Psyllid ID: psy1022

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MSRRRRPQRRRRHRPPALSRTSSFSSITDSSMSLNIITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVNDINFENMSNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFTIPRTEPVRPIDPGAWVAHTAAIRGDGFPLRPPSVSTLTSTSSSLTSSIAETESADVVDWLDKHVEGFTDRREARKYASQMLKFGYIRHTVNKITFSEQCYYIFGDLLQQR
cccccccccccccccccccccccccccccccccEEEEEEEEEccccccccEEEEccccccccccEEEEEEccccccccccccccccEEEEEcccccccccHHHHHHHHHHHccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccHHHHHHHHHHHHHcccccEEEEEEcccccccccEEEccccccc
ccccccHHHHcccccccccccccccccccccccccEEEEEEEccccccEEEEEEEcccccccccEEEEEEccccccHcccccccccEEEEEcccccccccHHHHHHHHHHHHcccccEEEEEEEccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccHHHHHHHcccccccHHHHHHHHHccHHHHHHHHHHHHHHHHcccEEEEEEEEEEcccEEEEEcHHcccc
msrrrrpqrrrrhrppalsrtssfssitdssmsLNIITVTLNMDTVNFLGISIvgqsnkggdggiyVGSIMKGgavaldgriepgdmilqvndinfenmsnDEAVRVLREVvqkpgpikLVVAkcwdpnpkgyftiprtepvrpidpgawvahtaairgdgfplrppsvstltstsssltssiaetesadVVDWLDKHVEGFTDRREARKYASQMLKFGYIRHTVNKITFSEQCYYIFGDLLQQR
msrrrrpqrrrrhrppalsrtssfssitdssmSLNIITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVNDINFENMSNDEAVRVLREvvqkpgpiklvvakcwdpnpKGYFTIPRTEPVRPIDPGAWVAHTAAIRGDGFPLRPPSVSTLTSTSssltssiaetesadvvdwLDKHVEGFTDRREARKYASQMLKFGYIRHTVNKITFSEQCYYIFGDLLQQR
MSrrrrpqrrrrhrppALsrtssfssitdssmsLNIITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVNDINFENMSNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFTIPRTEPVRPIDPGAWVAHTAAIRGDGFPLRPPSVstltstsssltssIAETESADVVDWLDKHVEGFTDRREARKYASQMLKFGYIRHTVNKITFSEQCYYIFGDLLQQR
********************************SLNIITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVNDINFENMSNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFTIPRTEPVRPIDPGAWVAHTAAIRGDGF***************************DVVDWLDKHVEGFTDRREARKYASQMLKFGYIRHTVNKITFSEQCYYIFGDLL***
************************************ITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVNDINFENMSNDEAVRVLREVVQKPGPIKLVVAKCWDP**************************************************************************************MLKFGYIRHTVNKITFSEQCYYIFGDLLQ**
***************************TDSSMSLNIITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVNDINFENMSNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFTIPRTEPVRPIDPGAWVAHTAAIRGDGFPLRPP******************TESADVVDWLDKHVEGFTDRREARKYASQMLKFGYIRHTVNKITFSEQCYYIFGDLLQQR
*******************************MSLNIITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVNDINFENMSNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFTIPRTEPVRPIDPGAWVAHTAAIRGDGFPLRPPSVSTLTSTSSSLTSSIAETESADVVDWLDKHVEGFTDRREARKYASQMLKFGYIRHTVNKITFSEQCYYIFGDLLQ**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRRRRPQRRRRHRPPALSRTSSFSSITDSSMSLNIITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVNDINFENMSNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFTIPRTEPVRPIDPGAWVAHTAAIRGDGFPLRPPSVSTLTSTSSSLTSSIAETESADVVDWLDKHVEGFTDRREARKYASQMLKFGYIRHTVNKITFSEQCYYIFGDLLQQR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query245 2.2.26 [Sep-21-2011]
Q60838 736 Segment polarity protein yes N/A 0.910 0.302 0.642 4e-91
O14641 736 Segment polarity protein yes N/A 0.902 0.300 0.647 1e-90
P51142 736 Segment polarity protein N/A N/A 0.902 0.300 0.620 1e-89
Q05AS8 732 Segment polarity protein yes N/A 0.902 0.301 0.609 5e-89
Q9WVB9 695 Segment polarity protein no N/A 0.975 0.343 0.582 4e-87
P51141 695 Segment polarity protein no N/A 0.975 0.343 0.582 4e-87
Q5IS48 670 Segment polarity protein no N/A 0.902 0.329 0.651 3e-86
P54792 670 Putative Segment polarity no N/A 0.902 0.329 0.630 2e-85
Q6DKE2 717 Segment polarity protein N/A N/A 0.902 0.308 0.597 2e-85
Q61062 716 Segment polarity protein no N/A 0.893 0.305 0.601 8e-85
>sp|Q60838|DVL2_MOUSE Segment polarity protein dishevelled homolog DVL-2 OS=Mus musculus GN=Dvl2 PE=1 SV=2 Back     alignment and function desciption
 Score =  333 bits (855), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 169/263 (64%), Positives = 197/263 (74%), Gaps = 40/263 (15%)

Query: 18  LSRTSSFSSITDSSMSLNIITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVA 77
           + RTSSFSS+TDS+MSLNIITVTLNM+  NFLGISIVGQSN+ GDGGIY+GSIMKGGAVA
Sbjct: 247 MERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVA 306

Query: 78  LDGRIEPGDMILQVNDINFENMSNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFTIP 137
            DGRIEPGDM+LQVND+NFENMSND+AVRVLR++V KPGPI L VAKCWDP+P+ YFT+P
Sbjct: 307 ADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLP 366

Query: 138 RTEPVRPIDPGAWVAHTAAIRGDGFPLRP--PSVSTLTSTSS-----------------S 178
           R EP++PIDP AWV+H+AA+ G  FP  P   S+ST+TS SS                 S
Sbjct: 367 RNEPIQPIDPAAWVSHSAALTG-AFPAYPGSSSMSTITSGSSLPDGCEGRGLSVHMDMAS 425

Query: 179 LTSSIAETES--------------------ADVVDWLDKHVEGFTDRREARKYASQMLKF 218
           +T ++A  ES                    +DVVDWL  HVEGF +RREARKYAS +LK 
Sbjct: 426 VTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKA 485

Query: 219 GYIRHTVNKITFSEQCYYIFGDL 241
           G IRHTVNKITFSEQCYY+FGDL
Sbjct: 486 GLIRHTVNKITFSEQCYYVFGDL 508
Participates in Wnt signaling by binding to the cytoplasmic C-terminus of frizzled family members and transducing the Wnt signal to down-stream effectors. Promotes internalization and degradation of frizzled proteins upon Wnt signaling. Plays a role both in canonical and non-canonical Wnt signaling. Plays a role in the signal transduction pathways mediated by multiple Wnt genes.
Mus musculus (taxid: 10090)
>sp|O14641|DVL2_HUMAN Segment polarity protein dishevelled homolog DVL-2 OS=Homo sapiens GN=DVL2 PE=1 SV=1 Back     alignment and function description
>sp|P51142|DVL2_XENLA Segment polarity protein dishevelled homolog DVL-2 OS=Xenopus laevis GN=dvl2 PE=1 SV=1 Back     alignment and function description
>sp|Q05AS8|DVL2_XENTR Segment polarity protein dishevelled homolog DVL-2 OS=Xenopus tropicalis GN=dvl2 PE=2 SV=1 Back     alignment and function description
>sp|Q9WVB9|DVL1_RAT Segment polarity protein dishevelled homolog DVL-1 OS=Rattus norvegicus GN=Dvl1 PE=1 SV=3 Back     alignment and function description
>sp|P51141|DVL1_MOUSE Segment polarity protein dishevelled homolog DVL-1 OS=Mus musculus GN=Dvl1 PE=1 SV=2 Back     alignment and function description
>sp|Q5IS48|DVL1_PANTR Segment polarity protein dishevelled homolog DVL-1 OS=Pan troglodytes GN=DVL1 PE=2 SV=1 Back     alignment and function description
>sp|P54792|DVL1L_HUMAN Putative Segment polarity protein dishevelled homolog DVL-1-like OS=Homo sapiens GN=DVL1L1 PE=5 SV=1 Back     alignment and function description
>sp|Q6DKE2|DVL3_XENLA Segment polarity protein dishevelled homolog DVL-3 OS=Xenopus laevis GN=dvl3 PE=2 SV=1 Back     alignment and function description
>sp|Q61062|DVL3_MOUSE Segment polarity protein dishevelled homolog DVL-3 OS=Mus musculus GN=Dvl3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
332022489 667 Segment polarity protein dishevelled-lik 0.926 0.340 0.724 1e-106
307167538 675 Segment polarity protein dishevelled-lik 0.926 0.336 0.720 1e-105
380021292 690 PREDICTED: segment polarity protein dish 0.918 0.326 0.718 1e-104
328782547 690 PREDICTED: segment polarity protein dish 0.918 0.326 0.718 1e-104
307192443 673 Segment polarity protein dishevelled-lik 0.918 0.334 0.718 1e-104
340723338 690 PREDICTED: segment polarity protein dish 0.918 0.326 0.748 1e-104
345482423 710 PREDICTED: segment polarity protein dish 0.914 0.315 0.754 1e-104
340723340 668 PREDICTED: segment polarity protein dish 0.918 0.336 0.748 1e-104
383857521 688 PREDICTED: segment polarity protein dish 0.918 0.327 0.748 1e-103
345482425 691 PREDICTED: segment polarity protein dish 0.914 0.324 0.738 1e-103
>gi|332022489|gb|EGI62796.1| Segment polarity protein dishevelled-like protein DVL-3 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/272 (72%), Positives = 212/272 (77%), Gaps = 45/272 (16%)

