 | Crystal Structure Of Hck In Complex With A Src Fami | 7e-15 | ||
| 1qcf_A | 454 | Crystal Structure Of Hck In Complex With A Src Fami | 7e-14 | ||
| 3nhn_A | 193 | Crystal Structure Of The Src-Family Kinase Hck Sh3- | 9e-15 | ||
| 3nhn_A | 193 | Crystal Structure Of The Src-Family Kinase Hck Sh3- | 1e-14 | ||
| 3t04_A | 123 | Crystal Structure Of Monobody 7c12ABL1 SH2 DOMAIN C | 2e-14 | ||
| 3t04_A | 123 | Crystal Structure Of Monobody 7c12ABL1 SH2 DOMAIN C | 2e-14 | ||
| 1sem_A | 58 | Structural Determinants Of Peptide-Binding Orientat | 7e-14 | ||
| 3sem_A | 60 | Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Le | 8e-14 | ||
| 2lqn_A | 303 | Solution Structure Of Crkl Length = 303 | 1e-13 | ||
| 2lqn_A | 303 | Solution Structure Of Crkl Length = 303 | 2e-07 | ||
| 2lqw_A | 303 | Solution Structure Of Phosphorylated Crkl Length = | 1e-13 | ||
| 2lqw_A | 303 | Solution Structure Of Phosphorylated Crkl Length = | 2e-07 | ||
| 1k76_A | 62 | Solution Structure Of The C-Terminal Sem-5 Sh3 Doma | 1e-13 | ||
| 2shp_A | 525 | Tyrosine Phosphatase Shp-2 Length = 525 | 2e-13 | ||
| 2dly_A | 121 | Solution Structure Of The Sh2 Domain Of Murine Fyn- | 2e-13 | ||
| 2dly_A | 121 | Solution Structure Of The Sh2 Domain Of Murine Fyn- | 2e-13 | ||
| 2ecd_A | 119 | Solution Structure Of The Human Abl2 Sh2 Domain Len | 7e-13 | ||
| 2ecd_A | 119 | Solution Structure Of The Human Abl2 Sh2 Domain Len | 7e-13 | ||
| 2ci9_A | 102 | Nck1 Sh2-Domain In Complex With A Dodecaphosphopept | 9e-13 | ||
| 2ci9_A | 102 | Nck1 Sh2-Domain In Complex With A Dodecaphosphopept | 9e-13 | ||
| 2ci8_A | 99 | Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomple | 9e-13 | ||
| 2ci8_A | 99 | Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomple | 9e-13 | ||
| 3k2m_A | 112 | Crystal Structure Of Monobody Ha4ABL1 SH2 DOMAIN CO | 1e-12 | ||
| 3k2m_A | 112 | Crystal Structure Of Monobody Ha4ABL1 SH2 DOMAIN CO | 1e-12 | ||
| 1ab2_A | 109 | Three-Dimensional Solution Structure Of The Src Hom | 1e-12 | ||
| 1ab2_A | 109 | Three-Dimensional Solution Structure Of The Src Hom | 1e-12 | ||
| 2vwf_A | 58 | Grb2 Sh3c (2) Length = 58 | 5e-12 | ||
| 2vvk_A | 56 | Grb2 Sh3c (1) Length = 56 | 6e-12 | ||
| 1gcq_A | 61 | Crystal Structure Of Vav And Grb2 Sh3 Domains Lengt | 6e-12 | ||
| 1io6_A | 59 | Growth Factor Receptor-Bound Protein 2 (Grb2) C-Ter | 8e-12 | ||
| 1rja_A | 100 | Solution Structure And Backbone Dynamics Of The Non | 8e-12 | ||
| 1rja_A | 100 | Solution Structure And Backbone Dynamics Of The Non | 8e-12 | ||
| 3ps5_A | 595 | Crystal Structure Of The Full-Length Human Protein | 9e-12 | ||
| 2b3o_A | 532 | Crystal Structure Of Human Tyrosine Phosphatase Shp | 1e-11 | ||
| 2cia_A | 102 | Human Nck2 Sh2-Domain In Complex With A Decaphospho | 3e-11 | ||
| 2cia_A | 102 | Human Nck2 Sh2-Domain In Complex With A Decaphospho | 3e-11 | ||
| 1z3k_A | 98 | Structural Insight Into The Binding Diversity Betwe | 3e-11 | ||
| 1z3k_A | 98 | Structural Insight Into The Binding Diversity Betwe | 3e-11 | ||
| 1f1w_A | 104 | Src Sh2 Thref1trp Mutant Complexed With The Phospho | 5e-11 | ||
| 1f1w_A | 104 | Src Sh2 Thref1trp Mutant Complexed With The Phospho | 5e-11 | ||
| 1a1a_A | 107 | C-Src (Sh2 Domain With C188a Mutation) Complexed Wi | 6e-11 | ||
| 1a1a_A | 107 | C-Src (Sh2 Domain With C188a Mutation) Complexed Wi | 6e-11 | ||
| 3eac_A | 106 | Crystal Structure Of Sh2 Domain Of Human Csk (Carbo | 6e-11 | ||
| 3eac_A | 106 | Crystal Structure Of Sh2 Domain Of Human Csk (Carbo | 6e-11 | ||
| 1shd_A | 107 | Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein In | 2e-10 | ||
| 1shd_A | 107 | Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein In | 2e-10 | ||
| 1o4c_A | 108 | Crystal Structure Of Sh2 In Complex With Phosphate. | 2e-10 | ||
| 1o4c_A | 108 | Crystal Structure Of Sh2 In Complex With Phosphate. | 2e-10 | ||
| 1o41_A | 108 | Crystal Structure Of Sh2 In Complex With Ru78300. L | 2e-10 | ||
| 1o41_A | 108 | Crystal Structure Of Sh2 In Complex With Ru78300. L | 2e-10 | ||
| 3c0c_A | 73 | X-Ray Crystal Structure Of The Rat Endophilin A2 Sh | 7e-10 | ||
| 1is0_A | 106 | Crystal Structure Of A Complex Of The Src Sh2 Domai | 9e-10 | ||
| 1is0_A | 106 | Crystal Structure Of A Complex Of The Src Sh2 Domai | 9e-10 | ||
| 1sha_A | 104 | Crystal Structure Of The Phosphotyrosine Recognitio | 1e-09 | ||
| 1sha_A | 104 | Crystal Structure Of The Phosphotyrosine Recognitio | 1e-09 | ||
| 1nzl_A | 103 | Crystal Structure Of Src Sh2 Domain Bound To Doubly | 1e-09 | ||
| 1nzl_A | 103 | Crystal Structure Of Src Sh2 Domain Bound To Doubly | 1e-09 | ||
| 1skj_A | 113 | Cocrystal Structure Of Urea-Substituted Phosphopept | 1e-09 | ||
| 1skj_A | 113 | Cocrystal Structure Of Urea-Substituted Phosphopept | 1e-09 | ||
| 1p13_A | 102 | Crystal Structure Of The Src Sh2 Domain Complexed W | 1e-09 | ||
| 1p13_A | 102 | Crystal Structure Of The Src Sh2 Domain Complexed W | 1e-09 | ||
| 2a08_A | 60 | Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 | 1e-09 | ||
| 2d8h_A | 80 | Solution Structure Of The Sh3 Domain Of Hypothetica | 1e-09 | ||
| 3eaz_A | 106 | Crystal Structure Of Sh2 Domain Of Human Csk (Carbo | 1e-09 | ||
| 3eaz_A | 106 | Crystal Structure Of Sh2 Domain Of Human Csk (Carbo | 1e-09 | ||
| 1oot_A | 60 | Crystal Structure Of The Sh3 Domain From A S. Cerev | 1e-09 | ||
| 4f59_A | 112 | Triple Mutant Src Sh2 Domain Length = 112 | 2e-09 | ||
| 4f59_A | 112 | Triple Mutant Src Sh2 Domain Length = 112 | 2e-09 | ||
| 3gf9_A | 295 | Crystal Structure Of Human Intersectin 2 Rhogef Dom | 2e-09 | ||
| 3gf9_A | 295 | Crystal Structure Of Human Intersectin 2 Rhogef Dom | 1e-08 | ||
| 2dbm_A | 73 | Solution Structures Of The Sh3 Domain Of Human Sh3- | 2e-09 | ||
| 1udl_A | 98 | The Solution Structure Of The Fifth Sh3 Domain Of I | 2e-09 | ||
| 1udl_A | 98 | The Solution Structure Of The Fifth Sh3 Domain Of I | 3e-08 | ||
| 3iql_A | 71 | Crystal Structure Of The Rat Endophilin-A1 Sh3 Doma | 2e-09 | ||
| 1kc2_A | 103 | Structure Of The Triple (Lys(Beta)d3ala, Asp(Beta)c | 3e-09 | ||
| 1kc2_A | 103 | Structure Of The Triple (Lys(Beta)d3ala, Asp(Beta)c | 3e-09 | ||
| 3jv3_A | 283 | Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l | 3e-09 | ||
| 1x2k_A | 68 | Solution Structure Of The Sh3 Domain Of Human Osteo | 4e-09 | ||
| 2ew3_A | 68 | Solution Structure Of The Sh3 Domain Of Human Sh3gl | 5e-09 | ||
| 3ehq_A | 222 | Crystal Structure Of Human Osteoclast Stimulating F | 5e-09 | ||
| 1zlm_A | 58 | Crystal Structure Of The Sh3 Domain Of Human Osteoc | 5e-09 | ||
| 4fl2_A | 636 | Structural And Biophysical Characterization Of The | 6e-09 | ||
| 1bkl_A | 113 | Self-Associated Apo Src Sh2 Domain Length = 113 | 6e-09 | ||
| 1bkl_A | 113 | Self-Associated Apo Src Sh2 Domain Length = 113 | 6e-09 | ||
| 1bkm_A | 113 | Cocrystal Structure Of D-Amino Acid Substituted Pho | 7e-09 | ||
| 1bkm_A | 113 | Cocrystal Structure Of D-Amino Acid Substituted Pho | 7e-09 | ||
| 1csk_A | 71 | The Crystal Structure Of Human Csksh3: Structural D | 7e-09 | ||
| 1jeg_A | 83 | Solution Structure Of The Sh3 Domain From C-Termina | 7e-09 | ||
| 2f2x_A | 62 | Alpha-Spectrin Sh3 Domain R21g Mutant Length = 62 | 1e-08 | ||
| 1aot_F | 106 | Nmr Structure Of The Fyn Sh2 Domain Complexed With | 1e-08 | ||
| 1aot_F | 106 | Nmr Structure Of The Fyn Sh2 Domain Complexed With | 1e-08 | ||
| 2lnw_A | 122 | Identification And Structural Basis For A Novel Int | 1e-08 | ||
| 2lnw_A | 122 | Identification And Structural Basis For A Novel Int | 1e-08 | ||
| 2dl4_A | 68 | Solution Structure Of The First Sh3 Domain Of Stac | 2e-08 | ||
| 1uj0_A | 62 | Crystal Structure Of Stam2 Sh3 Domain In Complex Wi | 2e-08 | ||
| 1qkw_A | 62 | Alpha-Spectrin Src Homology 3 Domain, N47g Mutant I | 3e-08 | ||
| 4fl3_A | 635 | Structural And Biophysical Characterization Of The | 3e-08 | ||
| 1lcj_A | 109 | Sh2 (Src Homology-2) Domain Of Human P56-Lck Tyrosi | 4e-08 | ||
| 1lcj_A | 109 | Sh2 (Src Homology-2) Domain Of Human P56-Lck Tyrosi | 4e-08 | ||
| 1lkk_A | 105 | Human P56-Lck Tyrosine Kinase Sh2 Domain In Complex | 4e-08 | ||
| 1lkk_A | 105 | Human P56-Lck Tyrosine Kinase Sh2 Domain In Complex | 4e-08 | ||
| 1lkl_A | 104 | Human P56-Lck Tyrosine Kinase Sh2 Domain In Complex | 4e-08 | ||
| 1lkl_A | 104 | Human P56-Lck Tyrosine Kinase Sh2 Domain In Complex | 4e-08 | ||
| 1bhf_A | 108 | P56lck Sh2 Domain Inhibitor Complex Length = 108 | 4e-08 | ||
| 1bhf_A | 108 | P56lck Sh2 Domain Inhibitor Complex Length = 108 | 4e-08 | ||
| 2l0a_A | 72 | Solution Nmr Structure Of Signal Transducing Adapte | 4e-08 | ||
| 1bhh_B | 103 | Free P56lck Sh2 Domain Length = 103 | 4e-08 | ||
| 1bhh_B | 103 | Free P56lck Sh2 Domain Length = 103 | 4e-08 | ||
| 2f2w_A | 62 | Alpha-Spectrin Sh3 Domain R21a Mutant Length = 62 | 5e-08 | ||
| 1uue_A | 62 | A-Spectrin Sh3 Domain (V44t, D48g Mutant) Length = | 5e-08 | ||
| 3tl0_A | 109 | Structure Of Shp2 N-Sh2 Domain In Complex With Rlnp | 5e-08 | ||
| 3tl0_A | 109 | Structure Of Shp2 N-Sh2 Domain In Complex With Rlnp | 5e-08 | ||
| 3thk_A | 73 | Structure Of Sh3 Chimera With A Type Ii Ligand Link | 5e-08 | ||
| 4fbn_A | 246 | Insights Into Structural Integration Of The Plcgamm | 6e-08 | ||
| 1x2q_A | 88 | Solution Structure Of The Sh3 Domain Of The Signal | 6e-08 | ||
| 1cwd_L | 98 | Human P56lck Tyrosine Kinase Complexed With Phospho | 6e-08 | ||
| 1cwd_L | 98 | Human P56lck Tyrosine Kinase Complexed With Phospho | 6e-08 | ||
| 1bk2_A | 57 | A-Spectrin Sh3 Domain D48g Mutant Length = 57 | 7e-08 | ||
| 1a81_A | 254 | Crystal Structure Of The Tandem Sh2 Domain Of The S | 7e-08 | ||
| 1uti_A | 58 | MonaGADS SH3C IN COMPLEX WITH HPK DERIVED PEPTIDE L | 7e-08 | ||
| 1ijr_A | 104 | Crystal Structure Of Lck Sh2 Complexed With Nonpept | 8e-08 | ||
| 1ijr_A | 104 | Crystal Structure Of Lck Sh2 Complexed With Nonpept | 8e-08 | ||
| 3m0s_A | 57 | Crystal Structure Of The R21d Mutant Of Alpha-Spect | 8e-08 | ||
| 1aya_A | 101 | Crystal Structures Of Peptide Complexes Of The Amin | 8e-08 | ||
| 1aya_A | 101 | Crystal Structures Of Peptide Complexes Of The Amin | 8e-08 | ||
| 1h3h_A | 60 | Structural Basis For Specific Recognition Of An Rxx | 8e-08 | ||
| 4ey0_A | 246 | Structure Of Tandem Sh2 Domains From Plcgamma1 Leng | 8e-08 | ||
| 1oeb_A | 62 | MonaGADS SH3C DOMAIN Length = 62 | 8e-08 | ||
| 3m0p_A | 62 | Crystal Structure Of The R21d Mutant Of Alpha-Spect | 9e-08 | ||
| 2cdt_A | 62 | Alpha-Spectrin Sh3 Domain A56s Mutant Length = 62 | 9e-08 | ||
| 2d0n_A | 59 | Crystal Structure Of The C-Terminal Sh3 Domain Of T | 9e-08 | ||
| 3hck_A | 107 | Nmr Ensemble Of The Uncomplexed Human Hck Sh2 Domai | 1e-07 | ||
| 3hck_A | 107 | Nmr Ensemble Of The Uncomplexed Human Hck Sh2 Domai | 1e-07 | ||
| 1fbz_A | 104 | Structure-Based Design Of A Novel, Osteoclast-Selec | 1e-07 | ||
| 1fbz_A | 104 | Structure-Based Design Of A Novel, Osteoclast-Selec | 1e-07 | ||
| 1qkx_A | 62 | Alpha-Spectrin Src Homology 3 Domain, N47a Mutant I | 1e-07 | ||
| 2gsb_A | 119 | Solution Structure Of The Second Sh2 Domain Of Huma | 1e-07 | ||
| 2gsb_A | 119 | Solution Structure Of The Second Sh2 Domain Of Huma | 1e-07 | ||
| 2lct_A | 107 | Solution Structure Of The Vav1 Sh2 Domain Complexed | 1e-07 | ||
| 2lct_A | 107 | Solution Structure Of The Vav1 Sh2 Domain Complexed | 1e-07 | ||
| 2crh_A | 138 | Solution Structure Of The Sh2 Domain Of Human Proto | 1e-07 | ||
| 2crh_A | 138 | Solution Structure Of The Sh2 Domain Of Human Proto | 1e-07 | ||
| 2lj3_A | 63 | Pfbd: High-Throughput Strategy Of Backbone Fold Det | 1e-07 | ||
| 1m8m_A | 62 | Solid-State Mas Nmr Structure Of The A-Spectrin Sh3 | 1e-07 | ||
| 2cs0_A | 119 | Solution Structure Of The Sh2 Domain Of Human Hsh2d | 1e-07 | ||
| 2cs0_A | 119 | Solution Structure Of The Sh2 Domain Of Human Hsh2d | 1e-07 | ||
| 1pwt_A | 61 | Thermodynamic Analysis Of Alpha-Spectrin Sh3 And Tw | 2e-07 | ||
| 2dlz_A | 118 | Solution Structure Of The Sh2 Domain Of Human Prote | 2e-07 | ||
| 2dlz_A | 118 | Solution Structure Of The Sh2 Domain Of Human Prote | 2e-07 | ||
| 1hd3_A | 62 | A-Spectrin Sh3 Domain F52y Mutant Length = 62 | 2e-07 | ||
| 1e6g_A | 62 | A-Spectrin Sh3 Domain A11v, V23l, M25i, V53i, V58l | 2e-07 | ||
| 3ngp_A | 62 | High Resolution Structure Of Alpha-Spectrin Sh3 Dom | 2e-07 | ||
| 2y3a_B | 302 | Crystal Structure Of P110beta In Complex With Icsh2 | 2e-07 | ||
| 2y3a_B | 302 | Crystal Structure Of P110beta In Complex With Icsh2 | 2e-07 | ||
| 3gqi_B | 226 | Crystal Structure Of Activated Receptor Tyrosine Ki | 2e-07 | ||
| 2ozo_A | 613 | Autoinhibited Intact Human Zap-70 Length = 613 | 2e-07 | ||
| 2f2v_A | 62 | Alpha-Spectrin Sh3 Domain A56g Mutant Length = 62 | 2e-07 | ||
| 1neg_A | 83 | Crystal Structure Analysis Of N-And C-Terminal Labe | 2e-07 | ||
| 1e7o_A | 62 | A-Spectrin Sh3 Domain A11v, V23l, M25v, V44i, V58l | 3e-07 | ||
| 1uhf_A | 69 | Solution Structure Of The Third Sh3 Domain Of Human | 4e-07 | ||
| 2yt6_A | 109 | Solution Structure Of The Sh3_1 Domain Of Yamaguchi | 4e-07 | ||
| 2yt6_A | 109 | Solution Structure Of The Sh3_1 Domain Of Yamaguchi | 9e-06 | ||
| 2kk6_A | 116 | Solution Structure Of Sh2 Domain Of Proto-Oncogene | 4e-07 | ||
| 2kk6_A | 116 | Solution Structure Of Sh2 Domain Of Proto-Oncogene | 4e-07 | ||
| 1m61_A | 259 | Crystal Structure Of The Apo Sh2 Domains Of Zap-70 | 5e-07 | ||
| 2yun_A | 79 | Solution Structure Of The Sh3 Domain Of Human Nostr | 5e-07 | ||
| 2drm_A | 58 | Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L | 5e-07 | ||
| 2drk_A | 59 | Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L | 5e-07 | ||
| 2oq1_A | 254 | Tandem Sh2 Domains Of Zap-70 With 19-Mer Zeta1 Pept | 6e-07 | ||
| 2krn_A | 60 | High Resolution Structure Of The Second Sh3 Domain | 6e-07 | ||
| 1e6h_A | 62 | A-Spectrin Sh3 Domain A11v, M25i, V44i, V58l Mutant | 6e-07 | ||
| 1ju5_A | 109 | Ternary Complex Of An Crk Sh2 Domain, Crk-Derived P | 6e-07 | ||
| 1ju5_A | 109 | Ternary Complex Of An Crk Sh2 Domain, Crk-Derived P | 6e-07 | ||
| 2eyv_A | 124 | Sh2 Domain Of Ct10-Regulated Kinase Length = 124 | 7e-07 | ||
| 2eyv_A | 124 | Sh2 Domain Of Ct10-Regulated Kinase Length = 124 | 7e-07 | ||
| 1h8k_A | 62 | A-Spectrin Sh3 Domain A11v, V23l, M25v, V53i, V58l | 8e-07 | ||
| 2kbt_A | 142 | Attachment Of An Nmr-Invisible Solubility Enhanceme | 9e-07 | ||
| 3i9q_A | 57 | Crystal Structure Of The Triple Mutant S19g-P20d-R2 | 1e-06 | ||
| 2eo3_A | 111 | Solution Structure Of The Sh2 Domain From Human Crk | 1e-06 | ||
| 2eo3_A | 111 | Solution Structure Of The Sh2 Domain From Human Crk | 1e-06 | ||
| 1blj_A | 114 | Nmr Ensemble Of Blk Sh2 Domain, 20 Structures Lengt | 1e-06 | ||
| 1blj_A | 114 | Nmr Ensemble Of Blk Sh2 Domain, 20 Structures Lengt | 1e-06 | ||
| 1ynz_A | 58 | Sh3 Domain Of Yeast Pin3 Length = 58 | 2e-06 | ||
| 2aug_A | 126 | Crystal Structure Of The Grb14 Sh2 Domain Length = | 2e-06 | ||
| 2aug_A | 126 | Crystal Structure Of The Grb14 Sh2 Domain Length = | 2e-06 | ||
| 1mw4_A | 120 | Solution Structure Of The Human Grb7-Sh2 Domain In | 2e-06 | ||
| 1mw4_A | 120 | Solution Structure Of The Human Grb7-Sh2 Domain In | 2e-06 | ||
| 2djq_A | 68 | The Solution Structure Of The First Sh3 Domain Of M | 2e-06 | ||
| 3pqz_A | 117 | Grb7 Sh2 With Peptide Length = 117 | 2e-06 | ||
| 3pqz_A | 117 | Grb7 Sh2 With Peptide Length = 117 | 2e-06 | ||
| 2ysq_A | 81 | Solution Structure Of The Sh3 Domain From Rho Guani | 2e-06 | ||
| 1zsg_A | 65 | Beta Pix-Sh3 Complexed With An Atypical Peptide Fro | 3e-06 | ||
| 2yuo_A | 78 | Solution Structure Of The Sh3 Domain Of Mouse Run A | 3e-06 | ||
| 3u23_A | 65 | Atomic Resolution Crystal Structure Of The 2nd Sh3 | 3e-06 | ||
| 3ulr_B | 65 | Lysozyme Contamination Facilitates Crystallization | 3e-06 | ||
| 3ulr_B | 65 | Lysozyme Contamination Facilitates Crystallization | 6e-05 | ||
| 4esr_A | 69 | Molecular And Structural Characterization Of The Sh | 4e-06 | ||
| 2kr3_A | 70 | Solution Structure Of Sha-D Length = 70 | 4e-06 | ||
| 4iim_A | 70 | Crystal Structure Of The Second Sh3 Domain Of Itsn1 | 4e-06 | ||
| 2l3s_A | 163 | Structure Of The Autoinhibited Crk Length = 163 | 4e-06 | ||
| 2l3s_A | 163 | Structure Of The Autoinhibited Crk Length = 163 | 3e-05 | ||
| 2dx0_A | 138 | Crystal Structure Of The N-Terminal Sh2 Domain Of M | 4e-06 | ||
| 2dx0_A | 138 | Crystal Structure Of The N-Terminal Sh2 Domain Of M | 4e-06 | ||
| 2d1x_A | 66 | The Crystal Structure Of The Cortactin-Sh3 Domain A | 6e-06 | ||
| 2d1x_A | 66 | The Crystal Structure Of The Cortactin-Sh3 Domain A | 8e-05 | ||
| 2epd_A | 76 | Solution Structure Of Sh3 Domain In Rho-Gtpase-Acti | 6e-06 | ||
| 2dm1_A | 73 | Solution Structure Of The Second Sh3 Domain Of Huma | 7e-06 | ||
| 2dl3_A | 68 | Solution Structure Of The First Sh3 Domain Of Human | 7e-06 | ||
| 2ysx_A | 119 | Solution Structure Of The Human Ship Sh2 Domain Len | 7e-06 | ||
| 2ysx_A | 119 | Solution Structure Of The Human Ship Sh2 Domain Len | 7e-06 | ||
| 1fu5_A | 111 | Nmr Structure Of The N-Sh2 Domain Of The P85 Subuni | 7e-06 | ||
| 1fu5_A | 111 | Nmr Structure Of The N-Sh2 Domain Of The P85 Subuni | 7e-06 | ||
| 1oo3_A | 111 | P395s Mutant Of The P85 Regulatory Subunit Of The N | 8e-06 | ||
| 1oo3_A | 111 | P395s Mutant Of The P85 Regulatory Subunit Of The N | 8e-06 | ||
| 1x69_A | 79 | Solution Structures Of The Sh3 Domain Of Human Src | 8e-06 | ||
| 1x69_A | 79 | Solution Structures Of The Sh3 Domain Of Human Src | 1e-04 | ||
| 2fei_A | 65 | Solution Structure Of The Second Sh3 Domain Of Huma | 1e-05 | ||
| 1wi7_A | 68 | Solution Structure Of The Sh3 Domain Of Sh3-Domain | 1e-05 | ||
| 3nmz_D | 116 | Crytal Structure Of Apc Complexed With Asef Length | 1e-05 | ||
| 2iug_A | 120 | Crystal Structure Of The Pi3-Kinase P85 N-Terminal | 1e-05 | ||
| 2iug_A | 120 | Crystal Structure Of The Pi3-Kinase P85 N-Terminal | 1e-05 | ||
| 2pz1_A | 466 | Crystal Structure Of Auto-Inhibited Asef Length = 4 | 1e-05 | ||
| 3hhm_B | 373 | Crystal Structure Of P110alpha H1047r Mutant In Com | 1e-05 | ||
| 3hhm_B | 373 | Crystal Structure Of P110alpha H1047r Mutant In Com | 1e-05 | ||
| 2nwm_A | 65 | Solution Structure Of The First Sh3 Domain Of Human | 1e-05 | ||
| 1x6c_A | 118 | Solution Structures Of The Sh2 Domain Of Human Prot | 1e-05 | ||
| 1x6c_A | 118 | Solution Structures Of The Sh2 Domain Of Human Prot | 1e-05 | ||
| 2eob_A | 124 | Solution Structure Of The Second Sh2 Domain From Ra | 1e-05 | ||
| 2eob_A | 124 | Solution Structure Of The Second Sh2 Domain From Ra | 1e-05 | ||
| 3qwy_A | 308 | Ced-2 Length = 308 | 1e-05 | ||
| 3cxl_A | 463 | Crystal Structure Of Human Chimerin 1 (Chn1) Length | 1e-05 | ||
| 3cxl_A | 463 | Crystal Structure Of Human Chimerin 1 (Chn1) Length | 1e-05 | ||
| 2dx1_A | 482 | Crystal Structure Of Rhogef Protein Asef Length = 4 | 1e-05 | ||
| 2dlm_A | 68 | Solution Structure Of The First Sh3 Domain Of Human | 2e-05 | ||
| 2dyb_A | 341 | The Crystal Structure Of Human P40(Phox) Length = 3 | 2e-05 | ||
| 2o2o_A | 92 | Solution Structure Of Domain B From Human Cin85 Pro | 2e-05 | ||
| 1xa6_A | 466 | Crystal Structure Of The Human Beta2-Chimaerin Leng | 2e-05 | ||
| 1xa6_A | 466 | Crystal Structure Of The Human Beta2-Chimaerin Leng | 2e-05 | ||
| 2yuq_A | 85 | Solution Structure Of The Sh3 Domain Of Human Tyros | 2e-05 | ||
| 2ed0_A | 78 | Solution Structure Of The Sh3 Domain Of Abl Interac | 2e-05 | ||
| 2ed0_A | 78 | Solution Structure Of The Sh3 Domain Of Abl Interac | 3e-05 | ||
| 1tce_A | 107 | Solution Nmr Structure Of The Shc Sh2 Domain Comple | 3e-05 | ||
| 1tce_A | 107 | Solution Nmr Structure Of The Shc Sh2 Domain Comple | 3e-05 | ||
| 2x3w_D | 60 | Structure Of Mouse Syndapin I (Crystal Form 2) Leng | 3e-05 | ||
| 2x3w_D | 60 | Structure Of Mouse Syndapin I (Crystal Form 2) Leng | 6e-04 | ||
| 2rmo_A | 70 | Solution Structure Of Alpha-Spectrin_sh3-Bergerac F | 3e-05 | ||
| 2ed1_A | 76 | Solution Structure Of The Sh3 Domain Of 130 Kda Pho | 3e-05 | ||
| 2fci_A | 105 | Structural Basis For The Requirement Of Two Phospho | 3e-05 | ||
| 2fci_A | 105 | Structural Basis For The Requirement Of Two Phospho | 3e-05 | ||
| 1hsq_A | 71 | Solution Structure Of The Sh3 Domain Of Phospholipa | 3e-05 | ||
| 2ak5_A | 64 | Beta Pix-Sh3 Complexed With A Cbl-B Peptide Length | 4e-05 | ||
| 2dl7_A | 73 | Solution Structure Of The Second Sh3 Domain Of Huma | 4e-05 | ||
| 1jwo_A | 97 | Crystal Structure Analysis Of The Sh2 Domain Of The | 4e-05 | ||
| 1jwo_A | 97 | Crystal Structure Analysis Of The Sh2 Domain Of The | 4e-05 | ||
| 2rqt_A | 61 | Solution Structure Of The Human Ddef1 Sh3 Domain Le | 4e-05 | ||
| 2df6_A | 59 | Crystal Structure Of The Sh3 Domain Of Betapix In C | 4e-05 | ||
| 2pna_A | 104 | Structure Of An Sh2 Domain Of The P85 Alpha Subunit | 4e-05 | ||
| 2pna_A | 104 | Structure Of An Sh2 Domain Of The P85 Alpha Subunit | 4e-05 | ||
| 3qwx_X | 174 | Ced-2 1-174 Length = 174 | 4e-05 | ||
| 2rd0_B | 279 | Structure Of A Human P110alpha/p85alpha Complex Len | 4e-05 | ||
| 2rd0_B | 279 | Structure Of A Human P110alpha/p85alpha Complex Len | 4e-05 | ||
| 3m7f_A | 108 | Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX | 4e-05 | ||
| 3m7f_A | 108 | Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX | 4e-05 | ||
| 2jte_A | 64 | Third Sh3 Domain Of Cd2ap Length = 64 | 4e-05 | ||
| 1mil_A | 104 | Transforming Protein Length = 104 | 5e-05 | ||
| 1mil_A | 104 | Transforming Protein Length = 104 | 5e-05 | ||
| 1y0m_A | 61 | Crystal Structure Of Of The Sh3 Domain Of Phospholi | 5e-05 | ||
| 2eyw_A | 78 | N-Terminal Sh3 Domain Of Ct10-Regulated Kinase Leng | 5e-05 | ||
| 1cka_A | 57 | Structural Basis For The Specific Interaction Of Ly | 5e-05 | ||
| 2lmj_A | 66 | Itk-Sh3 Length = 66 | 5e-05 | ||
| 1b07_A | 65 | Crk Sh3 Domain Complexed With Peptoid Inhibitor Len | 5e-05 | ||
| 1wyx_A | 69 | The Crystal Structure Of The P130cas Sh3 Domain At | 5e-05 | ||
| 1nrv_A | 105 | Crystal Structure Of The Sh2 Domain Of Grb10 Length | 6e-05 | ||
| 1nrv_A | 105 | Crystal Structure Of The Sh2 Domain Of Grb10 Length | 6e-05 | ||
| 1m30_A | 58 | Solution Structure Of N-Terminal Sh3 Domain From On | 6e-05 | ||
| 1k4u_S | 62 | Solution Structure Of The C-Terminal Sh3 Domain Of | 6e-05 | ||
| 2dil_A | 69 | Solution Structure Of The Sh3 Domain Of The Human P | 6e-05 | ||
| 1m3a_A | 57 | Solution Structure Of A Circular Form Of The Trunca | 6e-05 | ||
| 2oaw_A | 65 | Structure Of Shh Variant Of "bergerac" Chimera Of S | 6e-05 | ||
| 1ywo_A | 64 | Phospholipase Cgamma1 Sh3 In Complex With A Slp-76 | 6e-05 | ||
| 2rot_A | 70 | Structure Of Chimeric Variant Of Sh3 Domain- Shh Le | 6e-05 | ||
| 1m3c_A | 60 | Solution Structure Of A Circular Form Of The N-Term | 7e-05 | ||
| 2o2w_A | 67 | Extending Powder Diffraction To Proteins: Structure | 7e-05 | ||
| 2o2w_A | 67 | Extending Powder Diffraction To Proteins: Structure | 5e-04 | ||
| 2esw_A | 61 | Atomic Structure Of The N-Terminal Sh3 Domain Of Mo | 7e-05 | ||
| 2xmf_A | 60 | Myosin 1e Sh3 Length = 60 | 7e-05 | ||
| 1m3b_A | 58 | Solution Structure Of A Circular Form Of The N-Term | 7e-05 | ||
| 1z9q_A | 79 | Solution Structure Of Sh3 Domain Of P40phox Length | 8e-05 | ||
| 2ecz_A | 70 | Solution Structure Of The Sh3 Domain Of Sorbin And | 9e-05 | ||
| 2ecz_A | 70 | Solution Structure Of The Sh3 Domain Of Sorbin And | 6e-04 | ||
| 2dm0_A | 125 | Solution Structure Of The Sh2 Domain Of Human Tyros | 9e-05 | ||
| 2dm0_A | 125 | Solution Structure Of The Sh2 Domain Of Human Tyros | 9e-05 | ||
| 1w6x_A | 60 | Sh3 Domain Of P40phox, Component Of The Nadph Oxida | 1e-04 | ||
| 3haj_A | 486 | Crystal Structure Of Human Pacsin2 F-Bar Domain (P2 | 1e-04 | ||
| 1uhc_A | 79 | Solution Structure Of Rsgi Ruh-002, A Sh3 Domain Of | 1e-04 | ||
| 1csy_A | 112 | Syk Tyrosine Kinase C-Terminal Sh2 Domain Complexed | 1e-04 | ||
| 1csy_A | 112 | Syk Tyrosine Kinase C-Terminal Sh2 Domain Complexed | 1e-04 | ||
| 1ujy_A | 76 | Solution Structure Of Sh3 Domain In RacCDC42 GUANIN | 1e-04 | ||
| 1rqq_C | 114 | Crystal Structure Of The Insulin Receptor Kinase In | 1e-04 | ||
| 1rqq_C | 114 | Crystal Structure Of The Insulin Receptor Kinase In | 1e-04 | ||
| 3us4_A | 98 | Crystal Structure Of A Sh2 Domain Of A Megakaryocyt | 1e-04 | ||
| 3us4_A | 98 | Crystal Structure Of A Sh2 Domain Of A Megakaryocyt | 1e-04 | ||
| 2lj0_A | 65 | The Third Sh3 Domain Of R85fl Length = 65 | 2e-04 | ||
| 2bz8_A | 58 | N-Terminal Sh3 Domain Of Cin85 Bound To Cbl-B Pepti | 2e-04 | ||