Query: 16  PALSRTSSFSSITDSSMSLNIITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGA 75
           P +SRTSSFSSITDS+MSLNIITV+LNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGA
Sbjct: 188 PPMSRTSSFSSITDSTMSLNIITVSLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGA 247

Query: 76  VALDGRIEPGDMILQVNDINFENMSNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFT 135
           VALDGRIEPGDMILQVNDINFENMSNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFT
Sbjct: 248 VALDGRIEPGDMILQVNDINFENMSNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFT 307

Query: 136 IPRTEPVRPIDPGAWVAHTAAIRGDGFPLRPPSVS------------------------- 170
           IPRTEPVRPIDPGAWVAHTAAIRG+GFP RPPS +                         
Sbjct: 308 IPRTEPVRPIDPGAWVAHTAAIRGEGFPPRPPSATTLTSTSSSLASTLPDTERPLEELHL 367

Query: 171 TLTSTSSSLTSSIAETES--------------------ADVVDWLDKHVEGFTDRREARK 210
           T+ +   ++  ++A ++S                    ADVVDWL+ HVEGF DRR+ARK
Sbjct: 368 TIHTDMPTIVRAMARSDSGLEIRDRMWLKITIPNAFIGADVVDWLNTHVEGFLDRRDARK 427

Query: 211 YASQMLKFGYIRHTVNKITFSEQCYYIFGDLL 242
           YAS MLK GYIRHTVNKITFSEQCYYIFGDL 
Sbjct: 428 YASLMLKAGYIRHTVNKITFSEQCYYIFGDLC 459

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307167538|gb|EFN61109.1| Segment polarity protein dishevelled-like protein DVL-3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380021292|ref|XP_003694503.1| PREDICTED: segment polarity protein dishevelled homolog DVL-3-like [Apis florea] Back     alignment and taxonomy information
>gi|328782547|ref|XP_392577.4| PREDICTED: segment polarity protein dishevelled homolog DVL-3 [Apis mellifera] Back     alignment and taxonomy information
>gi|307192443|gb|EFN75659.1| Segment polarity protein dishevelled-like protein DVL-3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340723338|ref|XP_003400047.1| PREDICTED: segment polarity protein dishevelled homolog DVL-3-like isoform 1 [Bombus terrestris] gi|350401331|ref|XP_003486120.1| PREDICTED: segment polarity protein dishevelled homolog DVL-3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|345482423|ref|XP_003424592.1| PREDICTED: segment polarity protein dishevelled homolog DVL-3 isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340723340|ref|XP_003400048.1| PREDICTED: segment polarity protein dishevelled homolog DVL-3-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|383857521|ref|XP_003704253.1| PREDICTED: segment polarity protein dishevelled homolog DVL-3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|345482425|ref|XP_001608119.2| PREDICTED: segment polarity protein dishevelled homolog DVL-3 isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
UNIPROTKB|F1P5N3 656 DVL3 "Uncharacterized protein" 0.636 0.237 0.691 1.4e-80
UNIPROTKB|B1WAP7 713 dvl3 "Segment polarity protein 0.636 0.218 0.685 3.6e-80
UNIPROTKB|F1P4M8 687 Gga.16412 "Uncharacterized pro 0.636 0.227 0.679 4.6e-80
UNIPROTKB|Q5F487 529 Gga.16412 "Uncharacterized pro 0.636 0.294 0.679 4.6e-80
UNIPROTKB|F1MMW6 715 DVL3 "Uncharacterized protein" 0.636 0.218 0.691 9.5e-80
UNIPROTKB|F1PIB1 719 DVL3 "Uncharacterized protein" 0.636 0.216 0.691 9.5e-80
UNIPROTKB|J9P8S5 718 DVL3 "Uncharacterized protein" 0.636 0.217 0.691 9.5e-80
UNIPROTKB|Q92997 716 DVL3 "Segment polarity protein 0.636 0.217 0.691 9.5e-80
UNIPROTKB|I3LNW9 662 DVL3 "Uncharacterized protein" 0.636 0.235 0.691 9.5e-80
MGI|MGI:108100 716 Dvl3 "dishevelled 3, dsh homol 0.636 0.217 0.691 9.5e-80
UNIPROTKB|F1P5N3 DVL3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 578 (208.5 bits), Expect = 1.4e-80, Sum P(2) = 1.4e-80
 Identities = 110/159 (69%), Positives = 126/159 (79%)

Query:    34 LNIITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVND 93
             LNIITVTLNM+  NFLGISIVGQSN+ GDGGIY+GSIMKGGAVA DGRIEPGDM+LQVND
Sbjct:   190 LNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVND 249

Query:    94 INFENMSNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFTIPRTEPVRPIDPGAWVAH 153
             INFENMSND+AVRVLRE+V KPGPI L VAKCWDP+P+G F++PR+EP+RPIDP AWV+H
Sbjct:   250 INFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFSLPRSEPIRPIDPAAWVSH 309

Query:   154 TAAIRGDGFPL--RPPSVXXXXXXXXXXXXXIAETESAD 190
             TAA+ G  +P     PS+             I ETE  D
Sbjct:   310 TAAMTGT-YPAYGMSPSMSTITSTSSSITSSIPETERLD 347
GO:0004871 "signal transducer activity" evidence=IEA
GO:0035556 "intracellular signal transduction" evidence=IEA
GO:0002020 "protease binding" evidence=IEA
GO:0003148 "outflow tract septum morphogenesis" evidence=IEA
GO:0005109 "frizzled binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0008013 "beta-catenin binding" evidence=IEA
GO:0038031 "non-canonical Wnt receptor signaling pathway via JNK cascade" evidence=IEA
GO:0043507 "positive regulation of JUN kinase activity" evidence=IEA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IEA
GO:0046982 "protein heterodimerization activity" evidence=IEA
GO:0060070 "canonical Wnt receptor signaling pathway" evidence=IEA
GO:0090103 "cochlea morphogenesis" evidence=IEA
GO:0090179 "planar cell polarity pathway involved in neural tube closure" evidence=IEA
UNIPROTKB|B1WAP7 dvl3 "Segment polarity protein dishevelled homolog DVL-3" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|F1P4M8 Gga.16412 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F487 Gga.16412 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MMW6 DVL3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PIB1 DVL3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P8S5 DVL3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q92997 DVL3 "Segment polarity protein dishevelled homolog DVL-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LNW9 DVL3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:108100 Dvl3 "dishevelled 3, dsh homolog (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P51140DSH_DROMENo assigned EC number0.65460.91830.3611yesN/A
Q05AS8DVL2_XENTRNo assigned EC number0.60960.90200.3019yesN/A
Q60838DVL2_MOUSENo assigned EC number0.64250.91020.3029yesN/A
O14641DVL2_HUMANNo assigned EC number0.64750.90200.3002yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
cd0443884 cd04438, DEP_dishevelled, DEP (Dishevelled, Egl-10 5e-33
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 2e-20
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 2e-19
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 6e-17
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 2e-10
cd0437181 cd04371, DEP, DEP domain, named after Dishevelled, 3e-10
pfam0061074 pfam00610, DEP, Domain found in Dishevelled, Egl-1 5e-10
smart0004977 smart00049, DEP, Domain found in Dishevelled, Egl- 9e-09
cd0444983 cd04449, DEP_DEPDC5-like, DEP (Dishevelled, Egl-10 3e-06
COG0793 406 COG0793, Prc, Periplasmic protease [Cell envelope 6e-05
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 5e-04
cd0444383 cd04443, DEP_GPR155, DEP (Dishevelled, Egl-10, and 6e-04
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 0.004
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 0.004
>gnl|CDD|239885 cd04438, DEP_dishevelled, DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in dishevelled-like proteins Back     alignment and domain information 
 Score =  114 bits (288), Expect = 5e-33
 Identities = 43/52 (82%), Positives = 47/52 (90%)