| 2lj1_A | 64 | The Third Sh3 Domain Of R85fl With Ataxin-7 Prr Len | 2e-04 | ||
| 2da9_A | 70 | Solution Structure Of The Third Sh3 Domain Of Sh3-D | 2e-04 | ||
| 2k9g_A | 73 | Solution Structure Of The Third Sh3 Domain Of The C | 2e-04 | ||
| 1j3t_A | 74 | Solution Structure Of The Second Sh3 Domain Of Huma | 3e-04 | ||
| 2bbu_A | 164 | Solution Structure Of Mouse Socs3 In Complex With A | 3e-04 | ||
| 2bbu_A | 164 | Solution Structure Of Mouse Socs3 In Complex With A | 3e-04 | ||
| 2ydl_A | 69 | Crystal Structure Of Sh3c From Cin85 Length = 69 | 3e-04 | ||
| 2rn8_A | 64 | Nmr Structure Note: Murine Itk Sh3 Domain Length = | 3e-04 | ||
| 2k6d_A | 62 | Cin85 Sh3-C Domain In Complex With Ubiquitin Length | 3e-04 | ||
| 2cre_A | 71 | Solution Structure Of Rsgi Ruh-036, An Sh3 Domain F | 3e-04 | ||
| 1rpy_A | 114 | Crystal Structure Of The Dimeric Sh2 Domain Of Aps | 3e-04 | ||
| 1rpy_A | 114 | Crystal Structure Of The Dimeric Sh2 Domain Of Aps | 3e-04 | ||
| 2k79_A | 63 | Solution Structure Of The Binary Complex Between Th | 3e-04 | ||
| 1aww_A | 67 | Sh3 Domain From Bruton's Tyrosine Kinase, Nmr, 42 S | 4e-04 | ||
| 2k3b_A | 62 | Seeing The Invisible: Structures Of Excited Protein | 4e-04 | ||
| 1awj_A | 77 | Intramolecular Itk-Proline Complex, Nmr, Minimized | 4e-04 | ||
| 4glm_A | 72 | Crystal Structure Of The Sh3 Domain Of Dnmbp Protei | 4e-04 | ||
| 3h0f_A | 73 | Crystal Structure Of The Human Fyn Sh3 R96w Mutant | 4e-04 | ||
| 3reb_B | 90 | Hiv-1 Nef Protein In Complex With Engineered Hck-Sh | 4e-04 | ||
| 3h0h_A | 73 | Human Fyn Sh3 Domain R96i Mutant, Crystal Form I Le | 4e-04 | ||
| 1efn_A | 59 | Hiv-1 Nef Protein In Complex With R96i Mutant Fyn S | 5e-04 | ||
| 1tuc_A | 63 | Alpha-Spectrin Src Homology 3 Domain, Circular Perm | 5e-04 | ||
| 1a0n_B | 69 | Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene | 5e-04 | ||
| 1fyn_A | 62 | Phosphotransferase Length = 62 | 5e-04 | ||
| 4d8d_A | 58 | Crystal Structure Of Hiv-1 Nef Fyn-sh3 R96w Variant | 5e-04 | ||
| 3ua6_A | 64 | Crystal Structure Of The Human Fyn Sh3 Domain Lengt | 5e-04 | ||
| 1azg_B | 67 | Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene | 5e-04 | ||
| 2rpn_A | 59 | A Crucial Role For High Intrinsic Specificity In Th | 5e-04 | ||
| 1avz_C | 57 | V-1 Nef Protein In Complex With Wild Type Fyn Sh3 D | 6e-04 | ||
| 1shf_A | 59 | Crystal Structure Of The Sh3 Domain In Human Fyn; C | 6e-04 | ||
| 3rea_B | 61 | Hiv-1 Nef Protein In Complex With Engineered Hck-Sh | 6e-04 | ||
| 1m27_C | 61 | Crystal Structure Of SapFYNSH3SLAM TERNARY COMPLEX | 6e-04 | ||
| 1jo8_A | 58 | Structural Analysis Of The Yeast Actin Binding Prot | 6e-04 | ||
| 2jmc_A | 77 | Chimer Between Spc-Sh3 And P41 Length = 77 | 6e-04 | ||
| 2hdv_A | 111 | Crystal Structure Of The Src Homology-2 Domain Of T | 8e-04 | ||
| 2hdv_A | 111 | Crystal Structure Of The Src Homology-2 Domain Of T | 8e-04 | ||
| 4f14_A | 64 | Structure Of The Sh3 Domain Of Human Nebulette In C | 8e-04 |
| >pdb|1GRI|A Chain A, Grb2 Length = 217 | Back alignment and structure |
|
| >pdb|1GRI|A Chain A, Grb2 Length = 217 | Back alignment and structure |
| >pdb|1BMB|A Chain A, Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-974) Length = 123 | Back alignment and structure |
| >pdb|1BMB|A Chain A, Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-974) Length = 123 | Back alignment and structure |
| >pdb|1BM2|A Chain A, Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acetyl-L-Thi Alysyl-O-Phosphotyrosyl-Valyl-Asparagyl-Valyl-Prolyl] (Pkf273-791) Length = 117 | Back alignment and structure |
| >pdb|1BM2|A Chain A, Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acetyl-L-Thi Alysyl-O-Phosphotyrosyl-Valyl-Asparagyl-Valyl-Prolyl] (Pkf273-791) Length = 117 | Back alignment and structure |
| >pdb|1FYR|A Chain A, Dimer Formation Through Domain Swapping In The Crystal Structure Of The Grb2-Sh2 Ac-Pyvnv Complex Length = 114 | Back alignment and structure |
| >pdb|1FYR|A Chain A, Dimer Formation Through Domain Swapping In The Crystal Structure Of The Grb2-Sh2 Ac-Pyvnv Complex Length = 114 | Back alignment and structure |
| >pdb|3N84|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A 23-Membered Macrocyclic Ligand Having The Sequence Pyvnvp Length = 112 | Back alignment and structure |
| >pdb|3N84|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A 23-Membered Macrocyclic Ligand Having The Sequence Pyvnvp Length = 112 | Back alignment and structure |
| >pdb|3OVE|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Pyxn- Derived Tripeptide Length = 117 | Back alignment and structure |
| >pdb|3OVE|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Pyxn- Derived Tripeptide Length = 117 | Back alignment and structure |
| >pdb|3IMD|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Flexible Ac-Py-Q-N-Nh2 Tripeptide Mimic Length = 117 | Back alignment and structure |
| >pdb|3IMD|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Flexible Ac-Py-Q-N-Nh2 Tripeptide Mimic Length = 117 | Back alignment and structure |
| >pdb|1FHS|A Chain A, The Three-Dimensional Solution Structure Of The Src Homology Domain-2 Of The Growth Factor Receptor Bound Protein-2, Nmr, 18 Structures Length = 112 | Back alignment and structure |
| >pdb|1FHS|A Chain A, The Three-Dimensional Solution Structure Of The Src Homology Domain-2 Of The Growth Factor Receptor Bound Protein-2, Nmr, 18 Structures Length = 112 | Back alignment and structure |
| >pdb|2H46|E Chain E, Native Domain-Swapped Dimer Crystal Structure Of The Grb2 Sh2 Domain Length = 116 | Back alignment and structure |
| >pdb|2H46|E Chain E, Native Domain-Swapped Dimer Crystal Structure Of The Grb2 Sh2 Domain Length = 116 | Back alignment and structure |
| >pdb|2AOA|A Chain A, Crystal Structures Of A High-affinity Macrocyclic Peptide Mimetic In Complex With The Grb2 Sh2 Domain Length = 99 | Back alignment and structure |
| >pdb|2AOA|A Chain A, Crystal Structures Of A High-affinity Macrocyclic Peptide Mimetic In Complex With The Grb2 Sh2 Domain Length = 99 | Back alignment and structure |
| >pdb|1TZE|E Chain E, Signal Transduction Adaptor Growth Factor, Grb2 Sh2 Domain Complexed With Phosphotyrosyl Heptapeptide Lys-Pro-Phe-Ptyr-Val-Asn-Val-Nh2 (Kfppyvnc-Nh2) Length = 98 | Back alignment and structure |
| >pdb|1TZE|E Chain E, Signal Transduction Adaptor Growth Factor, Grb2 Sh2 Domain Complexed With Phosphotyrosyl Heptapeptide Lys-Pro-Phe-Ptyr-Val-Asn-Val-Nh2 (Kfppyvnc-Nh2) Length = 98 | Back alignment and structure |
| >pdb|3MXC|A Chain A, Structures Of Grb2-Sh2 Domain And Aicd Peptide Complexes Reveal A Conformational Switch And Their Functional Implications. Length = 101 | Back alignment and structure |
| >pdb|3MXC|A Chain A, Structures Of Grb2-Sh2 Domain And Aicd Peptide Complexes Reveal A Conformational Switch And Their Functional Implications. Length = 101 | Back alignment and structure |
| >pdb|1X0N|A Chain A, Nmr Structure Of Growth Factor Receptor Binding Protein Sh2 Domain Complexed With The Inhibitor Length = 104 | Back alignment and structure |
| >pdb|1X0N|A Chain A, Nmr Structure Of Growth Factor Receptor Binding Protein Sh2 Domain Complexed With The Inhibitor Length = 104 | Back alignment and structure |
| >pdb|1ZFP|E Chain E, Growth Factor Receptor Binding Protein Sh2 Domain Complexed With A Phosphotyrosyl Pentapeptide Length = 98 | Back alignment and structure |
| >pdb|1ZFP|E Chain E, Growth Factor Receptor Binding Protein Sh2 Domain Complexed With A Phosphotyrosyl Pentapeptide Length = 98 | Back alignment and structure |
| >pdb|1CJ1|A Chain A, Growth Factor Receptor Binding Protein Sh2 Domain (Human) Complexed With A Phosphotyrosyl Derivative Length = 96 | Back alignment and structure |
| >pdb|1CJ1|A Chain A, Growth Factor Receptor Binding Protein Sh2 Domain (Human) Complexed With A Phosphotyrosyl Derivative Length = 96 | Back alignment and structure |
| >pdb|1GHU|A Chain A, Nmr Solution Structure Of Growth Factor Receptor-Bound Protein 2 (Grb2) Sh2 Domain, 24 Structures Length = 107 | Back alignment and structure |
| >pdb|1GHU|A Chain A, Nmr Solution Structure Of Growth Factor Receptor-Bound Protein 2 (Grb2) Sh2 Domain, 24 Structures Length = 107 | Back alignment and structure |
| >pdb|1JYQ|A Chain A, Xray Structure Of Grb2 Sh2 Domain Complexed With A Highly Affine Phospho Peptide Length = 96 | Back alignment and structure |
| >pdb|1JYQ|A Chain A, Xray Structure Of Grb2 Sh2 Domain Complexed With A Highly Affine Phospho Peptide Length = 96 | Back alignment and structure |
| >pdb|2A36|A Chain A, Solution Structure Of The N-Terminal Sh3 Domain Of Drk Length = 59 | Back alignment and structure |
| >pdb|2A36|A Chain A, Solution Structure Of The N-Terminal Sh3 Domain Of Drk Length = 59 | Back alignment and structure |
| >pdb|2A37|A Chain A, Solution Structure Of The T22g Mutant Of N-Terminal Sh3 Domain Of Drk (Drkn Sh3 Domain) Length = 59 | Back alignment and structure |
| >pdb|2A37|A Chain A, Solution Structure Of The T22g Mutant Of N-Terminal Sh3 Domain Of Drk (Drkn Sh3 Domain) Length = 59 | Back alignment and structure |
| >pdb|1R1P|A Chain A, Structural Basis For Differential Recognition Of Tyrosine Phosphorylated Sites In The Linker For Activation Of T Cells (lat) By The Adaptor Protein Gads Length = 100 | Back alignment and structure |
| >pdb|1R1P|A Chain A, Structural Basis For Differential Recognition Of Tyrosine Phosphorylated Sites In The Linker For Activation Of T Cells (lat) By The Adaptor Protein Gads Length = 100 | Back alignment and structure |
| >pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 | Back alignment and structure |
| >pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 | Back alignment and structure |
| >pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 | Back alignment and structure |
| >pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 | Back alignment and structure |
| >pdb|2ABL|A Chain A, Sh3-Sh2 Domain Fragment Of Human Bcr-Abl Tyrosine Kinase Length = 163 | Back alignment and structure |
| >pdb|2ABL|A Chain A, Sh3-Sh2 Domain Fragment Of Human Bcr-Abl Tyrosine Kinase Length = 163 | Back alignment and structure |
| >pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 | Back alignment and structure |
| >pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 | Back alignment and structure |
| >pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 | Back alignment and structure |
| >pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 | Back alignment and structure |
| >pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 | Back alignment and structure |
| >pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 | Back alignment and structure |
| >pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 | Back alignment and structure |
| >pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 | Back alignment and structure |
| >pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 | Back alignment and structure |
| >pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 | Back alignment and structure |
| >pdb|4GBQ|A Chain A, Solution Nmr Structure Of The Grb2 N-Terminal Sh3 Domain Complexed With A Ten-Residue Peptide Derived From Sos Direct Refinement Against Noes, J-Couplings, And 1h And 13c Chemical Shifts, 15 Structures Length = 74 | Back alignment and structure |
| >pdb|4GBQ|A Chain A, Solution Nmr Structure Of The Grb2 N-Terminal Sh3 Domain Complexed With A Ten-Residue Peptide Derived From Sos Direct Refinement Against Noes, J-Couplings, And 1h And 13c Chemical Shifts, 15 Structures Length = 74 | Back alignment and structure |
| >pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 | Back alignment and structure |
| >pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 | Back alignment and structure |
| >pdb|1G83|A Chain A, Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | Back alignment and structure |
| >pdb|1G83|A Chain A, Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | Back alignment and structure |
| >pdb|3UF4|A Chain A, Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn Protein (Proto- Concogene Tyrosine-Protein Kinase Fyn) From Mus Musculus At 1.98 A Resolution Length = 164 | Back alignment and structure |
| >pdb|3UF4|A Chain A, Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn Protein (Proto- Concogene Tyrosine-Protein Kinase Fyn) From Mus Musculus At 1.98 A Resolution Length = 164 | Back alignment and structure |
| >pdb|2DVJ|A Chain A, Phosphorylated Crk-Ii Length = 230 | Back alignment and structure |
| >pdb|2DVJ|A Chain A, Phosphorylated Crk-Ii Length = 230 | Back alignment and structure |
| >pdb|1AZE|A Chain A, Nmr Structure Of The Complex Between The C32s-Y7v Mutant Of The Nsh3 Domain Of Grb2 With A Peptide From Sos, 10 Structures Length = 56 | Back alignment and structure |
| >pdb|1AZE|A Chain A, Nmr Structure Of The Complex Between The C32s-Y7v Mutant Of The Nsh3 Domain Of Grb2 With A Peptide From Sos, 10 Structures Length = 56 | Back alignment and structure |
| >pdb|2EYZ|A Chain A, Ct10-Regulated Kinase Isoform Ii Length = 304 | Back alignment and structure |
| >pdb|2EYZ|A Chain A, Ct10-Regulated Kinase Isoform Ii Length = 304 | Back alignment and structure |
| >pdb|1LCK|A Chain A, Sh3-Sh2 Domain Fragment Of Human P56-Lck Tyrosine Kinase Complexed With The 10 Residue Synthetic Phosphotyrosyl Peptide Tegqpyqpqpa Length = 175 | Back alignment and structure |
| >pdb|1LCK|A Chain A, Sh3-Sh2 Domain Fragment Of Human P56-Lck Tyrosine Kinase Complexed With The 10 Residue Synthetic Phosphotyrosyl Peptide Tegqpyqpqpa Length = 175 | Back alignment and structure |
| >pdb|4D8K|A Chain A, Crystal Structure Of A Sh3-Sh2 Domains Of A Lymphocyte-Specific Protein Tyrosine Kinase (Lck) From Homo Sapiens At 2.36 A Resolution Length = 175 | Back alignment and structure |
| >pdb|4D8K|A Chain A, Crystal Structure Of A Sh3-Sh2 Domains Of A Lymphocyte-Specific Protein Tyrosine Kinase (Lck) From Homo Sapiens At 2.36 A Resolution Length = 175 | Back alignment and structure |
| >pdb|2EYY|A Chain A, Ct10-Regulated Kinase Isoform I Length = 204 | Back alignment and structure |
| >pdb|2EYY|A Chain A, Ct10-Regulated Kinase Isoform I Length = 204 | Back alignment and structure |
| >pdb|1X27|A Chain A, Crystal Structure Of Lck Sh2-Sh3 With Sh2 Binding Site Of P130cas Length = 167 | Back alignment and structure |
| >pdb|1X27|A Chain A, Crystal Structure Of Lck Sh2-Sh3 With Sh2 Binding Site Of P130cas Length = 167 | Back alignment and structure |
| >pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 | Back alignment and structure |
| >pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 | Back alignment and structure |
| >pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 | Back alignment and structure |
| >pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 | Back alignment and structure |
| >pdb|3NHN|A Chain A, Crystal Structure Of The Src-Family Kinase Hck Sh3-Sh2-Linker Regulatory Region Length = 193 | Back alignment and structure |
| >pdb|3NHN|A Chain A, Crystal Structure Of The Src-Family Kinase Hck Sh3-Sh2-Linker Regulatory Region Length = 193 | Back alignment and structure |
| >pdb|3T04|A Chain A, Crystal Structure Of Monobody 7c12ABL1 SH2 DOMAIN COMPLEX Length = 123 | Back alignment and structure |
| >pdb|3T04|A Chain A, Crystal Structure Of Monobody 7c12ABL1 SH2 DOMAIN COMPLEX Length = 123 | Back alignment and structure |
| >pdb|1SEM|A Chain A, Structural Determinants Of Peptide-Binding Orientation And Of Sequence Specificity In Sh3 Domains Length = 58 | Back alignment and structure |
| >pdb|3SEM|A Chain A, Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Length = 60 | Back alignment and structure |
| >pdb|2LQN|A Chain A, Solution Structure Of Crkl Length = 303 | Back alignment and structure |
| >pdb|2LQN|A Chain A, Solution Structure Of Crkl Length = 303 | Back alignment and structure |
| >pdb|2LQW|A Chain A, Solution Structure Of Phosphorylated Crkl Length = 303 | Back alignment and structure |
| >pdb|2LQW|A Chain A, Solution Structure Of Phosphorylated Crkl Length = 303 | Back alignment and structure |
| >pdb|1K76|A Chain A, Solution Structure Of The C-Terminal Sem-5 Sh3 Domain (Minimized Average Structure) Length = 62 | Back alignment and structure |
| >pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 | Back alignment and structure |
| >pdb|2DLY|A Chain A, Solution Structure Of The Sh2 Domain Of Murine Fyn-Related Kinase Length = 121 | Back alignment and structure |
| >pdb|2DLY|A Chain A, Solution Structure Of The Sh2 Domain Of Murine Fyn-Related Kinase Length = 121 | Back alignment and structure |
| >pdb|2ECD|A Chain A, Solution Structure Of The Human Abl2 Sh2 Domain Length = 119 | Back alignment and structure |
| >pdb|2ECD|A Chain A, Solution Structure Of The Human Abl2 Sh2 Domain Length = 119 | Back alignment and structure |
| >pdb|2CI9|A Chain A, Nck1 Sh2-Domain In Complex With A Dodecaphosphopeptide From Epec Protein Tir Length = 102 | Back alignment and structure |
| >pdb|2CI9|A Chain A, Nck1 Sh2-Domain In Complex With A Dodecaphosphopeptide From Epec Protein Tir Length = 102 | Back alignment and structure |
| >pdb|2CI8|A Chain A, Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomplexed Length = 99 | Back alignment and structure |
| >pdb|2CI8|A Chain A, Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomplexed Length = 99 | Back alignment and structure |
| >pdb|3K2M|A Chain A, Crystal Structure Of Monobody Ha4ABL1 SH2 DOMAIN COMPLEX Length = 112 | Back alignment and structure |
| >pdb|3K2M|A Chain A, Crystal Structure Of Monobody Ha4ABL1 SH2 DOMAIN COMPLEX Length = 112 | Back alignment and structure |
| >pdb|1AB2|A Chain A, Three-Dimensional Solution Structure Of The Src Homology 2 Domain Of C-Abl Length = 109 | Back alignment and structure |
| >pdb|1AB2|A Chain A, Three-Dimensional Solution Structure Of The Src Homology 2 Domain Of C-Abl Length = 109 | Back alignment and structure |
| >pdb|2VWF|A Chain A, Grb2 Sh3c (2) Length = 58 | Back alignment and structure |
| >pdb|2VVK|A Chain A, Grb2 Sh3c (1) Length = 56 | Back alignment and structure |
| >pdb|1GCQ|A Chain A, Crystal Structure Of Vav And Grb2 Sh3 Domains Length = 61 | Back alignment and structure |
| >pdb|1IO6|A Chain A, Growth Factor Receptor-Bound Protein 2 (Grb2) C-Terminal Sh3 Domain Complexed With A Ligand Peptide (Nmr, Minimized Mean Structure) Length = 59 | Back alignment and structure |
| >pdb|1RJA|A Chain A, Solution Structure And Backbone Dynamics Of The Nonreceptor Tyrosine Kinase Ptk6BRK SH2 DOMAIN Length = 100 | Back alignment and structure |
| >pdb|1RJA|A Chain A, Solution Structure And Backbone Dynamics Of The Nonreceptor Tyrosine Kinase Ptk6BRK SH2 DOMAIN Length = 100 | Back alignment and structure |
| >pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 | Back alignment and structure |
| >pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 | Back alignment and structure |
| >pdb|2CIA|A Chain A, Human Nck2 Sh2-Domain In Complex With A Decaphosphopeptide From Translocated Intimin Receptor (Tir) Of Epec Length = 102 | Back alignment and structure |
| >pdb|2CIA|A Chain A, Human Nck2 Sh2-Domain In Complex With A Decaphosphopeptide From Translocated Intimin Receptor (Tir) Of Epec Length = 102 | Back alignment and structure |
| >pdb|1Z3K|A Chain A, Structural Insight Into The Binding Diversity Between The Tyr-Phosphorylated Human Ephrinbs And Nck2 Sh2 Domain Length = 98 | Back alignment and structure |
| >pdb|1Z3K|A Chain A, Structural Insight Into The Binding Diversity Between The Tyr-Phosphorylated Human Ephrinbs And Nck2 Sh2 Domain Length = 98 | Back alignment and structure |
| >pdb|1F1W|A Chain A, Src Sh2 Thref1trp Mutant Complexed With The Phosphopeptide S(Ptr)vnvqn Length = 104 | Back alignment and structure |
| >pdb|1F1W|A Chain A, Src Sh2 Thref1trp Mutant Complexed With The Phosphopeptide S(Ptr)vnvqn Length = 104 | Back alignment and structure |
| >pdb|1A1A|A Chain A, C-Src (Sh2 Domain With C188a Mutation) Complexed With Ace-Formyl Phosphotyr-Glu-(N,N-Dipentyl Amine) Length = 107 | Back alignment and structure |
| >pdb|1A1A|A Chain A, C-Src (Sh2 Domain With C188a Mutation) Complexed With Ace-Formyl Phosphotyr-Glu-(N,N-Dipentyl Amine) Length = 107 | Back alignment and structure |
| >pdb|3EAC|A Chain A, Crystal Structure Of Sh2 Domain Of Human Csk (Carboxyl- Terminal Src Kinase), Oxidized Form Length = 106 | Back alignment and structure |
| >pdb|3EAC|A Chain A, Crystal Structure Of Sh2 Domain Of Human Csk (Carboxyl- Terminal Src Kinase), Oxidized Form Length = 106 | Back alignment and structure |
| >pdb|1SHD|A Chain A, Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein Interactions Length = 107 | Back alignment and structure |
| >pdb|1SHD|A Chain A, Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein Interactions Length = 107 | Back alignment and structure |
| >pdb|1O4C|A Chain A, Crystal Structure Of Sh2 In Complex With Phosphate. Length = 108 | Back alignment and structure |
| >pdb|1O4C|A Chain A, Crystal Structure Of Sh2 In Complex With Phosphate. Length = 108 | Back alignment and structure |
| >pdb|1O41|A Chain A, Crystal Structure Of Sh2 In Complex With Ru78300. Length = 108 | Back alignment and structure |
| >pdb|1O41|A Chain A, Crystal Structure Of Sh2 In Complex With Ru78300. Length = 108 | Back alignment and structure |
| >pdb|3C0C|A Chain A, X-Ray Crystal Structure Of The Rat Endophilin A2 Sh3 Domain Length = 73 | Back alignment and structure |
| >pdb|1IS0|A Chain A, Crystal Structure Of A Complex Of The Src Sh2 Domain With Conformationally Constrained Peptide Inhibitor Length = 106 | Back alignment and structure |
| >pdb|1IS0|A Chain A, Crystal Structure Of A Complex Of The Src Sh2 Domain With Conformationally Constrained Peptide Inhibitor Length = 106 | Back alignment and structure |
| >pdb|1SHA|A Chain A, Crystal Structure Of The Phosphotyrosine Recognition Domain Sh2 Of V-Src Complexed With Tyrosine-Phosphorylated Peptides Length = 104 | Back alignment and structure |
| >pdb|1SHA|A Chain A, Crystal Structure Of The Phosphotyrosine Recognition Domain Sh2 Of V-Src Complexed With Tyrosine-Phosphorylated Peptides Length = 104 | Back alignment and structure |
| >pdb|1NZL|A Chain A, Crystal Structure Of Src Sh2 Domain Bound To Doubly Phosphorylated Peptide Pqpyepyipi Length = 103 | Back alignment and structure |
| >pdb|1NZL|A Chain A, Crystal Structure Of Src Sh2 Domain Bound To Doubly Phosphorylated Peptide Pqpyepyipi Length = 103 | Back alignment and structure |
| >pdb|1SKJ|A Chain A, Cocrystal Structure Of Urea-Substituted Phosphopeptide Complex Length = 113 | Back alignment and structure |
| >pdb|1SKJ|A Chain A, Cocrystal Structure Of Urea-Substituted Phosphopeptide Complex Length = 113 | Back alignment and structure |
| >pdb|1P13|A Chain A, Crystal Structure Of The Src Sh2 Domain Complexed With Peptide (Sdpyanfk) Length = 102 | Back alignment and structure |
| >pdb|1P13|A Chain A, Crystal Structure Of The Src Sh2 Domain Complexed With Peptide (Sdpyanfk) Length = 102 | Back alignment and structure |
| >pdb|2A08|A Chain A, Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 | Back alignment and structure |
| >pdb|2D8H|A Chain A, Solution Structure Of The Sh3 Domain Of Hypothetical Protein Sh3yl1 Length = 80 | Back alignment and structure |
| >pdb|3EAZ|A Chain A, Crystal Structure Of Sh2 Domain Of Human Csk (Carboxyl- Terminal Src Kinase), C122s Mutant Length = 106 | Back alignment and structure |
| >pdb|3EAZ|A Chain A, Crystal Structure Of Sh2 Domain Of Human Csk (Carboxyl- Terminal Src Kinase), C122s Mutant Length = 106 | Back alignment and structure |
| >pdb|1OOT|A Chain A, Crystal Structure Of The Sh3 Domain From A S. Cerevisiae Hypothetical 40.4 Kda Protein At 1.39 A Resolution Length = 60 | Back alignment and structure |
| >pdb|4F59|A Chain A, Triple Mutant Src Sh2 Domain Length = 112 | Back alignment and structure |
| >pdb|4F59|A Chain A, Triple Mutant Src Sh2 Domain Length = 112 | Back alignment and structure |
| >pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 | Back alignment and structure |
| >pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 | Back alignment and structure |
| >pdb|2DBM|A Chain A, Solution Structures Of The Sh3 Domain Of Human Sh3- Containing Grb2-Like Protein 2 Length = 73 | Back alignment and structure |
| >pdb|1UDL|A Chain A, The Solution Structure Of The Fifth Sh3 Domain Of Intersectin 2 (Kiaa1256) Length = 98 | Back alignment and structure |