Query: 189 ADVVDWLDKHVEGFTDRREARKYASQMLKFGYIRHTVNKITFSEQCYYIFGD 240
           +D+VDWL  HVEG TDRREARKYAS +LK GYIRHTVNKITFSEQCYY+FGD
Sbjct: 33  SDLVDWLLSHVEGLTDRREARKYASSLLKLGYIRHTVNKITFSEQCYYVFGD 84

Dishevelled-like proteins play a key role in the transduction of the Wnt signal from the cell surface to the nucleus, which in turn is an important regulatory pathway for cellular development and growth. They contain an N-terminal DIX domain, a central PDZ domain, and a C-terminal DEP domain. Length = 84
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|239836 cd04371, DEP, DEP domain, named after Dishevelled, Egl-10, and Pleckstrin, where this domain was first discovered Back     alignment and domain information
>gnl|CDD|216020 pfam00610, DEP, Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) Back     alignment and domain information
>gnl|CDD|214489 smart00049, DEP, Domain found in Dishevelled, Egl-10, and Pleckstrin Back     alignment and domain information
>gnl|CDD|239896 cd04449, DEP_DEPDC5-like, DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in DEPDC5-like proteins Back     alignment and domain information
>gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|239890 cd04443, DEP_GPR155, DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in GPR155-like proteins Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 245
KOG3571|consensus 626 100.0
cd0443884 DEP_dishevelled DEP (Dishevelled, Egl-10, and Plec 99.87
KOG3549|consensus 505 99.72
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.64
KOG3550|consensus207 99.58
KOG3209|consensus984 99.46
KOG0609|consensus 542 99.45
KOG3209|consensus984 99.43
KOG3551|consensus 506 99.39
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 99.25
KOG3553|consensus124 99.25
KOG1892|consensus 1629 99.21
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 99.16
KOG3580|consensus 1027 99.13
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 99.13
cd04437125 DEP_Epac DEP (Dishevelled, Egl-10, and Pleckstrin) 99.12
KOG3580|consensus 1027 99.08
KOG3651|consensus 429 99.08
cd0444983 DEP_DEPDC5-like DEP (Dishevelled, Egl-10, and Plec 98.99
KOG3605|consensus829 98.98
cd0444185 DEP_2_DEP6 DEP (Dishevelled, Egl-10, and Pleckstri 98.94
KOG3606|consensus358 98.88
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.86
KOG3552|consensus 1298 98.84
PF0061074 DEP: Domain found in Dishevelled, Egl-10, and Plec 98.83
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.82
cd0444881 DEP_PIKfyve DEP (Dishevelled, Egl-10, and Pleckstr 98.8
cd0437181 DEP DEP domain, named after Dishevelled, Egl-10, a 98.8
cd0444383 DEP_GPR155 DEP (Dishevelled, Egl-10, and Pleckstri 98.74
smart0004977 DEP Domain found in Dishevelled, Egl-10, and Pleck 98.7
cd0444282 DEP_1_DEP6 DEP (Dishevelled, Egl-10, and Pleckstri 98.66
cd0443981 DEP_1_P-Rex DEP (Dishevelled, Egl-10, and Pleckstr 98.65
cd0445088 DEP_RGS7-like DEP (Dishevelled, Egl-10, and Plecks 98.62
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 98.57
KOG3542|consensus 1283 98.47
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.43
PRK11186 667 carboxy-terminal protease; Provisional 98.4
cd0444093 DEP_2_P-Rex DEP (Dishevelled, Egl-10, and Pleckstr 98.35
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.32
PLN00049 389 carboxyl-terminal processing protease; Provisional 98.32
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.29
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 98.24
cd04444109 DEP_PLEK2 DEP (Dishevelled, Egl-10, and Pleckstrin 98.24
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.11
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.07
KOG3605|consensus829 98.07
KOG1738|consensus 638 98.01
KOG3938|consensus334 97.89
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.8
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.75
PRK10942473 serine endoprotease; Provisional 97.66
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.62
PRK10139455 serine endoprotease; Provisional 97.59
PRK10139455 serine endoprotease; Provisional 97.55
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.46
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.45
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 97.45
PRK10898353 serine endoprotease; Provisional 97.41
PRK10942473 serine endoprotease; Provisional 97.37
PRK10779449 zinc metallopeptidase RseP; Provisional 97.34
cd0444599 DEP_PLEK1 DEP (Dishevelled, Egl-10, and Pleckstrin 97.07
PRK10779 449 zinc metallopeptidase RseP; Provisional 97.06
cd0444695 DEP_DEPDC4 DEP (Dishevelled, Egl-10, and Pleckstri 97.05
cd0443684 DEP_fRgd2 DEP (Dishevelled, Egl-10, and Pleckstrin 97.04
KOG0606|consensus 1205 96.95
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 96.93
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 96.8
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 96.68
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 96.51
COG3975558 Predicted protease with the C-terminal PDZ domain 96.46
KOG3129|consensus231 96.22
KOG3532|consensus 1051 95.86
COG3480342 SdrC Predicted secreted protein containing a PDZ d 95.66
PRK09681276 putative type II secretion protein GspC; Provision 95.32
COG0265347 DegQ Trypsin-like serine proteases, typically peri 95.32
cd0444792 DEP_BRCC3 DEP (Dishevelled, Egl-10, and Pleckstrin 94.99
KOG1421|consensus 955 94.51
KOG4371|consensus1332 94.51
KOG1320|consensus473 93.79
KOG4371|consensus1332 93.55
COG3031275 PulC Type II secretory pathway, component PulC [In 92.91
KOG3572|consensus 1701 92.12
KOG4407|consensus 1973 89.33
PF1281278 PDZ_1: PDZ-like domain 88.81
KOG1945|consensus377 87.54
KOG0792|consensus 1144 83.5
>KOG3571|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.8e-80  Score=573.58  Aligned_cols=240  Identities=71%  Similarity=1.142  Sum_probs=215.5

Q ss_pred             ccccccccCCCCCC-CCCCCCCCCCCCCCCceeeEEEEEEcCCCCcccEEEEcccCCCCCCCEEEEeecCCChhhhcCCC
Q psy1022           4 RRRPQRRRRHRPPA-LSRTSSFSSITDSSMSLNIITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVALDGRI   82 (245)
Q Consensus         4 ~~~~~~r~~~r~~~-~~~~ss~ss~~~s~~~~~i~~V~L~k~~~~~LG~sI~gg~~~~~~~gi~I~~V~~Gg~A~~~G~L   82 (245)
                      +|+||||||+|+|+ ++++|||||+++++|+++|++|+|+++..++|||+|+|+.+..+++||||.+|++||++++||+|
T Consensus       217 ~r~K~rrrkkR~p~~~sr~SSfSSiTdSsmslnIITV~LnMe~vnfLGiSivgqsn~rgDggIYVgsImkgGAVA~DGRI  296 (626)
T KOG3571|consen  217 RRKKRRRRKKRRPRVPSRASSFSSITDSSMSLNIITVTLNMETVNFLGISIVGQSNARGDGGIYVGSIMKGGAVALDGRI  296 (626)
T ss_pred             HHHHHhhhhhcCCCccccccccccccccccceeEEEEEecccccccceeEeecccCcCCCCceEEeeeccCceeeccCcc
Confidence            57788999999998 89999999999999999999999999999999999999998889999999999999999999999