| >pdb|1UDL|A Chain A, The Solution Structure Of The Fifth Sh3 Domain Of Intersectin 2 (Kiaa1256) Length = 98 | Back alignment and structure |
| >pdb|3IQL|A Chain A, Crystal Structure Of The Rat Endophilin-A1 Sh3 Domain Length = 71 | Back alignment and structure |
| >pdb|1KC2|A Chain A, Structure Of The Triple (Lys(Beta)d3ala, Asp(Beta)c8ala, Aspcd2ala) Mutant Of The Src Sh2 Domain Bound To The Pqpyeeipi Peptide Length = 103 | Back alignment and structure |
| >pdb|1KC2|A Chain A, Structure Of The Triple (Lys(Beta)d3ala, Asp(Beta)c8ala, Aspcd2ala) Mutant Of The Src Sh2 Domain Bound To The Pqpyeeipi Peptide Length = 103 | Back alignment and structure |
| >pdb|3JV3|A Chain A, Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l Length = 283 | Back alignment and structure |
| >pdb|1X2K|A Chain A, Solution Structure Of The Sh3 Domain Of Human Osteoclast Stimulating Factor 1 (Ostf1) Length = 68 | Back alignment and structure |
| >pdb|2EW3|A Chain A, Solution Structure Of The Sh3 Domain Of Human Sh3gl3 Length = 68 | Back alignment and structure |
| >pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 | Back alignment and structure |
| >pdb|1ZLM|A Chain A, Crystal Structure Of The Sh3 Domain Of Human Osteoclast Stimulating Factor Length = 58 | Back alignment and structure |
| >pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 | Back alignment and structure |
| >pdb|1BKL|A Chain A, Self-Associated Apo Src Sh2 Domain Length = 113 | Back alignment and structure |
| >pdb|1BKL|A Chain A, Self-Associated Apo Src Sh2 Domain Length = 113 | Back alignment and structure |
| >pdb|1BKM|A Chain A, Cocrystal Structure Of D-Amino Acid Substituted Phosphopeptide Complex Length = 113 | Back alignment and structure |
| >pdb|1BKM|A Chain A, Cocrystal Structure Of D-Amino Acid Substituted Phosphopeptide Complex Length = 113 | Back alignment and structure |
| >pdb|1CSK|A Chain A, The Crystal Structure Of Human Csksh3: Structural Diversity Near The Rt-Src And N-Src Loop Length = 71 | Back alignment and structure |
| >pdb|1JEG|A Chain A, Solution Structure Of The Sh3 Domain From C-Terminal Src Kinase Complexed With A Peptide From The Tyrosine Phosphatase Pep Length = 83 | Back alignment and structure |
| >pdb|2F2X|A Chain A, Alpha-Spectrin Sh3 Domain R21g Mutant Length = 62 | Back alignment and structure |
| >pdb|1AOT|F Chain F, Nmr Structure Of The Fyn Sh2 Domain Complexed With A Phosphotyrosyl Peptide, Minimized Average Structure Length = 106 | Back alignment and structure |
| >pdb|1AOT|F Chain F, Nmr Structure Of The Fyn Sh2 Domain Complexed With A Phosphotyrosyl Peptide, Minimized Average Structure Length = 106 | Back alignment and structure |
| >pdb|2LNW|A Chain A, Identification And Structural Basis For A Novel Interaction Between Vav2 And Arap3 Length = 122 | Back alignment and structure |
| >pdb|2LNW|A Chain A, Identification And Structural Basis For A Novel Interaction Between Vav2 And Arap3 Length = 122 | Back alignment and structure |
| >pdb|2DL4|A Chain A, Solution Structure Of The First Sh3 Domain Of Stac Protein Length = 68 | Back alignment and structure |
| >pdb|1UJ0|A Chain A, Crystal Structure Of Stam2 Sh3 Domain In Complex With A Ubpy-Derived Peptide Length = 62 | Back alignment and structure |
| >pdb|1QKW|A Chain A, Alpha-Spectrin Src Homology 3 Domain, N47g Mutant In The Distal Loop Length = 62 | Back alignment and structure |
| >pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 | Back alignment and structure |
| >pdb|1LCJ|A Chain A, Sh2 (Src Homology-2) Domain Of Human P56-Lck Tyrosine Kinase Complexed With The 11 Residue Phosphotyrosyl Peptide Epqpyeeipiyl Length = 109 | Back alignment and structure |
| >pdb|1LCJ|A Chain A, Sh2 (Src Homology-2) Domain Of Human P56-Lck Tyrosine Kinase Complexed With The 11 Residue Phosphotyrosyl Peptide Epqpyeeipiyl Length = 109 | Back alignment and structure |
| >pdb|1LKK|A Chain A, Human P56-Lck Tyrosine Kinase Sh2 Domain In Complex With The Phosphotyrosyl Peptide Ac-Ptyr-Glu-Glu-Ile (Pyeei Peptide) Length = 105 | Back alignment and structure |
| >pdb|1LKK|A Chain A, Human P56-Lck Tyrosine Kinase Sh2 Domain In Complex With The Phosphotyrosyl Peptide Ac-Ptyr-Glu-Glu-Ile (Pyeei Peptide) Length = 105 | Back alignment and structure |
| >pdb|1LKL|A Chain A, Human P56-Lck Tyrosine Kinase Sh2 Domain In Complex With The Phosphotyrosyl Peptide Ac-Ptyr-Glu-Glu-Gly (Pyeeg Peptide) Length = 104 | Back alignment and structure |
| >pdb|1LKL|A Chain A, Human P56-Lck Tyrosine Kinase Sh2 Domain In Complex With The Phosphotyrosyl Peptide Ac-Ptyr-Glu-Glu-Gly (Pyeeg Peptide) Length = 104 | Back alignment and structure |
| >pdb|1BHF|A Chain A, P56lck Sh2 Domain Inhibitor Complex Length = 108 | Back alignment and structure |
| >pdb|1BHF|A Chain A, P56lck Sh2 Domain Inhibitor Complex Length = 108 | Back alignment and structure |
| >pdb|2L0A|A Chain A, Solution Nmr Structure Of Signal Transducing Adapter Molecule 1 Stam-1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4479e Length = 72 | Back alignment and structure |
| >pdb|1BHH|B Chain B, Free P56lck Sh2 Domain Length = 103 | Back alignment and structure |
| >pdb|1BHH|B Chain B, Free P56lck Sh2 Domain Length = 103 | Back alignment and structure |
| >pdb|2F2W|A Chain A, Alpha-Spectrin Sh3 Domain R21a Mutant Length = 62 | Back alignment and structure |
| >pdb|1UUE|A Chain A, A-Spectrin Sh3 Domain (V44t, D48g Mutant) Length = 62 | Back alignment and structure |
| >pdb|3TL0|A Chain A, Structure Of Shp2 N-Sh2 Domain In Complex With Rlnpyaqlwhr Peptide Length = 109 | Back alignment and structure |
| >pdb|3TL0|A Chain A, Structure Of Shp2 N-Sh2 Domain In Complex With Rlnpyaqlwhr Peptide Length = 109 | Back alignment and structure |
| >pdb|3THK|A Chain A, Structure Of Sh3 Chimera With A Type Ii Ligand Linked To The Chain C- Terminal Length = 73 | Back alignment and structure |
| >pdb|4FBN|A Chain A, Insights Into Structural Integration Of The Plcgamma Regulatory Region And Mechanism Of Autoinhibition And Activation Based On Key Roles Of Sh2 Domains Length = 246 | Back alignment and structure |
| >pdb|1X2Q|A Chain A, Solution Structure Of The Sh3 Domain Of The Signal Transducing Adaptor Molecule 2 Length = 88 | Back alignment and structure |
| >pdb|1CWD|L Chain L, Human P56lck Tyrosine Kinase Complexed With Phosphopeptide Length = 98 | Back alignment and structure |
| >pdb|1CWD|L Chain L, Human P56lck Tyrosine Kinase Complexed With Phosphopeptide Length = 98 | Back alignment and structure |
| >pdb|1BK2|A Chain A, A-Spectrin Sh3 Domain D48g Mutant Length = 57 | Back alignment and structure |
| >pdb|1A81|A Chain A, Crystal Structure Of The Tandem Sh2 Domain Of The Syk Kinase Bound To A Dually Tyrosine-Phosphorylated Itam Length = 254 | Back alignment and structure |
| >pdb|1UTI|A Chain A, MonaGADS SH3C IN COMPLEX WITH HPK DERIVED PEPTIDE Length = 58 | Back alignment and structure |
| >pdb|1IJR|A Chain A, Crystal Structure Of Lck Sh2 Complexed With Nonpeptide Phosphotyrosine Mimetic Length = 104 | Back alignment and structure |
| >pdb|1IJR|A Chain A, Crystal Structure Of Lck Sh2 Complexed With Nonpeptide Phosphotyrosine Mimetic Length = 104 | Back alignment and structure |
| >pdb|3M0S|A Chain A, Crystal Structure Of The R21d Mutant Of Alpha-Spectrin Sh3 Domain. Crystal Obtained In Ammonium Sulphate At Ph 7 Length = 57 | Back alignment and structure |
| >pdb|1AYA|A Chain A, Crystal Structures Of Peptide Complexes Of The Amino- Terminal Sh2 Domain Of The Syp Tyrosine Phosphatase Length = 101 | Back alignment and structure |
| >pdb|1AYA|A Chain A, Crystal Structures Of Peptide Complexes Of The Amino- Terminal Sh2 Domain Of The Syp Tyrosine Phosphatase Length = 101 | Back alignment and structure |
| >pdb|1H3H|A Chain A, Structural Basis For Specific Recognition Of An Rxxk-Containing Slp-76 Peptide By The Gads C-Terminal Sh3 Domain Length = 60 | Back alignment and structure |
| >pdb|4EY0|A Chain A, Structure Of Tandem Sh2 Domains From Plcgamma1 Length = 246 | Back alignment and structure |
| >pdb|1OEB|A Chain A, MonaGADS SH3C DOMAIN Length = 62 | Back alignment and structure |
| >pdb|3M0P|A Chain A, Crystal Structure Of The R21d Mutant Of Alpha-Spectrin Sh3 Domain. Crystal Obtained In Ammonium Sulphate At Ph 4. Length = 62 | Back alignment and structure |
| >pdb|2CDT|A Chain A, Alpha-Spectrin Sh3 Domain A56s Mutant Length = 62 | Back alignment and structure |
| >pdb|2D0N|A Chain A, Crystal Structure Of The C-Terminal Sh3 Domain Of The Adaptor Protein Gads In Complex With Slp-76 Motif Peptide Reveals A Unique Sh3-Sh3 Interaction Length = 59 | Back alignment and structure |
| >pdb|3HCK|A Chain A, Nmr Ensemble Of The Uncomplexed Human Hck Sh2 Domain, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|3HCK|A Chain A, Nmr Ensemble Of The Uncomplexed Human Hck Sh2 Domain, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|1FBZ|A Chain A, Structure-Based Design Of A Novel, Osteoclast-Selective, Nonpeptide Src Sh2 Inhibitor With In Vivo Anti-Resorptive Activity Length = 104 | Back alignment and structure |
| >pdb|1FBZ|A Chain A, Structure-Based Design Of A Novel, Osteoclast-Selective, Nonpeptide Src Sh2 Inhibitor With In Vivo Anti-Resorptive Activity Length = 104 | Back alignment and structure |
| >pdb|1QKX|A Chain A, Alpha-Spectrin Src Homology 3 Domain, N47a Mutant In The Distal Loop Length = 62 | Back alignment and structure |
| >pdb|2GSB|A Chain A, Solution Structure Of The Second Sh2 Domain Of Human Ras Gtpase-Activating Protein 1 Length = 119 | Back alignment and structure |
| >pdb|2GSB|A Chain A, Solution Structure Of The Second Sh2 Domain Of Human Ras Gtpase-Activating Protein 1 Length = 119 | Back alignment and structure |
| >pdb|2LCT|A Chain A, Solution Structure Of The Vav1 Sh2 Domain Complexed With A Syk-Derived Doubly Phosphorylated Peptide Length = 107 | Back alignment and structure |
| >pdb|2LCT|A Chain A, Solution Structure Of The Vav1 Sh2 Domain Complexed With A Syk-Derived Doubly Phosphorylated Peptide Length = 107 | Back alignment and structure |
| >pdb|2CRH|A Chain A, Solution Structure Of The Sh2 Domain Of Human Proto- Oncogene Protein Vav1 Length = 138 | Back alignment and structure |
| >pdb|2CRH|A Chain A, Solution Structure Of The Sh2 Domain Of Human Proto- Oncogene Protein Vav1 Length = 138 | Back alignment and structure |
| >pdb|2LJ3|A Chain A, Pfbd: High-Throughput Strategy Of Backbone Fold Determination For Small Well-Folded Proteins In Less Than A Day Length = 63 | Back alignment and structure |
| >pdb|1M8M|A Chain A, Solid-State Mas Nmr Structure Of The A-Spectrin Sh3 Domain Length = 62 | Back alignment and structure |
| >pdb|2CS0|A Chain A, Solution Structure Of The Sh2 Domain Of Human Hsh2d Protein Length = 119 | Back alignment and structure |
| >pdb|2CS0|A Chain A, Solution Structure Of The Sh2 Domain Of Human Hsh2d Protein Length = 119 | Back alignment and structure |
| >pdb|1PWT|A Chain A, Thermodynamic Analysis Of Alpha-Spectrin Sh3 And Two Of Its Circular Permutants With Different Loop Lengths: Discerning The Reasons For Rapid Folding In Proteins Length = 61 | Back alignment and structure |
| >pdb|2DLZ|A Chain A, Solution Structure Of The Sh2 Domain Of Human Protein Vav-2 Length = 118 | Back alignment and structure |
| >pdb|2DLZ|A Chain A, Solution Structure Of The Sh2 Domain Of Human Protein Vav-2 Length = 118 | Back alignment and structure |
| >pdb|1HD3|A Chain A, A-Spectrin Sh3 Domain F52y Mutant Length = 62 | Back alignment and structure |
| >pdb|1E6G|A Chain A, A-Spectrin Sh3 Domain A11v, V23l, M25i, V53i, V58l Mutant Length = 62 | Back alignment and structure |
| >pdb|3NGP|A Chain A, High Resolution Structure Of Alpha-Spectrin Sh3 Domain Mutant With A Redesigned Core Length = 62 | Back alignment and structure |
| >pdb|2Y3A|B Chain B, Crystal Structure Of P110beta In Complex With Icsh2 Of P85beta And The Drug Gdc-0941 Length = 302 | Back alignment and structure |
| >pdb|2Y3A|B Chain B, Crystal Structure Of P110beta In Complex With Icsh2 Of P85beta And The Drug Gdc-0941 Length = 302 | Back alignment and structure |
| >pdb|3GQI|B Chain B, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 226 | Back alignment and structure |
| >pdb|2OZO|A Chain A, Autoinhibited Intact Human Zap-70 Length = 613 | Back alignment and structure |
| >pdb|2F2V|A Chain A, Alpha-Spectrin Sh3 Domain A56g Mutant Length = 62 | Back alignment and structure |
| >pdb|1NEG|A Chain A, Crystal Structure Analysis Of N-And C-Terminal Labeled Sh3- Domain Of Alpha-Chicken Spectrin Length = 83 | Back alignment and structure |
| >pdb|1E7O|A Chain A, A-Spectrin Sh3 Domain A11v, V23l, M25v, V44i, V58l Mutations Length = 62 | Back alignment and structure |
| >pdb|1UHF|A Chain A, Solution Structure Of The Third Sh3 Domain Of Human Intersectin 2(Kiaa1256) Length = 69 | Back alignment and structure |
| >pdb|2YT6|A Chain A, Solution Structure Of The Sh3_1 Domain Of Yamaguchi Sarcoma Viral (V-Yes) Oncogene Homolog 1 Length = 109 | Back alignment and structure |
| >pdb|2YT6|A Chain A, Solution Structure Of The Sh3_1 Domain Of Yamaguchi Sarcoma Viral (V-Yes) Oncogene Homolog 1 Length = 109 | Back alignment and structure |
| >pdb|2KK6|A Chain A, Solution Structure Of Sh2 Domain Of Proto-Oncogene Tyrosine- Protein Kinase Fer From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr3461d Length = 116 | Back alignment and structure |
| >pdb|2KK6|A Chain A, Solution Structure Of Sh2 Domain Of Proto-Oncogene Tyrosine- Protein Kinase Fer From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr3461d Length = 116 | Back alignment and structure |
| >pdb|1M61|A Chain A, Crystal Structure Of The Apo Sh2 Domains Of Zap-70 Length = 259 | Back alignment and structure |
| >pdb|2YUN|A Chain A, Solution Structure Of The Sh3 Domain Of Human Nostrin Length = 79 | Back alignment and structure |
| >pdb|2DRM|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 58 | Back alignment and structure |
| >pdb|2DRK|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 59 | Back alignment and structure |
| >pdb|2OQ1|A Chain A, Tandem Sh2 Domains Of Zap-70 With 19-Mer Zeta1 Peptide Length = 254 | Back alignment and structure |
| >pdb|2KRN|A Chain A, High Resolution Structure Of The Second Sh3 Domain Of Cd2ap Length = 60 | Back alignment and structure |
| >pdb|1E6H|A Chain A, A-Spectrin Sh3 Domain A11v, M25i, V44i, V58l Mutants Length = 62 | Back alignment and structure |
| >pdb|1JU5|A Chain A, Ternary Complex Of An Crk Sh2 Domain, Crk-Derived Phophopeptide, And Abl Sh3 Domain By Nmr Spectroscopy Length = 109 | Back alignment and structure |
| >pdb|1JU5|A Chain A, Ternary Complex Of An Crk Sh2 Domain, Crk-Derived Phophopeptide, And Abl Sh3 Domain By Nmr Spectroscopy Length = 109 | Back alignment and structure |
| >pdb|2EYV|A Chain A, Sh2 Domain Of Ct10-Regulated Kinase Length = 124 | Back alignment and structure |
| >pdb|2EYV|A Chain A, Sh2 Domain Of Ct10-Regulated Kinase Length = 124 | Back alignment and structure |
| >pdb|1H8K|A Chain A, A-Spectrin Sh3 Domain A11v, V23l, M25v, V53i, V58l Mutant Length = 62 | Back alignment and structure |
| >pdb|2KBT|A Chain A, Attachment Of An Nmr-Invisible Solubility Enhancement Tag (Inset) Using A Sortase-Mediated Protein Ligation Method Length = 142 | Back alignment and structure |
| >pdb|3I9Q|A Chain A, Crystal Structure Of The Triple Mutant S19g-P20d-R21s Of Alpha Spectrin Sh3 Domain Length = 57 | Back alignment and structure |
| >pdb|2EO3|A Chain A, Solution Structure Of The Sh2 Domain From Human Crk-Like Protein Length = 111 | Back alignment and structure |
| >pdb|2EO3|A Chain A, Solution Structure Of The Sh2 Domain From Human Crk-Like Protein Length = 111 | Back alignment and structure |
| >pdb|1BLJ|A Chain A, Nmr Ensemble Of Blk Sh2 Domain, 20 Structures Length = 114 | Back alignment and structure |
| >pdb|1BLJ|A Chain A, Nmr Ensemble Of Blk Sh2 Domain, 20 Structures Length = 114 | Back alignment and structure |
| >pdb|1YNZ|A Chain A, Sh3 Domain Of Yeast Pin3 Length = 58 | Back alignment and structure |
| >pdb|2AUG|A Chain A, Crystal Structure Of The Grb14 Sh2 Domain Length = 126 | Back alignment and structure |
| >pdb|2AUG|A Chain A, Crystal Structure Of The Grb14 Sh2 Domain Length = 126 | Back alignment and structure |
| >pdb|1MW4|A Chain A, Solution Structure Of The Human Grb7-Sh2 Domain In Complex With A 10 Amino Acid Peptide Py1139 Length = 120 | Back alignment and structure |
| >pdb|1MW4|A Chain A, Solution Structure Of The Human Grb7-Sh2 Domain In Complex With A 10 Amino Acid Peptide Py1139 Length = 120 | Back alignment and structure |
| >pdb|2DJQ|A Chain A, The Solution Structure Of The First Sh3 Domain Of Mouse Sh3 Domain Containing Ring Finger 2 Length = 68 | Back alignment and structure |
| >pdb|3PQZ|A Chain A, Grb7 Sh2 With Peptide Length = 117 | Back alignment and structure |
| >pdb|3PQZ|A Chain A, Grb7 Sh2 With Peptide Length = 117 | Back alignment and structure |
| >pdb|2YSQ|A Chain A, Solution Structure Of The Sh3 Domain From Rho Guanine Nucleotide Exchange Factor 9 Length = 81 | Back alignment and structure |
| >pdb|1ZSG|A Chain A, Beta Pix-Sh3 Complexed With An Atypical Peptide From Alpha- Pak Length = 65 | Back alignment and structure |
| >pdb|2YUO|A Chain A, Solution Structure Of The Sh3 Domain Of Mouse Run And Tbc1 Domain Containing 3 Length = 78 | Back alignment and structure |
| >pdb|3U23|A Chain A, Atomic Resolution Crystal Structure Of The 2nd Sh3 Domain From Human Cd2ap (Cms) In Complex With A Proline-Rich Peptide From Human Rin3 Length = 65 | Back alignment and structure |
| >pdb|3ULR|B Chain B, Lysozyme Contamination Facilitates Crystallization Of A Hetero- Trimericcortactin:arg:lysozyme Complex Length = 65 | Back alignment and structure |
| >pdb|3ULR|B Chain B, Lysozyme Contamination Facilitates Crystallization Of A Hetero- Trimericcortactin:arg:lysozyme Complex Length = 65 | Back alignment and structure |
| >pdb|4ESR|A Chain A, Molecular And Structural Characterization Of The Sh3 Domain Of Ahi-1 In Regulation Of Cellular Resistance Of Bcr-Abl+ Chronic Myeloid Leukemia Cells To Tyrosine Kinase Inhibitors Length = 69 | Back alignment and structure |
| >pdb|2KR3|A Chain A, Solution Structure Of Sha-D Length = 70 | Back alignment and structure |
| >pdb|4IIM|A Chain A, Crystal Structure Of The Second Sh3 Domain Of Itsn1 Bound With A Synthetic Peptide Length = 70 | Back alignment and structure |
| >pdb|2L3S|A Chain A, Structure Of The Autoinhibited Crk Length = 163 | Back alignment and structure |
| >pdb|2L3S|A Chain A, Structure Of The Autoinhibited Crk Length = 163 | Back alignment and structure |
| >pdb|2DX0|A Chain A, Crystal Structure Of The N-Terminal Sh2 Domain Of Mouse Phospholipase C-Gamma 2 Length = 138 | Back alignment and structure |
| >pdb|2DX0|A Chain A, Crystal Structure Of The N-Terminal Sh2 Domain Of Mouse Phospholipase C-Gamma 2 Length = 138 | Back alignment and structure |
| >pdb|2D1X|A Chain A, The Crystal Structure Of The Cortactin-Sh3 Domain And Amap1- Peptide Complex Length = 66 | Back alignment and structure |
| >pdb|2D1X|A Chain A, The Crystal Structure Of The Cortactin-Sh3 Domain And Amap1- Peptide Complex Length = 66 | Back alignment and structure |
| >pdb|2EPD|A Chain A, Solution Structure Of Sh3 Domain In Rho-Gtpase-Activating Protein 4 Length = 76 | Back alignment and structure |
| >pdb|2DM1|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Protein Vav-2 Length = 73 | Back alignment and structure |
| >pdb|2DL3|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Sorbin And Sh3 Domain-Containing Protein 1 Length = 68 | Back alignment and structure |
| >pdb|2YSX|A Chain A, Solution Structure Of The Human Ship Sh2 Domain Length = 119 | Back alignment and structure |
| >pdb|2YSX|A Chain A, Solution Structure Of The Human Ship Sh2 Domain Length = 119 | Back alignment and structure |
| >pdb|1FU5|A Chain A, Nmr Structure Of The N-Sh2 Domain Of The P85 Subunit Of Pi3- Kinase Complexed To A Doubly Phosphorylated Peptide Derived From Polyomavirus Middle T Antigen Length = 111 | Back alignment and structure |
| >pdb|1FU5|A Chain A, Nmr Structure Of The N-Sh2 Domain Of The P85 Subunit Of Pi3- Kinase Complexed To A Doubly Phosphorylated Peptide Derived From Polyomavirus Middle T Antigen Length = 111 | Back alignment and structure |
| >pdb|1OO3|A Chain A, P395s Mutant Of The P85 Regulatory Subunit Of The N- Terminal Src Homology 2 Domain Of Pi3-Kinase Length = 111 | Back alignment and structure |
| >pdb|1OO3|A Chain A, P395s Mutant Of The P85 Regulatory Subunit Of The N- Terminal Src Homology 2 Domain Of Pi3-Kinase Length = 111 | Back alignment and structure |
| >pdb|1X69|A Chain A, Solution Structures Of The Sh3 Domain Of Human Src Substrate Cortactin Length = 79 | Back alignment and structure |
| >pdb|1X69|A Chain A, Solution Structures Of The Sh3 Domain Of Human Src Substrate Cortactin Length = 79 | Back alignment and structure |
| >pdb|2FEI|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Cms Protein Length = 65 | Back alignment and structure |
| >pdb|1WI7|A Chain A, Solution Structure Of The Sh3 Domain Of Sh3-Domain Kinase Binding Protein 1 Length = 68 | Back alignment and structure |
| >pdb|3NMZ|D Chain D, Crytal Structure Of Apc Complexed With Asef Length = 116 | Back alignment and structure |
| >pdb|2IUG|A Chain A, Crystal Structure Of The Pi3-Kinase P85 N-Terminal Sh2 Domain Length = 120 | Back alignment and structure |
| >pdb|2IUG|A Chain A, Crystal Structure Of The Pi3-Kinase P85 N-Terminal Sh2 Domain Length = 120 | Back alignment and structure |
| >pdb|2PZ1|A Chain A, Crystal Structure Of Auto-Inhibited Asef Length = 466 | Back alignment and structure |
| >pdb|3HHM|B Chain B, Crystal Structure Of P110alpha H1047r Mutant In Complex With Nish2 Of P85alpha And The Drug Wortmannin Length = 373 | Back alignment and structure |
| >pdb|3HHM|B Chain B, Crystal Structure Of P110alpha H1047r Mutant In Complex With Nish2 Of P85alpha And The Drug Wortmannin Length = 373 | Back alignment and structure |
| >pdb|2NWM|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Vinexin And Its Interaction With The Peptides From Vinculin Length = 65 | Back alignment and structure |
| >pdb|1X6C|A Chain A, Solution Structures Of The Sh2 Domain Of Human Protein- Tyrosine Phosphatase Shp-1 Length = 118 | Back alignment and structure |
| >pdb|1X6C|A Chain A, Solution Structures Of The Sh2 Domain Of Human Protein- Tyrosine Phosphatase Shp-1 Length = 118 | Back alignment and structure |
| >pdb|2EOB|A Chain A, Solution Structure Of The Second Sh2 Domain From Rat Plc Gamma-2 Length = 124 | Back alignment and structure |
| >pdb|2EOB|A Chain A, Solution Structure Of The Second Sh2 Domain From Rat Plc Gamma-2 Length = 124 | Back alignment and structure |
| >pdb|3QWY|A Chain A, Ced-2 Length = 308 | Back alignment and structure |
| >pdb|3CXL|A Chain A, Crystal Structure Of Human Chimerin 1 (Chn1) Length = 463 | Back alignment and structure |
| >pdb|3CXL|A Chain A, Crystal Structure Of Human Chimerin 1 (Chn1) Length = 463 | Back alignment and structure |
| >pdb|2DX1|A Chain A, Crystal Structure Of Rhogef Protein Asef Length = 482 | Back alignment and structure |
| >pdb|2DLM|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Vinexin Length = 68 | Back alignment and structure |
| >pdb|2DYB|A Chain A, The Crystal Structure Of Human P40(Phox) Length = 341 | Back alignment and structure |
| >pdb|2O2O|A Chain A, Solution Structure Of Domain B From Human Cin85 Protein Length = 92 | Back alignment and structure |
| >pdb|1XA6|A Chain A, Crystal Structure Of The Human Beta2-Chimaerin Length = 466 | Back alignment and structure |
| >pdb|1XA6|A Chain A, Crystal Structure Of The Human Beta2-Chimaerin Length = 466 | Back alignment and structure |
| >pdb|2YUQ|A Chain A, Solution Structure Of The Sh3 Domain Of Human Tyrosine- Protein Kinase ItkTSK Length = 85 | Back alignment and structure |
| >pdb|2ED0|A Chain A, Solution Structure Of The Sh3 Domain Of Abl Interactor 2 (Abelson Interactor 2) Length = 78 | Back alignment and structure |
| >pdb|2ED0|A Chain A, Solution Structure Of The Sh3 Domain Of Abl Interactor 2 (Abelson Interactor 2) Length = 78 | Back alignment and structure |
| >pdb|1TCE|A Chain A, Solution Nmr Structure Of The Shc Sh2 Domain Complexed With A Tyrosine-Phosphorylated Peptide From The T-Cell Receptor, Minimized Average Structure Length = 107 | Back alignment and structure |
| >pdb|1TCE|A Chain A, Solution Nmr Structure Of The Shc Sh2 Domain Complexed With A Tyrosine-Phosphorylated Peptide From The T-Cell Receptor, Minimized Average Structure Length = 107 | Back alignment and structure |
| >pdb|2X3W|D Chain D, Structure Of Mouse Syndapin I (Crystal Form 2) Length = 60 | Back alignment and structure |
| >pdb|2X3W|D Chain D, Structure Of Mouse Syndapin I (Crystal Form 2) Length = 60 | Back alignment and structure |
| >pdb|2RMO|A Chain A, Solution Structure Of Alpha-Spectrin_sh3-Bergerac From Chicken Length = 70 | Back alignment and structure |
| >pdb|2ED1|A Chain A, Solution Structure Of The Sh3 Domain Of 130 Kda Phosphatidylinositol 4,5-Biphosphate-Dependent Arf1 Gtpase- Activating Protein Length = 76 | Back alignment and structure |
| >pdb|2FCI|A Chain A, Structural Basis For The Requirement Of Two Phosphotyrosines In Signaling Mediated By Syk Tyrosine Kinase Length = 105 | Back alignment and structure |
| >pdb|2FCI|A Chain A, Structural Basis For The Requirement Of Two Phosphotyrosines In Signaling Mediated By Syk Tyrosine Kinase Length = 105 | Back alignment and structure |
| >pdb|1HSQ|A Chain A, Solution Structure Of The Sh3 Domain Of Phospholipase Cgamma Length = 71 | Back alignment and structure |
| >pdb|2AK5|A Chain A, Beta Pix-Sh3 Complexed With A Cbl-B Peptide Length = 64 | Back alignment and structure |
| >pdb|2DL7|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Kiaa0769 Protein Length = 73 | Back alignment and structure |
| >pdb|1JWO|A Chain A, Crystal Structure Analysis Of The Sh2 Domain Of The Csk Homologous Kinase Chk Length = 97 | Back alignment and structure |
| >pdb|1JWO|A Chain A, Crystal Structure Analysis Of The Sh2 Domain Of The Csk Homologous Kinase Chk Length = 97 | Back alignment and structure |
| >pdb|2RQT|A Chain A, Solution Structure Of The Human Ddef1 Sh3 Domain Length = 61 | Back alignment and structure |
| >pdb|2DF6|A Chain A, Crystal Structure Of The Sh3 Domain Of Betapix In Complex With A High Affinity Peptide From Pak2 Length = 59 | Back alignment and structure |
| >pdb|2PNA|A Chain A, Structure Of An Sh2 Domain Of The P85 Alpha Subunit Of Phosphatidylinositol-3-Oh Kinase Length = 104 | Back alignment and structure |
| >pdb|2PNA|A Chain A, Structure Of An Sh2 Domain Of The P85 Alpha Subunit Of Phosphatidylinositol-3-Oh Kinase Length = 104 | Back alignment and structure |
| >pdb|3QWX|X Chain X, Ced-2 1-174 Length = 174 | Back alignment and structure |
| >pdb|2RD0|B Chain B, Structure Of A Human P110alpha/p85alpha Complex Length = 279 | Back alignment and structure |
| >pdb|2RD0|B Chain B, Structure Of A Human P110alpha/p85alpha Complex Length = 279 | Back alignment and structure |
| >pdb|3M7F|A Chain A, Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX Length = 108 | Back alignment and structure |
| >pdb|3M7F|A Chain A, Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX Length = 108 | Back alignment and structure |
| >pdb|2JTE|A Chain A, Third Sh3 Domain Of Cd2ap Length = 64 | Back alignment and structure |
| >pdb|1MIL|A Chain A, Transforming Protein Length = 104 | Back alignment and structure |
| >pdb|1MIL|A Chain A, Transforming Protein Length = 104 | Back alignment and structure |
| >pdb|1Y0M|A Chain A, Crystal Structure Of Of The Sh3 Domain Of Phospholipase C Gamma-1 Length = 61 | Back alignment and structure |
| >pdb|2EYW|A Chain A, N-Terminal Sh3 Domain Of Ct10-Regulated Kinase Length = 78 | Back alignment and structure |
| >pdb|1CKA|A Chain A, Structural Basis For The Specific Interaction Of Lysine- Containing Proline-Rich Peptides With The N-Terminal Sh3 Domain Of C-Crk Length = 57 | Back alignment and structure |
| >pdb|2LMJ|A Chain A, Itk-Sh3 Length = 66 | Back alignment and structure |
| >pdb|1B07|A Chain A, Crk Sh3 Domain Complexed With Peptoid Inhibitor Length = 65 | Back alignment and structure |
| >pdb|1WYX|A Chain A, The Crystal Structure Of The P130cas Sh3 Domain At 1.1 A Resolution Length = 69 | Back alignment and structure |
| >pdb|1NRV|A Chain A, Crystal Structure Of The Sh2 Domain Of Grb10 Length = 105 | Back alignment and structure |
| >pdb|1NRV|A Chain A, Crystal Structure Of The Sh2 Domain Of Grb10 Length = 105 | Back alignment and structure |
| >pdb|1M30|A Chain A, Solution Structure Of N-Terminal Sh3 Domain From Oncogene Protein C-Crk Length = 58 | Back alignment and structure |
| >pdb|1K4U|S Chain S, Solution Structure Of The C-Terminal Sh3 Domain Of P67phox Complexed With The C-Terminal Tail Region Of P47phox Length = 62 | Back alignment and structure |
| >pdb|2DIL|A Chain A, Solution Structure Of The Sh3 Domain Of The Human Proline- Serine-Threonine Phosphatase-Interacting Protein 1 Length = 69 | Back alignment and structure |
| >pdb|1M3A|A Chain A, Solution Structure Of A Circular Form Of The Truncated N- Terminal Sh3 Domain From Oncogene Protein C-Crk Length = 57 | Back alignment and structure |
| >pdb|2OAW|A Chain A, Structure Of Shh Variant Of "bergerac" Chimera Of Spectrin Sh3 Length = 65 | Back alignment and structure |
| >pdb|1YWO|A Chain A, Phospholipase Cgamma1 Sh3 In Complex With A Slp-76 Motif Length = 64 | Back alignment and structure |
| >pdb|2ROT|A Chain A, Structure Of Chimeric Variant Of Sh3 Domain- Shh Length = 70 | Back alignment and structure |
| >pdb|1M3C|A Chain A, Solution Structure Of A Circular Form Of The N-Terminal Sh3 Domain (E132c, E133g, R191g Mutant) From Oncogene Protein C-Crk Length = 60 | Back alignment and structure |
| >pdb|2O2W|A Chain A, Extending Powder Diffraction To Proteins: Structure Solution Of The Second Sh3 Domain From Ponsin Length = 67 | Back alignment and structure |
| >pdb|2O2W|A Chain A, Extending Powder Diffraction To Proteins: Structure Solution Of The Second Sh3 Domain From Ponsin Length = 67 | Back alignment and structure |
| >pdb|2ESW|A Chain A, Atomic Structure Of The N-Terminal Sh3 Domain Of Mouse Beta Pix,P21-Activated Kinase (Pak)-Interacting Exchange Factor Length = 61 | Back alignment and structure |
| >pdb|2XMF|A Chain A, Myosin 1e Sh3 Length = 60 | Back alignment and structure |
| >pdb|1M3B|A Chain A, Solution Structure Of A Circular Form Of The N-Terminal Sh3 Domain (A134c, E135g, R191g Mutant) From Oncogene Protein C-Crk Length = 58 | Back alignment and structure |
| >pdb|1Z9Q|A Chain A, Solution Structure Of Sh3 Domain Of P40phox Length = 79 | Back alignment and structure |
| >pdb|2ECZ|A Chain A, Solution Structure Of The Sh3 Domain Of Sorbin And Sh3 Domain-Containing Protein 1 Length = 70 | Back alignment and structure |
| >pdb|2ECZ|A Chain A, Solution Structure Of The Sh3 Domain Of Sorbin And Sh3 Domain-Containing Protein 1 Length = 70 | Back alignment and structure |
| >pdb|2DM0|A Chain A, Solution Structure Of The Sh2 Domain Of Human Tyrosine- Protein Kinase Txk Length = 125 | Back alignment and structure |
| >pdb|2DM0|A Chain A, Solution Structure Of The Sh2 Domain Of Human Tyrosine- Protein Kinase Txk Length = 125 | Back alignment and structure |
| >pdb|1W6X|A Chain A, Sh3 Domain Of P40phox, Component Of The Nadph Oxidase Length = 60 | Back alignment and structure |
| >pdb|3HAJ|A Chain A, Crystal Structure Of Human Pacsin2 F-Bar Domain (P212121 Lattice) Length = 486 | Back alignment and structure |
| >pdb|1UHC|A Chain A, Solution Structure Of Rsgi Ruh-002, A Sh3 Domain Of Kiaa1010 Protein [homo Sapiens] Length = 79 | Back alignment and structure |
| >pdb|1CSY|A Chain A, Syk Tyrosine Kinase C-Terminal Sh2 Domain Complexed With A Phosphopeptidefrom The Gamma Chain Of The High Affinity Immunoglobin G Receptor, Nmr Length = 112 | Back alignment and structure |
| >pdb|1CSY|A Chain A, Syk Tyrosine Kinase C-Terminal Sh2 Domain Complexed With A Phosphopeptidefrom The Gamma Chain Of The High Affinity Immunoglobin G Receptor, Nmr Length = 112 | Back alignment and structure |
| >pdb|1UJY|A Chain A, Solution Structure Of Sh3 Domain In RacCDC42 GUANINE Nucleotide Exchange Factor(Gef) 6 Length = 76 | Back alignment and structure |
| >pdb|1RQQ|C Chain C, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 114 | Back alignment and structure |
| >pdb|1RQQ|C Chain C, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 114 | Back alignment and structure |
| >pdb|3US4|A Chain A, Crystal Structure Of A Sh2 Domain Of A Megakaryocyte-Associated Tyrosine Kinase (Matk) From Homo Sapiens At 1.50 A Resolution Length = 98 | Back alignment and structure |
| >pdb|3US4|A Chain A, Crystal Structure Of A Sh2 Domain Of A Megakaryocyte-Associated Tyrosine Kinase (Matk) From Homo Sapiens At 1.50 A Resolution Length = 98 | Back alignment and structure |
| >pdb|2LJ0|A Chain A, The Third Sh3 Domain Of R85fl Length = 65 | Back alignment and structure |
| >pdb|2BZ8|A Chain A, N-Terminal Sh3 Domain Of Cin85 Bound To Cbl-B Peptide Length = 58 | Back alignment and structure |
| >pdb|2LJ1|A Chain A, The Third Sh3 Domain Of R85fl With Ataxin-7 Prr Length = 64 | Back alignment and structure |
| >pdb|2DA9|A Chain A, Solution Structure Of The Third Sh3 Domain Of Sh3-Domain Kinase Binding Protein 1 (Regulator Of Ubiquitous Kinase, Ruk) Length = 70 | Back alignment and structure |
| >pdb|2K9G|A Chain A, Solution Structure Of The Third Sh3 Domain Of The Cin85 Adapter Protein Length = 73 | Back alignment and structure |
| >pdb|1J3T|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Intersectin 2 (Kiaa1256) Length = 74 | Back alignment and structure |
| >pdb|2BBU|A Chain A, Solution Structure Of Mouse Socs3 In Complex With A Phosphopeptide From The Gp130 Receptor Length = 164 | Back alignment and structure |
| >pdb|2BBU|A Chain A, Solution Structure Of Mouse Socs3 In Complex With A Phosphopeptide From The Gp130 Receptor Length = 164 | Back alignment and structure |
| >pdb|2YDL|A Chain A, Crystal Structure Of Sh3c From Cin85 Length = 69 | Back alignment and structure |
| >pdb|2RN8|A Chain A, Nmr Structure Note: Murine Itk Sh3 Domain Length = 64 | Back alignment and structure |
| >pdb|2K6D|A Chain A, Cin85 Sh3-C Domain In Complex With Ubiquitin Length = 62 | Back alignment and structure |
| >pdb|2CRE|A Chain A, Solution Structure Of Rsgi Ruh-036, An Sh3 Domain From Human Cdna Length = 71 | Back alignment and structure |
| >pdb|1RPY|A Chain A, Crystal Structure Of The Dimeric Sh2 Domain Of Aps Length = 114 | Back alignment and structure |
| >pdb|1RPY|A Chain A, Crystal Structure Of The Dimeric Sh2 Domain Of Aps Length = 114 | Back alignment and structure |
| >pdb|2K79|A Chain A, Solution Structure Of The Binary Complex Between The Sh3 And Sh2 Domain Of Interleukin-2 Tyrosine Kinase Length = 63 | Back alignment and structure |
| >pdb|1AWW|A Chain A, Sh3 Domain From Bruton's Tyrosine Kinase, Nmr, 42 Structures Length = 67 | Back alignment and structure |
| >pdb|2K3B|A Chain A, Seeing The Invisible: Structures Of Excited Protein States By Relaxation Dispersion Nmr Length = 62 | Back alignment and structure |
| >pdb|1AWJ|A Chain A, Intramolecular Itk-Proline Complex, Nmr, Minimized Average Structure Length = 77 | Back alignment and structure |
| >pdb|4GLM|A Chain A, Crystal Structure Of The Sh3 Domain Of Dnmbp Protein [homo Sapiens] Length = 72 | Back alignment and structure |
| >pdb|3H0F|A Chain A, Crystal Structure Of The Human Fyn Sh3 R96w Mutant Length = 73 | Back alignment and structure |
| >pdb|3REB|B Chain B, Hiv-1 Nef Protein In Complex With Engineered Hck-Sh3 Domain Length = 90 | Back alignment and structure |
| >pdb|3H0H|A Chain A, Human Fyn Sh3 Domain R96i Mutant, Crystal Form I Length = 73 | Back alignment and structure |
| >pdb|1EFN|A Chain A, Hiv-1 Nef Protein In Complex With R96i Mutant Fyn Sh3 Domain Length = 59 | Back alignment and structure |
| >pdb|1TUC|A Chain A, Alpha-Spectrin Src Homology 3 Domain, Circular Permutant, Cut At S19-P20 Length = 63 | Back alignment and structure |
| >pdb|1A0N|B Chain B, Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene Tyrosine Kinase Complexed With The Synthetic Peptide P2l Corresponding To Residues 91-104 Of The P85 Subunit Of Pi3- Kinase, Family Of 25 Structures Length = 69 | Back alignment and structure |
| >pdb|1FYN|A Chain A, Phosphotransferase Length = 62 | Back alignment and structure |
| >pdb|4D8D|A Chain A, Crystal Structure Of Hiv-1 Nef Fyn-sh3 R96w Variant Length = 58 | Back alignment and structure |
| >pdb|3UA6|A Chain A, Crystal Structure Of The Human Fyn Sh3 Domain Length = 64 | Back alignment and structure |
| >pdb|1AZG|B Chain B, Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene Tyrosine Kinase Kinase Complexed With The Synthetic Peptide P2l Corresponding To Residues 91-104 Of The P85 Subunit Of Pi3-Kinase, Minimized Average (Probmap) Structure Length = 67 | Back alignment and structure |
| >pdb|2RPN|A Chain A, A Crucial Role For High Intrinsic Specificity In The Function Of Yeast Sh3 Domains Length = 59 | Back alignment and structure |
| >pdb|1AVZ|C Chain C, V-1 Nef Protein In Complex With Wild Type Fyn Sh3 Domain Length = 57 | Back alignment and structure |
| >pdb|1SHF|A Chain A, Crystal Structure Of The Sh3 Domain In Human Fyn; Comparison Of The Three-Dimensional Structures Of Sh3 Domains In Tyrosine Kinases And Spectrin Length = 59 | Back alignment and structure |
| >pdb|3REA|B Chain B, Hiv-1 Nef Protein In Complex With Engineered Hck-Sh3 Domain Length = 61 | Back alignment and structure |
| >pdb|1M27|C Chain C, Crystal Structure Of SapFYNSH3SLAM TERNARY COMPLEX Length = 61 | Back alignment and structure |
| >pdb|1JO8|A Chain A, Structural Analysis Of The Yeast Actin Binding Protein Abp1 Sh3 Domain Length = 58 | Back alignment and structure |
| >pdb|2JMC|A Chain A, Chimer Between Spc-Sh3 And P41 Length = 77 | Back alignment and structure |
| >pdb|2HDV|A Chain A, Crystal Structure Of The Src Homology-2 Domain Of The Adapter Protein Sh2-B Length = 111 | Back alignment and structure |
| >pdb|2HDV|A Chain A, Crystal Structure Of The Src Homology-2 Domain Of The Adapter Protein Sh2-B Length = 111 | Back alignment and structure |
| >pdb|4F14|A Chain A, Structure Of The Sh3 Domain Of Human Nebulette In Complex With A Peptide Of Xirp2 Length = 64 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 376 | |||
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 7e-73 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 7e-51 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 2e-64 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 2e-27 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 2e-61 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 3e-26 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 2e-50 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 1e-30 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 3e-15 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 8e-50 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 3e-34 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 5e-25 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 4e-08 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 6e-47 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 1e-45 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 6e-47 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 2e-19 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 1e-46 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 1e-46 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 4e-46 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 4e-46 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 1e-45 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 1e-45 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 8e-43 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 4e-42 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 1e-41 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 1e-41 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 6e-41 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 6e-41 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 7e-41 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 3e-27 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 3e-23 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 2e-10 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 5e-40 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 5e-40 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 9e-38 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 9e-38 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 2e-37 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 2e-37 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 3e-37 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 1e-24 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 9e-24 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 2e-10 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 3e-37 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 3e-37 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 8e-37 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 1e-21 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 1e-13 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 8e-37 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 9e-36 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 8e-37 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 8e-37 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 1e-36 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 5e-36 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 1e-36 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 7e-36 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 2e-36 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 2e-36 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 3e-36 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 3e-36 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 1e-35 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 1e-35 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 1e-35 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 1e-35 | |
| 2bbu_A | 164 | Suppressor of cytokine signaling 3; SH2 domain, ex | 6e-35 | |
| 2bbu_A | 164 | Suppressor of cytokine signaling 3; SH2 domain, ex | 7e-35 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 1e-34 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 1e-34 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 1e-34 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 1e-34 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 2e-34 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 2e-34 | |
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 3e-34 | |
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 3e-34 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 3e-34 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 3e-34 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 8e-34 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 8e-34 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 9e-34 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 9e-34 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 2e-33 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 2e-33 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 2e-33 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 2e-33 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 2e-33 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 2e-33 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 2e-33 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 4e-32 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 1e-32 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 1e-32 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 3e-32 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 3e-32 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 4e-32 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 4e-32 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 5e-32 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 5e-32 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 6e-32 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 6e-32 | |
| 2izv_A | 187 | Suppressor of cytokine signaling 4; signal transdu | 3e-31 | |
| 2izv_A | 187 | Suppressor of cytokine signaling 4; signal transdu | 3e-31 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 1e-30 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 1e-30 | |
| 2c9w_A | 169 | Suppressor of cytokine signaling 2; growth regulat | 2e-30 | |
| 2c9w_A | 169 | Suppressor of cytokine signaling 2; growth regulat | 2e-30 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 2e-30 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 2e-30 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 3e-30 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 3e-30 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 3e-30 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 3e-30 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 5e-30 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 5e-30 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 7e-30 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 7e-30 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 1e-29 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 1e-29 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 4e-29 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 3e-26 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 5e-05 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 6e-29 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 6e-29 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 1e-28 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 1e-28 | |
| 1ju5_A | 109 | CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid | 2e-28 | |
| 1ju5_A | 109 | CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid | 2e-28 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 2e-28 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 2e-28 | |
| 3gqi_B | 226 | Phospholipase C-gamma-1; phosphorylated kinase, PY | 6e-28 | |
| 3gqi_B | 226 | Phospholipase C-gamma-1; phosphorylated kinase, PY | 4e-27 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 1e-27 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 1e-27 | |
| 2eo6_A | 141 | B-cell linker protein; SH2, cytoplasmic adapter pr | 3e-27 | |
| 2eo6_A | 141 | B-cell linker protein; SH2, cytoplasmic adapter pr | 3e-27 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 8e-27 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 1e-26 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 8e-21 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 1e-20 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 4e-26 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 1e-22 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 1e-24 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 1e-24 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 1e-23 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 7e-15 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 2e-04 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 2e-23 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 6e-15 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 5e-05 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 3e-23 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 2e-14 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 4e-05 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 3e-23 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 2e-15 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 6e-04 | |
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 3e-23 | |