Q ss_pred             CCCCEEEeeCCeecccCCHHHHHHHHHhccCCCCcEEEEEEecCCCCCCCCcccCCCCCcCcCCCCCcccccccccCC--
Q psy1022          83 EPGDMILQVNDINFENMSNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFTIPRTEPVRPIDPGAWVAHTAAIRGD--  160 (245)
Q Consensus        83 ~~GD~Il~VNg~~l~~~t~~eav~~Lr~~~~~~~~V~L~V~r~~~~~~~~~~~~~r~~p~~p~d~~~~~~~~~~~~~~--  160 (245)
                      .+||+||+||.++|++|++++||++||++++++++|+|+|++||||++.++|++||++|++||||++|+.|+++++|.  
T Consensus       297 e~GDMiLQVNevsFENmSNd~AVrvLREaV~~~gPi~ltvAk~~DP~~q~~fTipr~epvrPIDp~awv~ht~a~tg~~p  376 (626)
T KOG3571|consen  297 EPGDMILQVNEVSFENMSNDQAVRVLREAVSRPGPIKLTVAKCWDPNPQSYFTIPRGEPVRPIDPAAWVSHTQALTGAPP  376 (626)
T ss_pred             CccceEEEeeecchhhcCchHHHHHHHHHhccCCCeEEEEeeccCCCCcccccCCCCCcCCcCCHHHHHHHHHHhccCCc
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999999874  


Q ss_pred             CCCC-CCCC-----------CCccccCCCCC--------cccccCCC-cchhhhhhhhhcccchhhHHHHHHHHHHhhcc
Q psy1022         161 GFPL-RPPS-----------VSTLTSTSSSL--------TSSIAETE-SADVVDWLDKHVEGFTDRREARKYASQMLKFG  219 (245)
Q Consensus       161 ~~~~-~~p~-----------~~~~~~t~~~~--------~~~~p~~~-~~d~v~wl~~~v~g~~~r~~a~~~a~~~l~~~  219 (245)
                      .|+. .-+-           ...|+.+.|.+        .-.||.+. ++||||||++|||||+|||||||||+.|||+|
T Consensus       377 a~~~~~e~~~~~~~~d~~~vvraMa~pdSGLeirdRmWlKItIPnafiGsDlVdWL~~hVeg~~~RkeAR~yAs~lLk~g  456 (626)
T KOG3571|consen  377 AIIEQNEKIELLTEMDMIIVVRAMARPDSGLEIRDRMWLKITIPNAFIGSDLVDWLVDHVEGLHERKEARKYASRLLKAG  456 (626)
T ss_pred             cchhccccchhcccccHHHHHHhhcCCCCcceeccceeeeeecchhhcchhHHHHHHHHhhhhhhHHHHHHHHHHHHHhC
Confidence            1210 0000           01222333332        12356654 79999999999999999999999999999999


Q ss_pred             ceeecccccccccceeeeeccccc
Q psy1022         220 YIRHTVNKITFSEQCYYIFGDLLQ  243 (245)
Q Consensus       220 ~i~h~~~k~~f~e~cyy~~~~~~~  243 (245)
                      ||||||||+||||||||||||+|+
T Consensus       457 ~IrHtVnK~TFtEqCYYVfGD~c~  480 (626)
T KOG3571|consen  457 YIRHTVNKLTFTEQCYYVFGDECS  480 (626)
T ss_pred             chhhcccceeeeeeeEEEeccccc
Confidence            999999999999999999999998

>cd04438 DEP_dishevelled DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in dishevelled-like proteins Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>cd04437 DEP_Epac DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in Epac-like proteins Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>cd04449 DEP_DEPDC5-like DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in DEPDC5-like proteins Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>cd04441 DEP_2_DEP6 DEP (Dishevelled, Egl-10, and Pleckstrin) domain 2 found in DEP6-like proteins Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>PF00610 DEP: Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP); InterPro: IPR000591 This entry represents the DEP (Dishevelled, Egl-10 and Pleckstrin) domain, a globular domain of about 80 residues that is found in over 50 proteins involved in G-protein signalling pathways Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>cd04448 DEP_PIKfyve DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in fungal RhoGEF (GDP/GTP exchange factor) PIKfyve-like proteins Back     alignment and domain information
>cd04371 DEP DEP domain, named after Dishevelled, Egl-10, and Pleckstrin, where this domain was first discovered Back     alignment and domain information
>cd04443 DEP_GPR155 DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in GPR155-like proteins Back     alignment and domain information
>smart00049 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin Back     alignment and domain information
>cd04442 DEP_1_DEP6 DEP (Dishevelled, Egl-10, and Pleckstrin) domain 1 found in DEP6-like proteins Back     alignment and domain information
>cd04439 DEP_1_P-Rex DEP (Dishevelled, Egl-10, and Pleckstrin) domain 1 found in P-Rex-like proteins Back     alignment and domain information
>cd04450 DEP_RGS7-like DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in RGS (regulator of G-protein signaling) proteins of the subfamily R7 Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>cd04440 DEP_2_P-Rex DEP (Dishevelled, Egl-10, and Pleckstrin) domain 2 found in P-Rex-like proteins Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>cd04444 DEP_PLEK2 DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in pleckstrin 2-like proteins Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>cd04445 DEP_PLEK1 DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in pleckstrin 1-like proteins Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>cd04446 DEP_DEPDC4 DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in DEPDC4-like proteins Back     alignment and domain information
>cd04436 DEP_fRgd2 DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in fungal RhoGAP (GTPase-activator protein) Rgd2-like proteins Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04447 DEP_BRCC3 DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in BBRC3-like proteins Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3572|consensus Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>KOG1945|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
2rey_A100 Crystal Structure Of The Pdz Domain Of Human Dishev 6e-41
1mc7_A95 Solution Structure Of Mdvl1 Pdz Domain Length = 95 1e-38
3cby_A108 The Dvl2 Pdz Domain In Complex With The N1 Inhibito 1e-37
3cbx_A105 The Dvl2 Pdz Domain In Complex With The C1 Inhibito 1e-37
3cc0_A108 The Dvl2 Pdz Domain In Complex With The N3 Inhibito 1e-37
3cbz_A108 The Dvl2 Pdz Domain In Complex With The N2 Inhibito 1e-37
2kaw_A90 Nmr Structure Of The Mdvl1 Pdz Domain In Complex Wi 2e-36
3fy5_A91 Dishevelled Pdz Domain Homodimer Length = 91 3e-36
1l6o_A95 Xenopus Dishevelled Pdz Domain Length = 95 1e-34
2f0a_A98 Crystal Structure Of Monomeric Uncomplexed Form Of 3e-34
1fsh_A105 Structural Basis Of The Recognition Of The Dishevel 1e-21
3ml6_A 385 A Complex Between Dishevlled2 And Clathrin Adaptor 9e-21
2jre_A108 C60-1, A Pdz Domain Designed Using Statistical Coup 9e-11
1q7x_A108 Solution Structure Of The Alternatively Spliced Pdz 5e-08
1d5g_A96 Solution Structure Of The Pdz2 Domain From Human Ph 1e-07
3pdz_A96 Solution Structure Of The Pdz2 Domain From Human Ph 1e-07
3axa_A106 Crystal Structure Of Afadin Pdz Domain In Complex W 1e-07
1t2m_A101 Solution Structure Of The Pdz Domain Of Af-6 Length 1e-07
2ain_A93 Solution Structure Of The Af-6 Pdz Domain Complexed 1e-07
1xz9_A101 Structure Of Af-6 Pdz Domain Length = 101 2e-07
2aww_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 3e-07
2jin_A102 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 3e-07
2jik_A101 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 3e-07
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 3e-07
2awx_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 4e-07
4amh_A106 Influence Of Circular Permutation On The Folding Pa 5e-07
2byg_A117 2nd Pdz Domain Of Discs Large Homologue 2 Length = 5e-07
1ozi_A99 The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Len 5e-07
1vj6_A102 Pdz2 From Ptp-Bl In Complex With The C-Terminal Lig 5e-07
1gm1_A94 Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 5e-07
2eno_A120 Solution Structure Of The Pdz Domain From Human Syn 6e-07
2opg_A98 The Crystal Structure Of The 10th Pdz Domain Of Mpd 7e-07
2x7z_A99 Crystal Structure Of The Sap97 Pdz2 I342w C378a Mut 8e-07
4g69_A100 Structure Of The Human Discs Large 1 Pdz2 - Adenoma 8e-07
2awu_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 8e-07
2g2l_A105 Crystal Structure Of The Second Pdz Domain Of Sap97 9e-07
3rl8_A105 Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc L 9e-07
3zrt_A199 Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 1e-06
2oqs_A97 Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV 1e-06
2wl7_A102 Crystal Structure Of The Psd93 Pdz1 Domain Length = 1e-06
2dm8_A116 Solution Structure Of The Eighth Pdz Domain Of Huma 1e-06
2fe5_A94 The Crystal Structure Of The Second Pdz Domain Of H 1e-06
2i0l_A84 X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The 1e-06
2ka9_A189 Solution Structure Of Psd-95 Pdz12 Complexed With C 1e-06
3gsl_A196 Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An 1e-06
2iwn_A97 3rd Pdz Domain Of Multiple Pdz Domain Protein Mpdz 1e-06
1qlc_A95 Solution Structure Of The Second Pdz Domain Of Post 2e-06
2koh_A111 Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve 2e-06
3rl7_B107 Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc L 2e-06
2k1z_A104 Solution Structure Of Par-3 Pdz3 Length = 104 2e-06
1zok_A93 Pdz1 Domain Of Synapse Associated Protein 97 Length 4e-06
1wg6_A127 Solution Structure Of Pdz Domain In Protein Xp_1108 9e-06
2fne_A117 The Crystal Structure Of The 13th Pdz Domain Of Mpd 1e-05
2qg1_A92 Crystal Structure Of The 11th Pdz Domain Of Mpdz (M 3e-05
3jxt_A104 Crystal Structure Of The Third Pdz Domain Of Sap-10 3e-05
1um7_A113 Solution Structure Of The Third Pdz Domain Of Synap 3e-05
1rgr_A99 Cyclic Peptides Targeting Pdz Domains Of Psd-95: St 4e-05
1kef_A93 Pdz1 Of Sap90 Length = 93 4e-05
2koj_A111 Solution Structure Of Mouse Par-3 Pdz2 (Residues 45 6e-05
3b76_A118 Crystal Structure Of The Third Pdz Domain Of Human 6e-05
2i1n_A102 Crystal Structure Of The 1st Pdz Domain Of Human Dl 6e-05
1iu0_A91 The First Pdz Domain Of Psd-95 Length = 91 6e-05
2kom_A121 Solution Structure Of Humar Par-3b Pdz2 (Residues 4 8e-05
2ogp_A97 Solution Structure Of The Second Pdz Domain Of Par- 8e-05
1tp3_A119 Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv 1e-04
3hvq_C170 Crystal Structure Of A Complex Between Protein Phos 1e-04
2he2_A102 Crystal Structure Of The 3rd Pdz Domain Of Human Di 2e-04
1be9_A119 The Third Pdz Domain From The Synaptic Protein Psd- 2e-04
1wha_A105 Solution Structure Of The Second Pdz Domain Of Huma 3e-04
2dlu_A111 Solution Structure Of The Second Pdz Domain Of Huma 3e-04
1wh1_A124 Solution Structure Of The Fourth Pdz Domain Of Kiaa 3e-04
3egg_C170 Crystal Structure Of A Complex Between Protein Phos 4e-04
1wf8_A107 Solution Structure Of The Pdz Domain Of Spinophilin 4e-04
3egh_C170 Crystal Structure Of A Complex Between Protein Phos 4e-04
2fn5_A94 Nmr Structure Of The Neurabin Pdz Domain (502-594) 4e-04
3tsw_A 391 Crystal Structure Of The Pdz3-Sh3-Guk Core Module O 5e-04
3k82_A98 Crystal Structure Of The Third Pdz Domain Of Psd-95 5e-04
1b8q_A127 Solution Structure Of The Extended Neuronal Nitric 6e-04
3i4w_A104 Crystal Structure Of The Third Pdz Domain Of Psd-95 6e-04
3shw_A 468 Crystal Structure Of Zo-1 Pdz3-Sh3-Guk Supramodule 6e-04
1qav_B115 Unexpected Modes Of Pdz Domain Scaffolding Revealed 7e-04
1qau_A112 Unexpected Modes Of Pdz Domain Scaffolding Revealed 8e-04
3tsw_B194 Crystal Structure Of The Pdz3-Sh3-Guk Core Module O 8e-04
>pdb|2REY|A Chain A, Crystal Structure Of The Pdz Domain Of Human Dishevelled 2 (Homologous To Drosophila Dsh) Length = 100 Back     alignment and structure 
Iteration: 1