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 3e-23 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 4e-23 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 2e-18 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 2e-04 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 5e-23 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 1e-14 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 5e-05 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 5e-23 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 9e-15 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 6e-05 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 9e-23 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 1e-19 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 7e-04 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 1e-22 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 1e-22 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 1e-22 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 4e-15 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 4e-04 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 1e-22 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 5e-16 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 6e-04 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 1e-22 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 8e-15 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 2e-04 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 1e-22 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 3e-18 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 5e-04 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 2e-22 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 3e-19 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 5e-04 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 2e-22 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 8e-15 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 3e-04 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 3e-22 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 4e-15 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 2e-04 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 3e-22 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 3e-15 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 7e-04 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 3e-22 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 9e-16 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 7e-04 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 3e-22 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 5e-15 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 7e-04 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 3e-22 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 2e-15 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 2e-04 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 4e-22 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 2e-15 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 6e-04 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 6e-22 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 8e-16 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 5e-04 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 6e-22 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 6e-22 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 6e-22 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 5e-16 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 2e-04 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 7e-22 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 6e-09 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 7e-22 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 4e-17 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 7e-22 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 4e-15 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 9e-04 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} Length | 8e-22 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} Length | 1e-16 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} Length | 7e-04 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 8e-22 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 2e-15 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 5e-04 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 9e-22 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 2e-14 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 1e-04 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 1e-21 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 2e-14 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 6e-04 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 1e-21 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 9e-18 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 2e-04 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 1e-21 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 3e-15 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 1e-21 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 1e-14 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 4e-05 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 1e-21 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 4e-15 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 2e-04 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 2e-21 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 5e-15 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 3e-04 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 2e-21 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 9e-15 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 3e-21 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 2e-15 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 5e-04 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 3e-21 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 4e-15 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 6e-04 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 4e-21 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 8e-18 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 6e-21 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 3e-15 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 4e-04 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 6e-21 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 7e-14 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 6e-04 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 8e-21 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 7e-15 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 1e-20 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 9e-15 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 9e-04 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 1e-20 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 2e-14 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 2e-20 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 6e-15 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 2e-20 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 1e-13 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 4e-04 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 2e-20 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 2e-15 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 2e-20 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 3e-16 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 5e-04 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 2e-20 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 1e-14 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 3e-20 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 1e-12 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 3e-20 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 9e-14 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 5e-04 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 3e-20 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 8e-16 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 4e-20 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 1e-13 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 5e-20 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 2e-14 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 2e-05 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 5e-20 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 6e-14 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 6e-20 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 4e-15 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 5e-05 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 6e-20 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 7e-16 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 5e-12 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 8e-11 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 7e-20 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 2e-15 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 2e-04 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 8e-20 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 1e-16 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 9e-20 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 1e-15 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 6e-04 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 1e-19 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 7e-15 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 1e-19 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 4e-17 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 1e-19 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 3e-13 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 2e-19 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 5e-15 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 2e-19 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 1e-13 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 2e-19 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 1e-14 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 3e-04 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 2e-19 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 4e-14 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 7e-04 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 2e-19 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 6e-15 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 9e-05 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 2e-19 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 3e-13 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 2e-19 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 3e-14 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 6e-04 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 4e-19 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 3e-15 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 4e-19 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 8e-15 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 5e-19 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 2e-14 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 4e-04 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 5e-19 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 3e-14 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 2e-04 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 5e-19 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 5e-13 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 7e-04 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 6e-19 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 2e-15 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 6e-19 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 4e-13 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 9e-19 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 8e-13 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 1e-18 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 2e-13 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 1e-18 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 1e-13 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 1e-04 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 1e-18 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 5e-14 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 1e-18 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 2e-14 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 1e-18 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 4e-13 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 2e-18 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 2e-14 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 2e-18 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 4e-14 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 2e-18 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 2e-14 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 2e-18 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 5e-14 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 3e-18 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 1e-17 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 3e-18 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 5e-14 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 2e-05 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 4e-18 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 9e-14 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 4e-18 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 2e-12 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 5e-18 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 1e-12 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 5e-18 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 3e-12 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 5e-18 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 1e-14 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 6e-18 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 6e-13 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 6e-18 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 1e-17 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 6e-18 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 2e-15 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 7e-18 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 2e-15 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 7e-18 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 1e-16 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 9e-18 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 3e-16 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 1e-17 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 1e-15 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 4e-04 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 1e-17 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 1e-12 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 1e-17 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 5e-12 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 1e-04 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 2e-17 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 2e-11 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 2e-17 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 2e-11 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 2e-17 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 5e-12 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 3e-17 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 4e-16 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 3e-17 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 3e-16 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 3e-17 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 1e-12 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 4e-17 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 7e-13 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 4e-17 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 7e-11 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 5e-17 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 3e-13 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 5e-17 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 1e-13 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 5e-17 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 4e-15 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 5e-17 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 9e-14 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 6e-17 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 1e-11 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 9e-17 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 5e-14 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 1e-16 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 1e-13 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 2e-16 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 5e-08 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 7e-05 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 3e-16 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 3e-14 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 3e-16 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 9e-12 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 5e-16 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 2e-10 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 5e-16 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 3e-12 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 6e-16 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 1e-15 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 7e-16 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 3e-14 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 7e-16 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 3e-13 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 9e-16 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 5e-08 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 1e-15 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 2e-14 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 1e-15 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 3e-11 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 1e-15 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 2e-13 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 3e-04 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 1e-15 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 7e-14 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 3e-04 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 1e-15 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 2e-14 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 2e-15 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 2e-15 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 2e-15 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 2e-12 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 2e-15 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 2e-15 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 2e-15 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 4e-13 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 4e-04 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 2e-15 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 1e-13 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 5e-04 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 3e-15 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 7e-14 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 3e-15 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 2e-11 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 3e-15 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 3e-10 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 4e-15 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 9e-14 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 5e-04 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 5e-15 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 5e-14 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 9e-15 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 3e-08 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 9e-15 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 7e-12 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 9e-15 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 2e-13 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 4e-04 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 1e-14 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 1e-11 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 2e-14 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 8e-12 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 2e-14 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 4e-14 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 2e-14 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 6e-11 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 2e-14 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 4e-14 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 2e-14 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 6e-14 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 4e-14 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 2e-09 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 7e-14 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 1e-08 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 8e-14 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 5e-10 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 1e-13 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 2e-09 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 1e-13 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 2e-11 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 2e-13 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 1e-12 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 2e-13 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 1e-07 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 2e-13 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 3e-09 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 2e-13 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 6e-09 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 2e-13 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 2e-12 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 2e-13 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 1e-08 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 4e-13 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 1e-12 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 6e-13 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 7e-13 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 7e-13 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 4e-05 | |
| 1ug1_A | 92 | KIAA1010 protein; structural genomics, SH3 domain, | 7e-13 | |
| 1ug1_A | 92 | KIAA1010 protein; structural genomics, SH3 domain, | 7e-08 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 1e-12 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 3e-06 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 1e-12 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 3e-09 | |
| 2el8_A | 118 | Signal-transducing adaptor protein 2; SH2 domain, | 3e-12 | |
| 2el8_A | 118 | Signal-transducing adaptor protein 2; SH2 domain, | 3e-12 | |
| 2cr4_A | 126 | 3BP-2, SH3 domain-binding protein 2; structural ge | 8e-12 | |
| 2cr4_A | 126 | 3BP-2, SH3 domain-binding protein 2; structural ge | 8e-12 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 1e-11 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 8e-06 | |
| 3jv3_A | 283 | Intersectin-1; SH3 domain, DH domain, guanine nucl | 4e-11 | |
| 3jv3_A | 283 | Intersectin-1; SH3 domain, DH domain, guanine nucl | 1e-07 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 5e-11 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 1e-05 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 1e-10 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 1e-07 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 2e-10 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 5e-07 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 4e-10 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 4e-10 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 8e-10 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 1e-09 | |
| 3i5r_A | 83 | Phosphatidylinositol 3-kinase regulatory subunit a | 2e-08 | |
| 1u3o_A | 82 | Huntingtin-associated protein-interacting protein; | 2e-08 | |
| 1u3o_A | 82 | Huntingtin-associated protein-interacting protein; | 7e-05 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 5e-08 | |
| 3or8_A | 197 | Transcription elongation factor SPT6; SH2, CTD bin | 1e-07 | |
| 3or8_A | 197 | Transcription elongation factor SPT6; SH2, CTD bin | 1e-07 | |