 Score =  164 bits (414), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 78/94 (82%), Positives = 87/94 (92%)
Query: 34  LNIITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVND 93
           LNIITVTLNM+  NFLGISIVGQSN+ GDGGIY+GSIMKGGAVA DGRIEPGDM+LQVND
Sbjct: 4   LNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVND 63
Query: 94  INFENMSNDEAVRVLREVVQKPGPIKLVVAKCWD 127
           +NFENMSND+AVRVLR++V KPGPI L VAKCW+
Sbjct: 64  MNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWE 97
>pdb|1MC7|A Chain A, Solution Structure Of Mdvl1 Pdz Domain Length = 95 Back     alignment and structure
>pdb|3CBY|A Chain A, The Dvl2 Pdz Domain In Complex With The N1 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|3CBX|A Chain A, The Dvl2 Pdz Domain In Complex With The C1 Inhibitory Peptide Length = 105 Back     alignment and structure
>pdb|3CC0|A Chain A, The Dvl2 Pdz Domain In Complex With The N3 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|3CBZ|A Chain A, The Dvl2 Pdz Domain In Complex With The N2 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|2KAW|A Chain A, Nmr Structure Of The Mdvl1 Pdz Domain In Complex With Its Inhibitor Length = 90 Back     alignment and structure
>pdb|3FY5|A Chain A, Dishevelled Pdz Domain Homodimer Length = 91 Back     alignment and structure
>pdb|1L6O|A Chain A, Xenopus Dishevelled Pdz Domain Length = 95 Back     alignment and structure
>pdb|2F0A|A Chain A, Crystal Structure Of Monomeric Uncomplexed Form Of Xenopus Dishevelled Pdz Domain Length = 98 Back     alignment and structure
>pdb|1FSH|A Chain A, Structural Basis Of The Recognition Of The Dishevelled Dep Domain In The Wnt Signaling Pathway Length = 105 Back     alignment and structure
>pdb|3ML6|A Chain A, A Complex Between Dishevlled2 And Clathrin Adaptor Ap-2 Length = 385 Back     alignment and structure
>pdb|2JRE|A Chain A, C60-1, A Pdz Domain Designed Using Statistical Coupling Analysis Length = 108 Back     alignment and structure
>pdb|1Q7X|A Chain A, Solution Structure Of The Alternatively Spliced Pdz2 Domain (Pdz2b) Of Ptp-Bas (Hptp1e) Length = 108 Back     alignment and structure
>pdb|1D5G|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Complexed With A Peptide Length = 96 Back     alignment and structure
>pdb|3PDZ|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Length = 96 Back     alignment and structure
>pdb|3AXA|A Chain A, Crystal Structure Of Afadin Pdz Domain In Complex With The C-Terminal Peptide From Nectin-3 Length = 106 Back     alignment and structure
>pdb|1T2M|A Chain A, Solution Structure Of The Pdz Domain Of Af-6 Length = 101 Back     alignment and structure
>pdb|2AIN|A Chain A, Solution Structure Of The Af-6 Pdz Domain Complexed With The C-Terminal Peptide From The Bcr Protein Length = 93 Back     alignment and structure
>pdb|1XZ9|A Chain A, Structure Of Af-6 Pdz Domain Length = 101 Back     alignment and structure
>pdb|2AWW|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g With C-Terminal Glur-A Peptide Length = 105 Back     alignment and structure
>pdb|2JIN|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 102 Back     alignment and structure
>pdb|2JIK|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 101 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|2AWX|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378s Length = 105 Back     alignment and structure
>pdb|4AMH|A Chain A, Influence Of Circular Permutation On The Folding Pathway Of A Pdz Domain Length = 106 Back     alignment and structure
>pdb|2BYG|A Chain A, 2nd Pdz Domain Of Discs Large Homologue 2 Length = 117 Back     alignment and structure
>pdb|1OZI|A Chain A, The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Length = 99 Back     alignment and structure
>pdb|1VJ6|A Chain A, Pdz2 From Ptp-Bl In Complex With The C-Terminal Ligand From The Apc Protein Length = 102 Back     alignment and structure
>pdb|1GM1|A Chain A, Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 Back     alignment and structure
>pdb|2ENO|A Chain A, Solution Structure Of The Pdz Domain From Human Synaptojanin 2 Binding Protein Length = 120 Back     alignment and structure
>pdb|2OPG|A Chain A, The Crystal Structure Of The 10th Pdz Domain Of Mpdz Length = 98 Back     alignment and structure
>pdb|2X7Z|A Chain A, Crystal Structure Of The Sap97 Pdz2 I342w C378a Mutant Protein Domain Length = 99 Back     alignment and structure
>pdb|4G69|A Chain A, Structure Of The Human Discs Large 1 Pdz2 - Adenomatous Polyposis Coli Cytoskeletal Polarity Complex Length = 100 Back     alignment and structure
>pdb|2AWU|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g Length = 105 Back     alignment and structure
>pdb|2G2L|A Chain A, Crystal Structure Of The Second Pdz Domain Of Sap97 In Complex With A Glur-A C-Terminal Peptide Length = 105 Back     alignment and structure
>pdb|3RL8|A Chain A, Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc Length = 105 Back     alignment and structure
>pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 Back     alignment and structure
>pdb|2OQS|A Chain A, Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV-18 Papillomavirus E6 Peptide Length = 97 Back     alignment and structure
>pdb|2WL7|A Chain A, Crystal Structure Of The Psd93 Pdz1 Domain Length = 102 Back     alignment and structure
>pdb|2DM8|A Chain A, Solution Structure Of The Eighth Pdz Domain Of Human Inad- Like Protein Length = 116 Back     alignment and structure
>pdb|2FE5|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Dlg3 Length = 94 Back     alignment and structure
>pdb|2I0L|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The C- Terminal Peptide Of Hpv18 E6. Length = 84 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 Back     alignment and structure
>pdb|2IWN|A Chain A, 3rd Pdz Domain Of Multiple Pdz Domain Protein Mpdz (Casp Target) Length = 97 Back     alignment and structure
>pdb|1QLC|A Chain A, Solution Structure Of The Second Pdz Domain Of Postsynaptic Density-95 Length = 95 Back     alignment and structure
>pdb|2KOH|A Chain A, Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve-Cadherin C-Terminus Length = 111 Back     alignment and structure
>pdb|3RL7|B Chain B, Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc Length = 107 Back     alignment and structure
>pdb|2K1Z|A Chain A, Solution Structure Of Par-3 Pdz3 Length = 104 Back     alignment and structure
>pdb|1ZOK|A Chain A, Pdz1 Domain Of Synapse Associated Protein 97 Length = 93 Back     alignment and structure
>pdb|1WG6|A Chain A, Solution Structure Of Pdz Domain In Protein Xp_110852 Length = 127 Back     alignment and structure
>pdb|2FNE|A Chain A, The Crystal Structure Of The 13th Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|2QG1|A Chain A, Crystal Structure Of The 11th Pdz Domain Of Mpdz (Mupp1) Length = 92 Back     alignment and structure
>pdb|3JXT|A Chain A, Crystal Structure Of The Third Pdz Domain Of Sap-102 In Complex With A Fluorogenic Peptide-Based Ligand Length = 104 Back     alignment and structure
>pdb|1UM7|A Chain A, Solution Structure Of The Third Pdz Domain Of Synapse- Associated Protein 102 Length = 113 Back     alignment and structure
>pdb|1RGR|A Chain A, Cyclic Peptides Targeting Pdz Domains Of Psd-95: Structural Basis For Enhanced Affinity And Enzymatic Stability Length = 99 Back     alignment and structure
>pdb|1KEF|A Chain A, Pdz1 Of Sap90 Length = 93 Back     alignment and structure
>pdb|2KOJ|A Chain A, Solution Structure Of Mouse Par-3 Pdz2 (Residues 450-558) Length = 111 Back     alignment and structure
>pdb|3B76|A Chain A, Crystal Structure Of The Third Pdz Domain Of Human Ligand-of-numb Protein-x (lnx1) In Complex With The C-terminal Peptide From The Coxsackievirus And Adenovirus Receptor Length = 118 Back     alignment and structure
>pdb|2I1N|A Chain A, Crystal Structure Of The 1st Pdz Domain Of Human Dlg3 Length = 102 Back     alignment and structure
>pdb|1IU0|A Chain A, The First Pdz Domain Of Psd-95 Length = 91 Back     alignment and structure
>pdb|2KOM|A Chain A, Solution Structure Of Humar Par-3b Pdz2 (Residues 451-549) Length = 121 Back     alignment and structure
>pdb|2OGP|A Chain A, Solution Structure Of The Second Pdz Domain Of Par-3 Length = 97 Back     alignment and structure
>pdb|1TP3|A Chain A, Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv Peptide Ligand Length = 119 Back     alignment and structure
>pdb|3HVQ|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Neurabin Length = 170 Back     alignment and structure
>pdb|2HE2|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Discs Large Homologue 2, Dlg2 Length = 102 Back     alignment and structure
>pdb|1BE9|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 In Complex With A C-Terminal Peptide Derived From Cript. Length = 119 Back     alignment and structure
>pdb|1WHA|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 105 Back     alignment and structure
>pdb|2DLU|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Inad- Like Protein Length = 111 Back     alignment and structure
>pdb|1WH1|A Chain A, Solution Structure Of The Fourth Pdz Domain Of Kiaa1095 Protein Length = 124 Back     alignment and structure
>pdb|3EGG|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Spinophilin Length = 170 Back     alignment and structure
>pdb|1WF8|A Chain A, Solution Structure Of The Pdz Domain Of SpinophilinNEURABINII PROTEIN Length = 107 Back     alignment and structure
>pdb|3EGH|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1), The Pp1 Binding And Pdz Domains Of Spinophilin And The Small Natural Molecular Toxin Nodularin-R Length = 170 Back     alignment and structure
>pdb|2FN5|A Chain A, Nmr Structure Of The Neurabin Pdz Domain (502-594) Length = 94 Back     alignment and structure
>pdb|3TSW|A Chain A, Crystal Structure Of The Pdz3-Sh3-Guk Core Module Of Human Zo-1 Length = 391 Back     alignment and structure
>pdb|3K82|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 98 Back     alignment and structure
>pdb|1B8Q|A Chain A, Solution Structure Of The Extended Neuronal Nitric Oxide Synthase Pdz Domain Complexed With An Associated Peptide Length = 127 Back     alignment and structure
>pdb|3I4W|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 104 Back     alignment and structure
>pdb|3SHW|A Chain A, Crystal Structure Of Zo-1 Pdz3-Sh3-Guk Supramodule Complex With Connexin-45 Peptide Length = 468 Back     alignment and structure
>pdb|1QAV|B Chain B, Unexpected Modes Of Pdz Domain Scaffolding Revealed By Structure Of Nnos-Syntrophin Complex Length = 115 Back     alignment and structure
>pdb|1QAU|A Chain A, Unexpected Modes Of Pdz Domain Scaffolding Revealed By Structure Of Nnos-Syntrophin Complex Length = 112 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 6e-41
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 2e-35
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 4e-30
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 2e-29
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 4e-29
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 6e-29
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 8e-29
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 2e-28
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 2e-28
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 2e-28
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 6e-28
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 9e-28
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 2e-27
2byg_A117 Channel associated protein of synapse-110; DLG2, P 5e-27
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 1e-26
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 3e-26
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 6e-26
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 6e-26
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 3e-25
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 3e-25
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 5e-25
2awx_A105 Synapse associated protein 97; membrane protein, s 6e-25
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 7e-25
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 2e-24
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 4e-24
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 8e-24
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 8e-24
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-23
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-23
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 1e-23
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 3e-23
2fne_A117 Multiple PDZ domain protein; structural protein, s 4e-23
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 6e-23
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 1e-22
2o2t_A117 Multiple PDZ domain protein; structural protein, s 1e-22
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 2e-22
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 3e-22
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 3e-22
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 5e-22
2djt_A104 Unnamed protein product; PDZ domain, structural ge 8e-22
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 9e-22
1fsh_A105 Dishevelled-1; three-helix bundle, beta-ARM, signa 2e-21
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 2e-21
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 2e-21
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 2e-21
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 3e-21
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 3e-21
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 3e-21
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 3e-21
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 5e-21
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 6e-21
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 7e-21
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 9e-21
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 1e-20
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 1e-20
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 2e-20
2opg_A98 Multiple PDZ domain protein; structural protein, s 2e-20
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 2e-20
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 2e-20
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 3e-20
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 3e-20
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 3e-19
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 3e-20
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 4e-20
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 6e-20
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 7e-20
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 8e-20
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 1e-19
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 1e-19
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 1e-19
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 1e-19
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 1e-19
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-19
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-17
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 2e-19
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 2e-19
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 2e-19
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 8e-19
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-19
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-14
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 4e-19
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 5e-19
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 5e-19
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 1e-18
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 1e-18
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 2e-18
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 3e-18
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 6e-18
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 6e-18
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 7e-18
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 8e-18
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 3e-17
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 3e-17
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-14
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 9e-09
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 3e-17
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 4e-17
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 4e-17
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 6e-17
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 1e-16
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 1e-16
2eeh_A100 PDZ domain-containing protein 7; structural genomi 1e-16
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 2e-16
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 3e-16
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 4e-16
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 5e-16
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 1e-15
3k1r_A192 Harmonin; protein-protein complex, alternative spl 1e-15
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 2e-15
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 2e-15
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 5e-15
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 5e-15
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 6e-15
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 2e-14
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 5e-14
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 4e-04
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 6e-14
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 3e-13
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 3e-13
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 2e-08
2eaq_A90 LIM domain only protein 7; conserved hypothetical 5e-13
2eei_A106 PDZ domain-containing protein 1; regulatory factor 6e-12
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 7e-12
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 1e-11
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 2e-11
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 3e-11
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 4e-11
2v90_A96 PDZ domain-containing protein 3; membrane, protein 4e-11
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 4e-11
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 8e-11
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 9e-11
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 1e-10
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 1e-10
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 1e-10
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 2e-10
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 2e-10
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 2e-10
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 2e-10
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 3e-10
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 3e-10
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 4e-10
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 4e-10
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 6e-10
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 6e-10
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 7e-10
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 1e-09
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 1e-09
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 2e-09
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 2e-09
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 3e-09
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 5e-09
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 9e-09
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 9e-09
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 2e-08
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 2e-08
2ego_A96 General receptor for phosphoinositides 1- associat 2e-08
2d90_A102 PDZ domain containing protein 1; structural genomi 4e-08
3khf_A99 Microtubule-associated serine/threonine-protein ki 5e-08
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 9e-08
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 2e-07
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 2e-07
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 3e-07
3ml6_A 385 Chimeric complex between protein dishevlled2 HOMO 3e-07
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 4e-07
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 9e-07
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 1e-06
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 3e-06
1uhw_A109 Pleckstrin; three-helix bundle, beta-ARM, riken st 3e-06
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 6e-06
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 1e-04
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
2kl1_A94 YLBL protein; structure genomics, structural genom 6e-04
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 6e-04
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 9e-04
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
 Score =  135 bits (341), Expect = 6e-41
 Identities = 75/92 (81%), Positives = 84/92 (91%)

Query: 33  SLNIITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVN 92
            +NIITVTLNM+  NFLGISIVGQSN+ GDGGIY+GSIMKGGAVA DGRIEPGDM+LQVN
Sbjct: 3   HMNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVN 62

Query: 93  DINFENMSNDEAVRVLREVVQKPGPIKLVVAK 124
           D+NFENMSND+AVRVLR++V KPGPI L VAK
Sbjct: 63  DMNFENMSNDDAVRVLRDIVHKPGPIVLTVAK 94
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>1fsh_A Dishevelled-1; three-helix bundle, beta-ARM, signaling protein; NMR {Mus musculus} SCOP: a.4.5.31 Length = 105 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>3ml6_A Chimeric complex between protein dishevlled2 HOMO and clathrin adaptor AP-2 complex...; dishevelled, frizzled internalization; 3.50A {Mus musculus} Length = 385 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1uhw_A Pleckstrin; three-helix bundle, beta-ARM, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Mus musculus} SCOP: a.4.5.31 PDB: 1w4m_A Length = 109 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Length = 388 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
1fsh_A105 Dishevelled-1; three-helix bundle, beta-ARM, signa 99.81
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.75
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.73
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.7
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.68
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.67
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.66
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.65
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.65
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.65
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.64
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.64
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.64
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.63
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.63
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.63
2awx_A105 Synapse associated protein 97; membrane protein, s 99.63
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.63
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.63
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.63
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.63
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.62
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.62
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.62
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.62
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.62
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.61
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.61
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.61
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.61
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.61
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.61
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.6
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.6
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.6
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.6
3ml6_A 385 Chimeric complex between protein dishevlled2 HOMO 99.6
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.6
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.6
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.6
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.6
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.59
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.59
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.59
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.58
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.58
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.58
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.58
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.58
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.58
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.58
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.58
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.58
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.58
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.57
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.57
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.57
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.57
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.57
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.56
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.56
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.56
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.56
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.56
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.56
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.56
2ego_A96 General receptor for phosphoinositides 1- associat 99.56
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.55
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.55
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.55
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.55
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.55
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.54
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.54
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.54
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.54
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.54
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.54
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.54
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.54
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.54
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.54
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.53
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.53
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.53
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.53
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.53
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.52
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.52
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.52
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.51
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.51
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.51
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.5
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.5
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.5
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.49
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.49
2d90_A102 PDZ domain containing protein 1; structural genomi 99.49
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.49
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.49
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.49
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.48
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.48
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.48
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.48
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.48
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.48
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.48
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.47
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.47
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.47
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.47
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.47
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.47
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.46
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.46
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.46
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.45
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.45
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.45
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.44
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.44
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.43
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.43
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.42
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.42
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.42
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.41
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.4
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.4
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.4
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.4
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 99.1
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.38
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.38
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.36
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.36
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.36
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.36
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.36
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.36
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.34
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.34
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.34
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.33
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.32
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.32
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.32
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.32
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.31
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.31
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.3
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.29
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.28
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.27
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 99.25
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.24
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.22
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.21
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.21
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 99.21
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.2
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 99.17
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 99.17
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.17
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.17
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.16
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.15
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.12
1v3f_A120 Pleckstrin 2; three-helix bundle, structural genom 98.95
2pbi_A 424 Regulator of G-protein signaling 9; helix WRAP, RG 98.88
1uhw_A109 Pleckstrin; three-helix bundle, beta-ARM, riken st 98.57
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.57
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.53
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 98.52
2cso_A127 Pleckstrin; DEP domain, platelet P47 protein, stru 98.5
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.47
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.45
2kl1_A94 YLBL protein; structure genomics, structural genom 98.44
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.37
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.34
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.3
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.3
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.27
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.25
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.22
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.15
3k50_A 403 Putative S41 protease; structural genomics, joint 98.13
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.1
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.09
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.08
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.07
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.01
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.98
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 97.97
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 97.96
2ysr_A105 DEP domain-containing protein 1; structural genomi 97.93
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 97.91
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.9
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 97.89
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.88
1k32_A 1045 Tricorn protease; protein degradation, substrate g 97.58
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.58
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.42
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.36
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 96.86
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 96.26
>1fsh_A Dishevelled-1; three-helix bundle, beta-ARM, signaling protein; NMR {Mus musculus} SCOP: a.4.5.31 Back     alignment and structure
Probab=99.81  E-value=7.2e-21  Score=146.51  Aligned_cols=53  Identities=81%  Similarity=1.380  Sum_probs=52.2