| 3kfv_A | 308 | Tight junction protein ZO-3; structural genomics c | 3e-07 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 4e-07 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 4e-07 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 8e-07 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 7e-04 | |
| 2xp1_A | 178 | SPT6; transcription, IWS1, histone chaperone, mRNA | 3e-06 | |
| 2xp1_A | 178 | SPT6; transcription, IWS1, histone chaperone, mRNA | 3e-06 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 2e-05 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 2e-05 | |
| 2de0_X | 526 | Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran | 5e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 2e-04 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 2e-04 | |
| 1kjw_A | 295 | Postsynaptic density protein 95; protein-protein i | 2e-04 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 4e-04 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 4e-04 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 8e-04 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 9e-04 | |
| 3tvt_A | 292 | Disks large 1 tumor suppressor protein; DLG, SRC-h | 8e-04 |
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
Score = 225 bits (574), Expect = 7e-73
Identities = 130/217 (59%), Positives = 164/217 (75%), Gaps = 4/217 (1%)
Query: 1 MEAIAKHDFNATAEDELSFRKSQVLKILNMEDDMNWYRAELDGKEGLIPSNYIEMKNHDW 60
MEAIAK+DF ATA+DELSF++ +LK+LN E D NWY+AEL+GK+G IP NYIEMK H W
Sbjct: 1 MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPW 60
Query: 61 YYGRITRADAERLLS-NKHEGAFLIRVSESSPGDFSLSVKCSDGVQHFKVLRDSSGKFFL 119
++G+I RA AE +LS +H+GAFLIR SES+PGDFSLSVK + VQHFKVLRD +GK+FL
Sbjct: 61 FFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL 120
Query: 120 WVVKFNSLNELVEYHRTASVSRSQDVK---LRDMVPEECLVQALYDFTPQEPGELEFRRG 176
WVVKFNSLNELV+YHR+ SVSR+Q + + + + VQAL+DF PQE GEL FRRG
Sbjct: 121 WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRG 180
Query: 177 DVITVTDRSDQHWWHGEIGARKGLFPATYILNMEDDM 213
D I V D SD +WW G + G+FP Y+ + ++
Sbjct: 181 DFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV 217
|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 | Back alignment and structure |
|---|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Length = 112 | Back alignment and structure |
|---|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Length = 112 | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 | Back alignment and structure |
|---|
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 | Back alignment and structure |
|---|
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 | Back alignment and structure |
|---|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Length = 104 | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Length = 104 | Back alignment and structure |
|---|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 | Back alignment and structure |
|---|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Length = 128 | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Length = 128 | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Length = 103 | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Length = 103 | Back alignment and structure |
|---|
| >2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 | Back alignment and structure |
|---|
| >2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Length = 105 | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Length = 105 | Back alignment and structure |
|---|
| >2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 | Back alignment and structure |
|---|
| >2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 | Back alignment and structure |
|---|
| >1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 109 | Back alignment and structure |
|---|
| >1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 109 | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 | Back alignment and structure |
|---|
| >3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Length = 141 | Back alignment and structure |
|---|
| >2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Length = 141 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 | Back alignment and structure |
|---|
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 | Back alignment and structure |
|---|
| >1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 92 | Back alignment and structure |
|---|
| >1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 92 | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Length = 108 | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Length = 108 | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Length = 463 | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Length = 463 | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 | Back alignment and structure |
|---|
| >3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Length = 83 | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Length = 78 | Back alignment and structure |
|---|
| >3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Length = 70 | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Length = 70 | Back alignment and structure |
|---|
| >2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Length = 178 | Back alignment and structure |
|---|
| >2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Length = 178 | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 | Back alignment and structure |
|---|
| >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 | Back alignment and structure |
|---|
| >1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 376 | |||
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 100.0 | |
| 4fbn_A | 246 | 1-phosphatidylinositol 4,5-bisphosphate phosphodi | 100.0 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 100.0 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 100.0 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 100.0 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 100.0 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 100.0 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 100.0 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 99.97 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.97 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.97 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.97 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 99.97 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 99.97 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 99.97 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 99.97 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.97 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 99.97 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.96 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.96 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 99.96 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 99.96 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 99.96 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 99.95 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 99.94 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 99.93 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 99.93 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 99.88 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 99.93 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.93 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.92 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.92 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 99.92 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.92 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 99.92 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.92 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 99.92 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 99.92 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 99.92 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 99.92 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 99.92 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.91 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.91 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 99.91 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 99.85 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 99.91 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 99.91 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 99.91 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 99.91 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 99.91 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 99.91 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 99.91 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 99.91 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 99.91 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 99.91 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.9 | |
| 2lnw_A | 122 | VAV-2, guanine nucleotide exchange factor VAV2; si | 99.9 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.9 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 99.9 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 99.9 | |
| 1ju5_A | 109 | CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid | 99.9 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 99.9 | |
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 99.9 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 99.9 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 99.9 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 99.9 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 99.9 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 99.89 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 99.89 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.89 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 99.89 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 99.89 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 99.89 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 99.89 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 99.89 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 99.88 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 99.88 | |
| 2eo6_A | 141 | B-cell linker protein; SH2, cytoplasmic adapter pr | 99.88 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 99.88 | |
| 2bbu_A | 164 | Suppressor of cytokine signaling 3; SH2 domain, ex | 99.88 | |
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 99.88 | |
| 2c9w_A | 169 | Suppressor of cytokine signaling 2; growth regulat | 99.87 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 99.87 | |
| 2el8_A | 118 | Signal-transducing adaptor protein 2; SH2 domain, | 99.86 | |
| 2izv_A | 187 | Suppressor of cytokine signaling 4; signal transdu | 99.86 | |
| 2cr4_A | 126 | 3BP-2, SH3 domain-binding protein 2; structural ge | 99.85 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 99.83 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 99.83 | |
| 4fbn_A | 246 | 1-phosphatidylinositol 4,5-bisphosphate phosphodi | 99.82 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 99.82 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 99.82 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 99.79 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 99.77 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 99.77 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 99.77 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.77 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 99.77 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.76 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.76 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.76 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 99.75 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 99.72 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 99.72 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.72 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 99.72 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 99.71 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 99.71 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.7 | |
| 2lx7_A | 60 | GAS-7, growth arrest-specific protein 7; structura | 99.7 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 99.7 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 99.7 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 99.7 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 99.7 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 99.69 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 99.69 | |
| 1ju5_A | 109 | CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid | 99.69 | |
| 2xp1_A | 178 | SPT6; transcription, IWS1, histone chaperone, mRNA | 99.69 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 99.69 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 99.68 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 99.68 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 99.68 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 99.68 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 99.68 | |
| 2lnw_A | 122 | VAV-2, guanine nucleotide exchange factor VAV2; si | 99.68 | |
| 2lj0_A | 65 | Sorbin and SH3 domain-containing protein 1; R85FL, | 99.67 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 99.67 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 99.67 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 99.67 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 99.67 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 99.67 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 99.67 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 99.67 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 99.67 | |
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 99.66 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 99.66 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 99.66 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 99.65 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 99.64 | |
| 2bbu_A | 164 | Suppressor of cytokine signaling 3; SH2 domain, ex | 99.64 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 99.64 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 99.63 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} | 99.63 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 99.63 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 99.63 | |
| 2cr4_A | 126 | 3BP-2, SH3 domain-binding protein 2; structural ge | 99.63 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 99.63 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 99.63 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 99.63 | |
| 2c9w_A | 169 | Suppressor of cytokine signaling 2; growth regulat | 99.62 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 99.62 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 99.62 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 99.62 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 99.62 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 99.62 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 99.62 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.61 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 99.61 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 99.61 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 99.61 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 99.61 | |
| 2el8_A | 118 | Signal-transducing adaptor protein 2; SH2 domain, | 99.61 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 99.61 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 99.61 | |
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 99.61 | |
| 2eo6_A | 141 | B-cell linker protein; SH2, cytoplasmic adapter pr | 99.61 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 99.6 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 99.6 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 99.6 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 99.6 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 99.6 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 99.59 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 99.59 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 99.59 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 99.59 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 99.59 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 99.59 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.59 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 99.59 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 99.59 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 99.59 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 99.58 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 99.58 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 99.58 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 99.58 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 99.58 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 99.58 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 99.58 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 99.58 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 99.58 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 99.58 | |
| 2izv_A | 187 | Suppressor of cytokine signaling 4; signal transdu | 99.58 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 99.58 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 99.57 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 99.57 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 99.57 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 99.57 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 99.57 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 99.57 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.57 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 99.57 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 99.57 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 99.57 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 99.57 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 99.57 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 99.57 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 99.57 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.57 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 99.57 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 99.56 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 99.56 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 99.56 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 99.56 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.56 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 99.56 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 99.56 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.56 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 99.56 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 99.56 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 99.56 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 99.56 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 99.55 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 99.55 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.55 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 99.55 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.55 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 99.55 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 99.55 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.55 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 99.55 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 99.55 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 99.55 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 99.55 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 99.55 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 99.54 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 99.54 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 99.54 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 99.54 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 99.54 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 99.54 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 99.54 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 99.54 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.54 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 99.54 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 99.54 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 99.54 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 99.54 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.54 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.53 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 99.53 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 99.53 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.53 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 99.53 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.53 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 99.53 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 99.53 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 99.53 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 99.53 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 99.53 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 99.52 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 99.52 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.52 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 99.52 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 99.52 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 99.52 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 99.52 | |
| 4glm_A | 72 | Dynamin-binding protein; SH3 domain, DNMBP, struct | 99.52 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 99.52 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 99.52 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 99.52 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 99.52 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 99.52 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 99.52 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 99.52 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 99.52 | |
| 2lx7_A | 60 | GAS-7, growth arrest-specific protein 7; structura | 99.52 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 99.52 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.51 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 99.51 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 99.51 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 99.51 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 99.51 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.51 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 99.5 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 99.5 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 99.5 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 99.5 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 99.5 | |
| 2lj0_A | 65 | Sorbin and SH3 domain-containing protein 1; R85FL, | 99.5 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 99.5 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 99.5 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 99.5 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 99.5 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 99.49 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.49 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 99.49 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 99.49 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 99.49 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 99.49 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 99.49 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 99.49 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.48 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 99.48 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 99.47 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 99.47 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 99.47 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 99.47 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 99.46 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 99.46 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 99.45 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.45 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 99.45 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 99.45 | |
| 1v1c_A | 71 | Obscurin; muscle, sarcomere, adapter, myogenesis, | 99.45 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 99.45 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 99.45 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 99.44 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 99.44 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 99.44 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 99.43 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 99.43 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 99.43 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 99.43 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 99.42 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 99.42 | |
| 2m0y_A | 74 | Dedicator of cytokinesis protein 1; apoptosis; NMR | 99.42 | |
| 3i5r_A | 83 | Phosphatidylinositol 3-kinase regulatory subunit a | 99.42 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 99.42 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} | 99.42 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 99.41 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 99.41 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 99.41 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 99.41 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 99.4 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 99.4 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 99.4 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 99.4 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 99.4 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 99.4 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 99.39 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 99.39 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 99.39 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 99.39 | |
| 1u3o_A | 82 | Huntingtin-associated protein-interacting protein; | 99.39 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 99.38 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 99.38 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 99.38 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.38 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 99.38 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 99.38 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 99.38 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 99.37 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 99.37 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 99.37 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 99.37 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 99.37 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 99.37 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 99.37 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 99.37 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 99.37 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 99.36 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 99.36 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 99.36 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 99.36 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 99.36 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 99.36 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 99.36 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 99.36 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 99.36 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 99.36 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.36 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.36 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 99.36 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 99.35 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 99.35 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 99.35 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 99.35 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 99.35 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.35 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 99.35 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 99.35 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 99.35 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 99.35 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 99.34 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 99.34 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 99.34 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.34 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 99.34 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 99.34 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 99.34 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 99.34 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 99.34 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.34 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 99.33 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 99.33 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 99.33 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 99.33 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.33 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 99.33 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 99.33 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 99.33 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 99.33 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 99.33 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 99.33 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 99.33 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 99.33 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 99.33 | |
| 4glm_A | 72 | Dynamin-binding protein; SH3 domain, DNMBP, struct | 99.33 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 99.32 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 99.32 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 99.32 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 99.32 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 99.32 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.32 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.32 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 99.32 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 99.32 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 99.32 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 99.32 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 99.31 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 99.31 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 99.31 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 99.31 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 99.31 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.31 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 99.31 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 99.31 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 99.31 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 99.3 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 99.3 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 99.3 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 99.3 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.3 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 99.3 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 99.3 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 99.3 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 99.3 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 99.3 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 99.3 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 99.3 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 99.29 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 99.29 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 99.29 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 99.29 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 99.29 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 99.29 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.29 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 99.29 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 99.29 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 99.29 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 99.29 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 99.29 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 99.29 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 99.28 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 99.28 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 99.28 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 99.27 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.27 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 99.27 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 99.26 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 99.26 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.26 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.25 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.25 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 99.25 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.25 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 99.25 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 99.25 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 99.24 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 99.24 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 99.23 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 99.23 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.23 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 99.23 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 99.22 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 99.21 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 99.21 | |
| 3jv3_A | 283 | Intersectin-1; SH3 domain, DH domain, guanine nucl | 99.2 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 99.2 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 99.2 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 99.18 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 99.18 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 99.18 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 99.17 | |
| 3or8_A | 197 | Transcription elongation factor SPT6; SH2, CTD bin | 99.17 | |
| 2m0y_A | 74 | Dedicator of cytokinesis protein 1; apoptosis; NMR | 99.15 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 99.14 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.14 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 99.14 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 99.14 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 99.13 | |
| 2de0_X | 526 | Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran | 99.13 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 99.12 | |
| 2xp1_A | 178 | SPT6; transcription, IWS1, histone chaperone, mRNA | 99.11 | |
| 3i5r_A | 83 | Phosphatidylinositol 3-kinase regulatory subunit a | 99.1 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 99.09 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 99.09 | |
| 1v1c_A | 71 | Obscurin; muscle, sarcomere, adapter, myogenesis, | 99.09 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 99.07 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 99.05 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.02 |
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.6e-44 Score=313.55 Aligned_cols=211 Identities=63% Similarity=1.102 Sum_probs=188.5
Q ss_pred CEEEEeecCCCCCCCCccccCCCEEEEEeccCCccceeeccCCccceeccccccccccccccccCCHHHHHHHhc-CCCC
Q psy10189 1 MEAIAKHDFNATAEDELSFRKSQVLKILNMEDDMNWYRAELDGKEGLIPSNYIEMKNHDWYYGRITRADAERLLS-NKHE 79 (376)
Q Consensus 1 ~~~~al~~y~~~~~~eLsf~~Gd~i~v~~~~~~~~W~~~~~~g~~G~vP~nyve~~~~~w~~g~isr~~ae~~l~-~~~~ 79 (376)
|+|+|+|||+++.++||+|++||+|.|+++.++++||.++.+|++||||+|||++...+||||.|+|.+|+.+|. ..++
T Consensus 1 m~~~al~~~~~~~~~eLs~~~Gd~i~v~~~~~~~~W~~~~~~g~~G~~P~~yv~~~~~~w~~g~isr~~ae~lL~~~~~~ 80 (217)
T 1gri_A 1 MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHD 80 (217)
T ss_dssp CEEEECSCBCCCSSSCCCBCTTCEEEC------CCEEEEESSSCEEEEEGGGEECCCCSSBCTTCCHHHHHHHHHTCSST
T ss_pred CEEEEeeccCCcCCCcCCCCCCCEEEEEeccCCCCeEeeccCCccceECCcccccccchhhcccCCHHHHHHHHhccCCC
Confidence 899999999999999999999999999997556789999999999999999999999999999999999999994 4899
Q ss_pred ccEEEeecCCCCCceEEEEEeCCeeEEEEEEEcCCCcEEEeceeecchhhhHhhhhcccccccccccccCCCc---hhhh
Q psy10189 80 GAFLIRVSESSPGDFSLSVKCSDGVQHFKVLRDSSGKFFLWVVKFNSLNELVEYHRTASVSRSQDVKLRDMVP---EECL 156 (376)
Q Consensus 80 G~flvR~s~~~~~~~~Ls~~~~~~v~h~~I~~~~~~~~~~~~~~f~sl~~li~~~~~~~~~~~~~~~~~~~~~---~~~~ 156 (376)
|+||+|.|.+.++.|+||+..++.++|++|....+|.|++....|.++.+||++|+..++.......+..+.| ....
T Consensus 81 G~fLvR~S~~~~g~~~LSv~~~~~v~h~~I~~~~~g~~~~~~~~f~sl~eLv~~~~~~~~~~~~~~~l~~~~~~~~~~~~ 160 (217)
T 1gri_A 81 GAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTY 160 (217)
T ss_dssp TCEEEEECSSSTTCEEEEEEETTEEEEEEEEECSSSCEESSSCEESSHHHHHHHHHHSCSSSSTTCCCCBCCCCCCCCCE
T ss_pred ceEEEEccCCCCCCEEEEEEECCEEEEEEEEEcCCCCEEEeeeEcCCHHHHHHhhhccccccccceeecccccCCCCceE
Confidence 9999999999999999999999999999999999999999977899999999999998877655444433322 3467
Q ss_pred hhhcccCCCCCCCceeccCCCEEEEEecCCCcceeeeeCCeeeeeeccccccccc
Q psy10189 157 VQALYDFTPQEPGELEFRRGDVITVTDRSDQHWWHGEIGARKGLFPATYILNMED 211 (376)
Q Consensus 157 ~~al~~~~~~~~~eL~~~~g~~i~v~~~~~~~w~~~~~~~~~G~~P~~~v~~~~~ 211 (376)
++|+|+|.++.++||+|++||+|.|+.+.+++||.|+.+|+.|+||++||++++.
T Consensus 161 ~~al~~y~~~~~~eL~~~~Gd~i~v~~~~~~~W~~g~~~g~~G~~P~~yv~~~~~ 215 (217)
T 1gri_A 161 VQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNR 215 (217)
T ss_dssp EEESSCCCCSSTTBCCCCTTCEEEEEECCSSSEEEEECSSCEEEEEGGGEEEECC
T ss_pred EEecCCccCCCCCcCCCCCCCEEEEEEeCCCCeEEEEECCeEEEEeHHHeEECCC
Confidence 8999999999999999999999999999999999999999999999999998754
|
| >4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A | Back alignment and structure |
|---|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} | Back alignment and structure |
|---|
| >2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A | Back alignment and structure |
|---|
| >1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A | Back alignment and structure |
|---|
| >2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A | Back alignment and structure |
|---|
| >2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
| >4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} | Back alignment and structure |
|---|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A | Back alignment and structure |
|---|
| >2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A | Back alignment and structure |
|---|
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* | Back alignment and structure |
|---|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A | Back alignment and structure |
|---|
| >2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
| >2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A | Back alignment and structure |
|---|
| >2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} | Back alignment and structure |
|---|
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A | Back alignment and structure |
|---|
| >2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} | Back alignment and structure |
|---|
| >4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B | Back alignment and structure |
|---|
| >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} | Back alignment and structure |
|---|
| >3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 376 | ||||
| d1r1qa_ | 97 | d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA | 5e-35 | |
| d1r1qa_ | 97 | d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA | 5e-35 | |
| d1jyra_ | 96 | d.93.1.1 (A:) Growth factor receptor-bound protein | 6e-32 | |
| d1jyra_ | 96 | d.93.1.1 (A:) Growth factor receptor-bound protein | 6e-32 | |
| d1rpya_ | 86 | d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor | 4e-26 | |
| d1rpya_ | 86 | d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor | 4e-26 | |
| d1fu6a_ | 111 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 2e-24 | |
| d1fu6a_ | 111 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 2e-24 | |
| d1mila_ | 104 | d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap | 2e-23 | |
| d1mila_ | 104 | d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap | 2e-23 | |
| d1k9aa2 | 101 | d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( | 5e-23 | |
| d1k9aa2 | 101 | d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( | 5e-23 | |
| d2shpa2 | 109 | d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma | 7e-23 | |
| d2shpa2 | 109 | d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma | 7e-23 | |
| d1opka2 | 101 | d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M | 8e-23 | |
| d1opka2 | 101 | d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M | 8e-23 | |
| d2izva2 | 112 | d.93.1.1 (A:274-385) Suppressor of cytokine signal | 1e-22 | |
| d2izva2 | 112 | d.93.1.1 (A:274-385) Suppressor of cytokine signal | 1e-22 | |
| d1jwoa_ | 97 | d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho | 2e-22 | |
| d1jwoa_ | 97 | d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho | 2e-22 | |
| d2c9wa2 | 103 | d.93.1.1 (A:32-134) Suppressor of cytokine signali | 1e-21 | |
| d2c9wa2 | 103 | d.93.1.1 (A:32-134) Suppressor of cytokine signali | 1e-21 | |
| d1nrva_ | 105 | d.93.1.1 (A:) Growth factor receptor-bound protein | 1e-21 | |
| d1nrva_ | 105 | d.93.1.1 (A:) Growth factor receptor-bound protein | 1e-21 | |
| d2eyva1 | 109 | d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo | 1e-21 | |
| d2eyva1 | 109 | d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo | 1e-21 | |
| d2qmsa1 | 113 | d.93.1.1 (A:420-532) Growth factor receptor-bound | 1e-21 | |
| d2qmsa1 | 113 | d.93.1.1 (A:420-532) Growth factor receptor-bound | 1e-21 | |
| d1rjaa_ | 100 | d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu | 1e-21 | |
| d1rjaa_ | 100 | d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu | 1e-21 | |
| d1i3za_ | 103 | d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat | 1e-21 | |
| d1i3za_ | 103 | d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat | 1e-21 | |
| d1d4ta_ | 104 | d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap | 2e-21 | |
| d1d4ta_ | 104 | d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap | 2e-21 | |
| d1qada_ | 107 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 3e-21 | |
| d1qada_ | 107 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 3e-21 | |
| d1lkka_ | 105 | d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo | 3e-21 | |
| d1lkka_ | 105 | d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo | 3e-21 | |
| d1xa6a2 | 141 | d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom | 3e-21 | |
| d1xa6a2 | 141 | d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom | 3e-21 | |
| d2oq1a2 | 124 | d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 | 8e-21 | |
| d2oq1a2 | 124 | d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 | 8e-21 | |
| d2cs0a1 | 106 | d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai | 9e-21 | |
| d2cs0a1 | 106 | d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai | 9e-21 | |
| d1blja_ | 114 | d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou | 2e-20 | |
| d1blja_ | 114 | d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou | 2e-20 | |
| d1gria1 | 56 | b.34.2.1 (A:1-56) Growth factor receptor-bound pro | 2e-20 | |
| d1gria1 | 56 | b.34.2.1 (A:1-56) Growth factor receptor-bound pro | 8e-16 | |
| d2shpa3 | 108 | d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Hu | 3e-20 | |
| d2shpa3 | 108 | d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Hu | 3e-20 | |
| d1o48a_ | 106 | d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s | 3e-20 | |
| d1o48a_ | 106 | d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s | 3e-20 | |
| d2oq1a1 | 130 | d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 | 1e-19 | |
| d2oq1a1 | 130 | d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 | 3e-19 | |
| d1qcfa2 | 103 | d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H | 1e-19 | |
| d1qcfa2 | 103 | d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H | 1e-19 | |
| d1gcqa_ | 56 | b.34.2.1 (A:) Growth factor receptor-bound protein | 4e-19 | |
| d1gcqa_ | 56 | b.34.2.1 (A:) Growth factor receptor-bound protein | 3e-15 | |
| d1gcqa_ | 56 | b.34.2.1 (A:) Growth factor receptor-bound protein | 0.001 | |
| d1sema_ | 58 | b.34.2.1 (A:) Growth factor receptor-bound protein | 8e-19 | |
| d1sema_ | 58 | b.34.2.1 (A:) Growth factor receptor-bound protein | 7e-15 | |
| d1sema_ | 58 | b.34.2.1 (A:) Growth factor receptor-bound protein | 8e-04 | |
| d1ujya_ | 76 | b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens | 1e-18 | |
| d1ujya_ | 76 | b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens | 7e-14 | |
| d1ujya_ | 76 | b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens | 6e-04 | |
| d1g83a2 | 104 | d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H | 1e-18 | |
| d1g83a2 | 104 | d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H | 1e-18 | |
| d2fcia1 | 105 | d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B | 2e-18 | |
| d2fcia1 | 105 | d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B | 2e-18 | |
| d1k4us_ | 62 | b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId | 2e-18 | |
| d1k4us_ | 62 | b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId | 1e-14 | |
| d1k4us_ | 62 | b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId | 0.002 | |
| d1u06a1 | 55 | b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic | 3e-18 | |
| d1u06a1 | 55 | b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic | 2e-14 | |
| d1u06a1 | 55 | b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic | 0.001 | |
| d1bg1a3 | 141 | d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) | 7e-18 | |
| d1bg1a3 | 141 | d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) | 7e-18 | |
| d1udla_ | 98 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 9e-18 | |
| d1udla_ | 98 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 6e-15 | |
| d1udla_ | 98 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 8e-04 | |
| d1udla_ | 98 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 0.001 | |
| d1a81a1 | 129 | d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom | 1e-17 | |
| d1a81a1 | 129 | d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom | 1e-17 | |
| d1uura3 | 131 | d.93.1.1 (A:577-707) STAT homologue {Dictyostelium | 1e-17 | |
| d1uura3 | 131 | d.93.1.1 (A:577-707) STAT homologue {Dictyostelium | 1e-17 | |
| d1utia_ | 57 | b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona | 1e-17 | |
| d1utia_ | 57 | b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona | 1e-14 | |
| d1utia_ | 57 | b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona | 0.004 | |
| d1a81a2 | 125 | d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H | 2e-17 | |
| d1a81a2 | 125 | d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H | 2e-17 | |
| d1uj0a_ | 58 | b.34.2.1 (A:) Signal transducing adaptor molecule | 2e-17 | |
| d1uj0a_ | 58 | b.34.2.1 (A:) Signal transducing adaptor molecule | 4e-14 | |
| d1uj0a_ | 58 | b.34.2.1 (A:) Signal transducing adaptor molecule | 0.004 | |
| d2hspa_ | 71 | b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( | 2e-17 | |
| d2hspa_ | 71 | b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( | 2e-12 | |
| d2hspa_ | 71 | b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( | 5e-04 | |
| d1uhfa_ | 69 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 1e-16 | |
| d1uhfa_ | 69 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 8e-15 | |
| d1efna_ | 57 | b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, | 1e-16 | |
| d1efna_ | 57 | b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, | 3e-14 | |
| d1efna_ | 57 | b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, | 0.001 | |
| d1ng2a2 | 118 | b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic | 2e-16 | |
| d1ng2a2 | 118 | b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic | 2e-12 | |
| d1j3ta_ | 74 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 2e-16 | |
| d1j3ta_ | 74 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 4e-14 | |
| d1j3ta_ | 74 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 0.002 | |
| d1jo8a_ | 58 | b.34.2.1 (A:) Actin binding protein ABP1 {Baker's | 2e-16 | |
| d1jo8a_ | 58 | b.34.2.1 (A:) Actin binding protein ABP1 {Baker's | 2e-14 | |
| d1ycsb2 | 63 | b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ | 2e-16 | |
| d1ycsb2 | 63 | b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ | 4e-14 | |
| d1ycsb2 | 63 | b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ | 0.001 | |
| d1awwa_ | 67 | b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom | 2e-16 | |
| d1awwa_ | 67 | b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom | 1e-14 | |
| d1awwa_ | 67 | b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom | 0.002 | |
| d1ckaa_ | 57 | b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse | 2e-16 | |
| d1ckaa_ | 57 | b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse | 2e-13 | |
| d1ckaa_ | 57 | b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse | 0.001 | |
| d1arka_ | 60 | b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo | 3e-16 | |
| d1arka_ | 60 | b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo | 6e-13 | |
| d1ugva_ | 72 | b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 | 5e-16 | |
| d1ugva_ | 72 | b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 | 2e-14 | |
| d1ugva_ | 72 | b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 | 0.003 | |
| d1luia_ | 108 | d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou | 6e-16 | |
| d1luia_ | 108 | d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou | 6e-16 | |
| d1uhca_ | 79 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 7e-16 | |
| d1uhca_ | 79 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 1e-13 | |
| d1uhca_ | 79 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 0.004 | |
| d1bb9a_ | 83 | b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu | 9e-16 | |
| d1bb9a_ | 83 | b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu | 4e-10 | |
| d1k9aa1 | 71 | b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs | 1e-15 | |
| d1k9aa1 | 71 | b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs | 3e-13 | |
| d2iima1 | 62 | b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d | 1e-15 | |
| d2iima1 | 62 | b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d | 2e-14 | |
| d2iima1 | 62 | b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d | 4e-04 | |
| d1oota_ | 58 | b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' | 1e-15 | |
| d1oota_ | 58 | b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' | 6e-15 | |
| d1fmka1 | 64 | b.34.2.1 (A:82-145) c-src protein tyrosine kinase | 1e-15 | |
| d1fmka1 | 64 | b.34.2.1 (A:82-145) c-src protein tyrosine kinase | 2e-13 | |
| d1gl5a_ | 67 | b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc | 2e-15 | |
| d1gl5a_ | 67 | b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc | 8e-14 | |
| d1gl5a_ | 67 | b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc | 0.002 | |
| d1opka1 | 57 | b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai | 2e-15 | |
| d1opka1 | 57 | b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai | 3e-15 | |
| d1qcfa1 | 65 | b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu | 8e-15 | |
| d1qcfa1 | 65 | b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu | 4e-14 | |
| d1qcfa1 | 65 | b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu | 0.001 | |
| d1u5sa1 | 71 | b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax | 3e-14 | |
| d1u5sa1 | 71 | b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax | 5e-13 | |
| d1u5sa1 | 71 | b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax | 0.003 | |
| d1ue9a_ | 80 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 3e-14 | |
| d1ue9a_ | 80 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 2e-10 | |
| d1wlpb1 | 53 | b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic | 3e-14 | |
| d1wlpb1 | 53 | b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic | 2e-11 | |
| d1uffa_ | 93 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 3e-14 | |
| d1uffa_ | 93 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 5e-12 | |
| d1ng2a1 | 58 | b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic | 5e-14 | |
| d1ng2a1 | 58 | b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic | 9e-11 | |
| d2rn8a1 | 53 | b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus | 2e-13 | |
| d2rn8a1 | 53 | b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus | 5e-11 | |
| d2rn8a1 | 53 | b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus | 0.001 | |
| d2v1ra1 | 67 | b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe | 5e-13 | |
| d2v1ra1 | 67 | b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe | 2e-10 | |
| d1phta_ | 83 | b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a | 7e-13 | |
| d1phta_ | 83 | b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a | 2e-07 | |
| d1i07a_ | 59 | b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus | 1e-12 | |
| d1i07a_ | 59 | b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus | 2e-10 | |
| d1spka_ | 72 | b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI | 2e-12 | |
| d1spka_ | 72 | b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI | 3e-09 | |
| d1ug1a_ | 92 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 3e-12 | |
| d1ug1a_ | 92 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 7e-08 | |
| d1ug1a_ | 92 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 1e-04 | |
| d1zuua1 | 56 | b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc | 3e-12 | |
| d1zuua1 | 56 | b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc | 5e-10 | |
| d1kjwa1 | 96 | b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu | 4e-12 | |
| d1kjwa1 | 96 | b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu | 1e-08 | |
| d1gcqc_ | 69 | b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu | 1e-11 | |
| d1gcqc_ | 69 | b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu | 2e-09 | |
| d1t0ha_ | 96 | b.34.2.1 (A:) SH3-like domain of the L-type calciu | 2e-11 | |
| d1t0ha_ | 96 | b.34.2.1 (A:) SH3-like domain of the L-type calciu | 3e-06 | |
| d1i1ja_ | 106 | b.34.2.1 (A:) Melanoma inhibitory activity protein | 2e-10 | |
| d1i1ja_ | 106 | b.34.2.1 (A:) Melanoma inhibitory activity protein | 7e-07 | |
| d1i1ja_ | 106 | b.34.2.1 (A:) Melanoma inhibitory activity protein | 6e-04 | |
| d1wfwa_ | 74 | b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta | 5e-10 | |
| d1wfwa_ | 74 | b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta | 2e-07 | |
| d1wiea_ | 96 | b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human | 2e-09 | |
| d1wiea_ | 96 | b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human | 3e-09 | |
| d1vyva1 | 145 | b.34.2.1 (A:71-215) SH3-like domain of the L-type | 1e-08 | |
| d1vyva1 | 145 | b.34.2.1 (A:71-215) SH3-like domain of the L-type | 4e-05 | |
| d1vyua1 | 136 | b.34.2.1 (A:39-174) SH3-like domain of the L-type | 3e-07 | |
| d1vyua1 | 136 | b.34.2.1 (A:39-174) SH3-like domain of the L-type | 0.003 | |
| d1bf5a3 | 142 | d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) | 4e-05 | |
| d1bf5a3 | 142 | d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) | 4e-05 |
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: SH2-like superfamily: SH2 domain family: SH2 domain domain: GRB2-related adaptor protein 2 (MONA, GRID) species: Mouse (Mus musculus) [TaxId: 10090]
Score = 122 bits (307), Expect = 5e-35
Identities = 51/97 (52%), Positives = 72/97 (74%)
Query: 53 IEMKNHDWYYGRITRADAERLLSNKHEGAFLIRVSESSPGDFSLSVKCSDGVQHFKVLRD 112
I+++ +W++ ++R AE LL K G F+IR S+SSPGDFS+SV+ D VQHFKV+RD
Sbjct: 1 IDIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRD 60
Query: 113 SSGKFFLWVVKFNSLNELVEYHRTASVSRSQDVKLRD 149
+ G +FLW KF SLN+LV+Y+RT S+S+ + V LRD
Sbjct: 61 TKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRD 97
|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 | Back information, alignment and structure |
|---|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 | Back information, alignment and structure |
|---|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 | Back information, alignment and structure |
|---|
| >d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 141 | Back information, alignment and structure |
|---|
| >d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 141 | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 | Back information, alignment and structure |
|---|
| >d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 142 | Back information, alignment and structure |
|---|
| >d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 142 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 376 | |||
| d1opka2 | 101 | Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: | 99.93 | |
| d1rjaa_ | 100 | Tyrosine-protein kinase 6 (Breast tumor kinase, Br | 99.93 | |
| d1jwoa_ | 97 | Csk homologous kinase Chk {Human (Homo sapiens) [T | 99.93 | |
| d1k9aa2 | 101 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.93 | |
| d1jyra_ | 96 | Growth factor receptor-bound protein 2 (GRB2) {Hum | 99.92 | |
| d1r1qa_ | 97 | GRB2-related adaptor protein 2 (MONA, GRID) {Mouse | 99.92 | |
| d1a81a1 | 129 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 99.92 | |
| d2oq1a1 | 130 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 99.91 | |
| d1lkka_ | 105 | p56-lck tyrosine kinase {Human (Homo sapiens) [Tax | 99.91 | |
| d1a81a2 | 125 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 99.91 | |
| d1i3za_ | 103 | Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus | 99.91 | |
| d1d4ta_ | 104 | The Xlp protein Sap {Human (Homo sapiens) [TaxId: | 99.91 | |
| d1mila_ | 104 | Shc adaptor protein {Human (Homo sapiens) [TaxId: | 99.91 | |
| d2oq1a2 | 124 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 99.91 | |
| d1nrva_ | 105 | Growth factor receptor-bound protein 10, GRB10 {Hu | 99.91 | |
| d2fcia1 | 105 | Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: | 99.91 | |
| d1g83a2 | 104 | Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: | 99.9 | |
| d2shpa2 | 109 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 99.9 | |
| d1o48a_ | 106 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 99.9 | |
| d1blja_ | 114 | P55 Blk protein tyrosine kinase {Mouse (Mus muscul | 99.9 | |
| d1qcfa2 | 103 | Hemopoetic cell kinase Hck {Human (Homo sapiens) [ | 99.9 | |
| d2izva2 | 112 | Suppressor of cytokine signaling 4, SOCS-4 {Human | 99.9 | |
| d1qada_ | 107 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 99.89 | |
| d2qmsa1 | 113 | Growth factor receptor-bound protein 7 {Human (Hom | 99.89 | |
| d1luia_ | 108 | Itk/tsk protein tyrosine kinase {Mouse (Mus muscul | 99.88 | |
| d2cs0a1 | 106 | Hematopoietic SH2 domain containing protein HSH2D | 99.87 | |
| d2eyva1 | 109 | Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 | 99.87 | |
| d1rpya_ | 86 | Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI | 99.87 | |
| d1fu6a_ | 111 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 99.86 | |
| d2shpa3 | 108 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 99.84 | |
| d2c9wa2 | 103 | Suppressor of cytokine signaling 2, SOCS-2 {Human | 99.84 | |
| d1r1qa_ | 97 | GRB2-related adaptor protein 2 (MONA, GRID) {Mouse | 99.79 | |
| d1jyra_ | 96 | Growth factor receptor-bound protein 2 (GRB2) {Hum | 99.78 | |
| d1gria1 | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.77 | |
| d1xa6a2 | 141 | Beta-chimaerin, N-terminal domain {Human (Homo sap | 99.76 | |
| d1rjaa_ | 100 | Tyrosine-protein kinase 6 (Breast tumor kinase, Br | 99.75 | |
| d1opka2 | 101 | Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: | 99.74 | |
| d1jwoa_ | 97 | Csk homologous kinase Chk {Human (Homo sapiens) [T | 99.72 | |
| d1wlpb1 | 53 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.71 | |
| d1k9aa2 | 101 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.71 | |
| d1k4us_ | 62 | p67phox {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d1uj0a_ | 58 | Signal transducing adaptor molecule Stam2 {Mouse ( | 99.7 | |
| d1opka1 | 57 | Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul | 99.7 | |
| d1a81a1 | 129 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 99.7 | |
| d1oota_ | 58 | Hypothetical protein YFR024c {Baker's yeast (Sacch | 99.69 | |
| d1mila_ | 104 | Shc adaptor protein {Human (Homo sapiens) [TaxId: | 99.69 | |
| d1u06a1 | 55 | alpha-Spectrin, SH3 domain {Chicken (Gallus gallus | 99.69 | |
| d1utia_ | 57 | Grb2-related adaptor protein 2 (Mona/Gads) {Mouse | 99.69 | |
| d2izva2 | 112 | Suppressor of cytokine signaling 4, SOCS-4 {Human | 99.69 | |
| d1i3za_ | 103 | Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus | 99.69 | |
| d1ng2a1 | 58 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.68 | |
| d1sema_ | 58 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.68 | |
| d1qcfa2 | 103 | Hemopoetic cell kinase Hck {Human (Homo sapiens) [ | 99.68 | |
| d1rpya_ | 86 | Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI | 99.68 | |
| d1gcqa_ | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.68 | |
| d1ycsb2 | 63 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.67 | |
| d2oq1a1 | 130 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 99.67 | |
| d1g83a2 | 104 | Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: | 99.67 | |
| d1lkka_ | 105 | p56-lck tyrosine kinase {Human (Homo sapiens) [Tax | 99.67 | |
| d2shpa2 | 109 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 99.67 | |
| d1udla_ | 98 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.67 | |
| d1d4ta_ | 104 | The Xlp protein Sap {Human (Homo sapiens) [TaxId: | 99.66 | |
| d1k9aa1 | 71 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.66 | |
| d1nrva_ | 105 | Growth factor receptor-bound protein 10, GRB10 {Hu | 99.66 | |
| d2rn8a1 | 53 | Bruton's tyrosine kinase {Mus musculus [TaxId: 100 | 99.66 | |
| d1ugva_ | 72 | Olygophrenin-1 like protein (KIAA0621) {Human (Hom | 99.66 | |
| d1a81a2 | 125 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 99.66 | |
| d1blja_ | 114 | P55 Blk protein tyrosine kinase {Mouse (Mus muscul | 99.66 | |
| d1udla_ | 98 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.65 | |
| d1o48a_ | 106 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 99.65 | |
| d2oq1a2 | 124 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 99.65 | |
| d1zuua1 | 56 | BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.65 | |
| d2eyva1 | 109 | Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 | 99.65 | |
| d1jo8a_ | 58 | Actin binding protein ABP1 {Baker's yeast (Sacchar | 99.65 | |
| d2fcia1 | 105 | Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: | 99.64 | |
| d2cs0a1 | 106 | Hematopoietic SH2 domain containing protein HSH2D | 99.64 | |
| d1ckaa_ | 57 | C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) | 99.64 | |
| d1j3ta_ | 74 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.63 | |
| d1awwa_ | 67 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.63 | |
| d1gl5a_ | 67 | tyrosine kinase tec {Mouse (Mus musculus) [TaxId: | 99.62 | |
| d2qmsa1 | 113 | Growth factor receptor-bound protein 7 {Human (Hom | 99.62 | |
| d1qada_ | 107 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 99.62 | |
| d1spka_ | 72 | BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 | 99.62 | |
| d1efna_ | 57 | Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu | 99.62 | |
| d1uhfa_ | 69 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.61 | |
| d1i07a_ | 59 | EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 | 99.6 | |
| d1ujya_ | 76 | Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 | 99.6 | |
| d2v1ra1 | 67 | Peroxisomal membrane protein Pex13p {Baker's yeast | 99.6 | |
| d1fmka1 | 64 | c-src protein tyrosine kinase {Human (Homo sapiens | 99.6 | |
| d1wiea_ | 96 | RIM binding protein 2, RIMBP2 {Human (Homo sapiens | 99.6 | |
| d2c9wa2 | 103 | Suppressor of cytokine signaling 2, SOCS-2 {Human | 99.6 | |
| d1uhca_ | 79 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.59 | |
| d1ng2a2 | 118 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.59 | |
| d1arka_ | 60 | SH3 domain from nebulin {Human (Homo sapiens) [Tax | 99.59 | |
| d1u5sa1 | 71 | Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.59 | |
| d1ug1a_ | 92 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.59 | |
| d1uffa_ | 93 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.58 | |
| d1wfwa_ | 74 | Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | 99.57 | |
| d1qcfa1 | 65 | Hemapoetic cell kinase Hck {Human (Homo sapiens) [ | 99.57 | |
| d1ue9a_ | 80 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.56 | |
| d1gcqa_ | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.56 | |
| d1utia_ | 57 | Grb2-related adaptor protein 2 (Mona/Gads) {Mouse | 99.56 | |
| d1luia_ | 108 | Itk/tsk protein tyrosine kinase {Mouse (Mus muscul | 99.56 | |
| d1sema_ | 58 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.56 | |
| d2iima1 | 62 | p56-lck tyrosine kinase, SH3 domain {Human (Homo s | 99.55 | |
| d2hspa_ | 71 | Phospholipase C, SH3 domain {Human (Homo sapiens) | 99.54 | |
| d1fu6a_ | 111 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 99.54 | |
| d1k4us_ | 62 | p67phox {Human (Homo sapiens) [TaxId: 9606]} | 99.54 | |
| d1gcqc_ | 69 | Vav N-terminal SH3 domain {Mouse (Mus musculus) [T | 99.53 | |
| d2shpa3 | 108 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 99.53 | |
| d1u06a1 | 55 | alpha-Spectrin, SH3 domain {Chicken (Gallus gallus | 99.53 | |
| d1phta_ | 83 | Phosphatidylinositol 3-kinase (p85-alpha subunit, | 99.52 | |
| d1ng2a1 | 58 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.52 | |
| d1uj0a_ | 58 | Signal transducing adaptor molecule Stam2 {Mouse ( | 99.51 | |
| d1wlpb1 | 53 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.51 | |
| d1bb9a_ | 83 | Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 | 99.48 | |
| d1xa6a2 | 141 | Beta-chimaerin, N-terminal domain {Human (Homo sap | 99.48 | |
| d2rn8a1 | 53 | Bruton's tyrosine kinase {Mus musculus [TaxId: 100 | 99.46 | |
| d1ckaa_ | 57 | C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) | 99.45 | |
| d1jo8a_ | 58 | Actin binding protein ABP1 {Baker's yeast (Sacchar | 99.44 | |
| d1opka1 | 57 | Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul | 99.44 | |
| d1ycsb2 | 63 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.43 | |
| d1efna_ | 57 | Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu | 99.43 | |
| d1kjwa1 | 96 | Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.43 | |
| d1ng2a2 | 118 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.42 | |
| d1oota_ | 58 | Hypothetical protein YFR024c {Baker's yeast (Sacch | 99.42 | |
| d1uhfa_ | 69 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.42 | |
| d1ujya_ | 76 | Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 | 99.42 | |
| d1t0ha_ | 96 | SH3-like domain of the L-type calcium channel {Rab | 99.41 | |
| d1gria1 | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.41 | |
| d1i1ja_ | 106 | Melanoma inhibitory activity protein {Human (Homo | 99.41 | |
| d1arka_ | 60 | SH3 domain from nebulin {Human (Homo sapiens) [Tax | 99.41 | |
| d1gl5a_ | 67 | tyrosine kinase tec {Mouse (Mus musculus) [TaxId: | 99.41 | |
| d1fmka1 | 64 | c-src protein tyrosine kinase {Human (Homo sapiens | 99.41 | |
| d1bg1a3 | 141 | STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | 99.4 | |
| d1j3ta_ | 74 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.4 | |
| d1uura3 | 131 | STAT homologue {Dictyostelium discoideum [TaxId: 4 | 99.39 | |
| d1ug1a_ | 92 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.39 | |
| d2hspa_ | 71 | Phospholipase C, SH3 domain {Human (Homo sapiens) | 99.38 | |
| d1awwa_ | 67 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.38 | |
| d1ugva_ | 72 | Olygophrenin-1 like protein (KIAA0621) {Human (Hom | 99.38 | |
| d1wfwa_ | 74 | Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | 99.37 | |
| d1k9aa1 | 71 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.36 | |
| d1uhca_ | 79 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.36 | |
| d2v1ra1 | 67 | Peroxisomal membrane protein Pex13p {Baker's yeast | 99.34 | |
| d1i07a_ | 59 | EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 | 99.33 | |
| d1u5sa1 | 71 | Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.33 | |
| d1spka_ | 72 | BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 | 99.32 | |
| d1ue9a_ | 80 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.32 | |
| d1zuua1 | 56 | BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.29 | |
| d1uffa_ | 93 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.29 | |
| d1qcfa1 | 65 | Hemapoetic cell kinase Hck {Human (Homo sapiens) [ | 99.28 | |
| d2iima1 | 62 | p56-lck tyrosine kinase, SH3 domain {Human (Homo s | 99.25 | |
| d1wiea_ | 96 | RIM binding protein 2, RIMBP2 {Human (Homo sapiens | 99.24 | |
| d1gcqc_ | 69 | Vav N-terminal SH3 domain {Mouse (Mus musculus) [T | 99.24 | |
| d1bb9a_ | 83 | Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 | 99.23 | |
| d1phta_ | 83 | Phosphatidylinositol 3-kinase (p85-alpha subunit, | 99.23 | |
| d1vyva1 | 145 | SH3-like domain of the L-type calcium channel {Rat | 99.2 | |
| d1t0ha_ | 96 | SH3-like domain of the L-type calcium channel {Rab | 99.16 | |
| d1kjwa1 | 96 | Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.13 | |
| d1i1ja_ | 106 | Melanoma inhibitory activity protein {Human (Homo | 99.1 | |
| d1vyua1 | 136 | SH3-like domain of the L-type calcium channel {Rat | 98.99 | |
| d1uura3 | 131 | STAT homologue {Dictyostelium discoideum [TaxId: 4 | 98.89 | |
| d1vyva1 | 145 | SH3-like domain of the L-type calcium channel {Rat | 98.87 | |
| d1bg1a3 | 141 | STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | 98.82 | |
| d1vyua1 | 136 | SH3-like domain of the L-type calcium channel {Rat | 98.6 | |
| d1bf5a3 | 142 | STAT-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.56 | |
| d1ri9a_ | 77 | Fyn-binding protein (T-cell adapter protein adap) | 95.38 | |
| d1bf5a3 | 142 | STAT-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.1 | |
| d1ri9a_ | 77 | Fyn-binding protein (T-cell adapter protein adap) | 94.39 | |
| d3buxb3 | 88 | Cbl {Human (Homo sapiens) [TaxId: 9606]} | 87.95 |
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: SH2-like superfamily: SH2 domain family: SH2 domain domain: Abl tyrosine kinase species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.93 E-value=1.1e-26 Score=173.05 Aligned_cols=98 Identities=38% Similarity=0.625 Sum_probs=90.1
Q ss_pred cccccccccccChHHHHHhhcCCCCCceEEeecCCCCCceEEEEEeCCeeEEEEEEEcCCCcEEEe-ccccCCHHHHHHH
Q psy10189 234 MKNHDWYYGRITRADAERLLSNKHEGAFLIRVSESSPGDFSLSVKCSDGVQHFKVLRDSSGKFFLW-VVKFNSLNELVEY 312 (376)
Q Consensus 234 ~~~~~w~~g~i~r~~ae~~L~~~~~G~flvR~s~~~~~~~~ls~~~~~~v~h~~I~~~~~~~~~~~-~~~f~sl~~lv~~ 312 (376)
++.++||||.|+|++||.+|++.++|+||||+|.+.++.|+||++.+++|+||+|....+|.|++. +..|+||.+||+|
T Consensus 2 Le~~~Wy~g~isR~eAe~lL~~~~~G~FLVR~S~~~~~~~~LSv~~~~~v~H~~I~~~~~g~~~~~~~~~F~sl~~LI~~ 81 (101)
T d1opka2 2 LEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHH 81 (101)
T ss_dssp GGGSTTEEEECCHHHHHHHGGGCCTTEEEEEECSSSTTCEEEEEEETTEEEEEECEECTTSCEESSTTSCBSSHHHHHHH
T ss_pred cccCcccCCCCCHHHHHHHhcCCCCCeEEEEecCCCCCCEEEEEEcCcceEEEEeEECCCCCEEeCCCcccCCHHHHHHH
Confidence 577899999999999999999999999999999888999999999999999999999888888887 5789999999999
Q ss_pred HhhCCcCCcceeeeCCCCCcc
Q psy10189 313 HRTASVSRSQDVKLRDMVPEE 333 (376)
Q Consensus 313 y~~~~~~~~~~~~L~~p~~~~ 333 (376)
|+.++.++ .++|+.|+|+.
T Consensus 82 y~~~~~~l--~~~L~~P~pr~ 100 (101)
T d1opka2 82 HSTVADGL--ITTLHYPAPKR 100 (101)
T ss_dssp HTTCCTTS--SSCCCEECCCC
T ss_pred HhhCCCCC--ceECCCccCCC
Confidence 99998766 67899998764
|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3buxb3 d.93.1.1 (B:264-351) Cbl {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|