Q ss_pred             cchhhhhhhhhcccchhhHHHHHHHHHHhhccceeecccccccccceeeeecc
Q psy1022         188 SADVVDWLDKHVEGFTDRREARKYASQMLKFGYIRHTVNKITFSEQCYYIFGD  240 (245)
Q Consensus       188 ~~d~v~wl~~~v~g~~~r~~a~~~a~~~l~~~~i~h~~~k~~f~e~cyy~~~~  240 (245)
                      |+|+||||.+|++|+.+|.||.+||..||++|||+|++||.+|.++|||+|||
T Consensus        53 G~dlVdWL~~~~~~~~~r~eAv~lg~~Ll~~G~I~hv~~~~~F~D~~~y~f~~  105 (105)
T 1fsh_A           53 GADVVDWLYTHVEGFKERREARKYASSMLKHGFLRHTVNKITFSEQCYYVFGD  105 (105)
T ss_dssp             HHHHHHHHHHHCCCCSSHHHHHHHHHHHHHTTTEECSSSSCCCCSSSCCEECC
T ss_pred             cHHHHHHHHHhCcCCCCHHHHHHHHHHHHHCCcEEEcCCCCcccCCCeeecCC
Confidence            69999999999999999999999999999999999999999999999999998
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>3ml6_A Chimeric complex between protein dishevlled2 HOMO and clathrin adaptor AP-2 complex...; dishevelled, frizzled internalization; 3.50A {Mus musculus} Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>1v3f_A Pleckstrin 2; three-helix bundle, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: a.4.5.31 Back     alignment and structure
>2pbi_A Regulator of G-protein signaling 9; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1uhw_A Pleckstrin; three-helix bundle, beta-ARM, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Mus musculus} SCOP: a.4.5.31 PDB: 1w4m_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2cso_A Pleckstrin; DEP domain, platelet P47 protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.5.31 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>2ysr_A DEP domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 245
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 2e-31
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 5e-20
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 5e-19
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 1e-18
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 2e-18
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 2e-18
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 3e-18
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 3e-18
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 4e-18
d1fsha_94 a.4.5.31 (A:) Segment polarity protein Dishevelled 6e-18
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 6e-18
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 7e-18
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 7e-18
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 1e-17
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 1e-17
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-17
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 2e-17
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 5e-17
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 7e-17
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 1e-16
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 1e-16
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 2e-16
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 2e-16
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 2e-16
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 3e-16
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 4e-16
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 4e-16
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 8e-16
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 9e-16
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-15
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 3e-15
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 4e-15
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 6e-15
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 6e-15
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 6e-15
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 1e-14
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 1e-14
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 3e-14
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 3e-14
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 4e-14
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 1e-13
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 3e-13
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 7e-13
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 2e-12
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 2e-12
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 3e-12
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 3e-12
d1o7fa1142 a.4.5.31 (A:180-321) Regulatory domain of epac2, d 4e-12
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 4e-12
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 6e-12
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 8e-12
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 1e-11
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 2e-11
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 3e-11
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 4e-11
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 4e-11
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 1e-10
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 9e-10
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 2e-09
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 2e-08
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 2e-08
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 4e-08
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 7e-08
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 2e-07
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 3e-07
d2csoa1115 a.4.5.31 (A:8-122) Pleckstrin {Human (Homo sapiens 5e-06
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 5e-05
d1v3fa_120 a.4.5.31 (A:) Pleckstrin 2 {Mouse (Mus musculus) [ 2e-04
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 0.001
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Segment polarity protein dishevelled homolog Dvl-2
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

 Score =  109 bits (273), Expect = 2e-31
 Identities = 75/89 (84%), Positives = 82/89 (92%)

Query: 36  IITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVNDIN 95
           IITVTLNM+  NFLGISIVGQSN+ GDGGIY+GSIMKGGAVA DGRIEPGDM+LQVNDIN
Sbjct: 2   IITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDIN 61

Query: 96  FENMSNDEAVRVLREVVQKPGPIKLVVAK 124
           FENMSND+AVRVLR++V KPGPI L VAK
Sbjct: 62  FENMSNDDAVRVLRDIVHKPGPIVLTVAK 90
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1fsha_ a.4.5.31 (A:) Segment polarity protein Dishevelled-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1o7fa1 a.4.5.31 (A:180-321) Regulatory domain of epac2, domain 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 142 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d2csoa1 a.4.5.31 (A:8-122) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1v3fa_ a.4.5.31 (A:) Pleckstrin 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.85
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.82
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.82
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.81
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.81
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.81
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.8
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.8
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.8
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.8
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.8
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.79
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.79
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.79
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.78
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.78
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.78
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.77
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.77
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.77
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.77
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.77
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.77
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.76
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.76
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.74
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.74
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.74
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.74
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.74
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.73
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.73
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.73
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.72
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.72
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.72
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.72
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.72
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.71
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.71
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.71
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.7
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.7
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.7
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.69
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.68
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.67
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.66
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.64
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.64
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.62
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.61
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.6
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.56
d1fsha_94 Segment polarity protein Dishevelled-1 {Mouse (Mus 99.53
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.48
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.05
d1o7fa1142 Regulatory domain of epac2, domain 2 {Mouse (Mus m 98.98
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.83
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.68
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.62
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.36
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.32
d2csoa1115 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 98.28
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.23
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.23
d1v3fa_120 Pleckstrin 2 {Mouse (Mus musculus) [TaxId: 10090]} 98.15
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Segment polarity protein dishevelled homolog Dvl-2
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

Probab=99.85  E-value=1.3e-21  Score=145.25  Aligned_cols=89  Identities=84%  Similarity=1.279  Sum_probs=81.3

Q ss_pred             eEEEEEEcCCCCcccEEEEcccCCCCCCCEEEEeecCCChhhhcCCCCCCCEEEeeCCeecccCCHHHHHHHHHhccCCC
Q psy1022          36 IITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVNDINFENMSNDEAVRVLREVVQKP  115 (245)
Q Consensus        36 i~~V~L~k~~~~~LG~sI~gg~~~~~~~gi~I~~V~~Gg~A~~~G~L~~GD~Il~VNg~~l~~~t~~eav~~Lr~~~~~~  115 (245)
                      +++|+|.+++.++|||+|.|+.+..++.++||.+|.+||||+++|+|++||+|++|||+++.+++|++|+++||++..+.
T Consensus         2 i~tV~l~k~~~~~lGi~i~gg~~~~~~~~i~I~~I~~gg~A~~~G~L~~GD~Il~VNg~~l~~~s~~eav~llk~~~~~~   81 (92)
T d2f0aa1           2 IITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDIVHKP   81 (92)
T ss_dssp             EEEEEECHHHHCSCCEEEECCCCTTSCCCEEEEEEBTTSHHHHHCCCCTTCEEEEETTEECTTCCHHHHHHHHHHHHHSS
T ss_pred             EEEEEEEeCCCCccCEEEEccCCCCCCCCEEEEEECCCCcHHHcCCCCCccEEEEECCEECCCCCHHHHHHHHHhccCCC
Confidence            57899999888899999999876556789999999999999999999999999999999999999999999999875556


Q ss_pred             CcEEEEEEe
Q psy1022         116 GPIKLVVAK  124 (245)
Q Consensus       116 ~~V~L~V~r  124 (245)
                      +.|+|+|.|
T Consensus        82 ~~v~L~V~R   90 (92)
T d2f0aa1          82 GPIVLTVAK   90 (92)
T ss_dssp             SCEEEEEEC
T ss_pred             CcEEEEEEe
Confidence            789999987
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fsha_ a.4.5.31 (A:) Segment polarity protein Dishevelled-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o7fa1 a.4.5.31 (A:180-321) Regulatory domain of epac2, domain 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2csoa1 a.4.5.31 (A:8-122) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1v3fa_ a.4.5.31 (A:) Pleckstrin 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure