Psyllid ID: psy1033


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60-------
PNAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMPASEKGP
cccccccccccccccccccHHHHHHHHHHcccccccEEEEcccccEEEEEccccccccccccccccc
ccccccccccccHHHHHccHHHHHHHHHHccccHHHEEEEEEcEEEEEEEccccccccccEEEEEcc
pnaplypavtdqgyfkslnanwSVNYYLykgipanklllglptyghsytlvnpdstdygmpasekgp
PNAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMPASEKGP
PNAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMPASEKGP
*****YPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVN***************
PNAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMPA*****
PNAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYG********
**AP*YPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMPASEK**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PNAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMPASEKGP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query67 2.2.26 [Sep-21-2011]
Q13231 466 Chitotriosidase-1 OS=Homo yes N/A 0.970 0.139 0.461 8e-10
Q9BZP6 476 Acidic mammalian chitinas no N/A 0.985 0.138 0.469 2e-09
Q6RY07 473 Acidic mammalian chitinas yes N/A 0.985 0.139 0.454 7e-09
Q91XA9 473 Acidic mammalian chitinas yes N/A 0.985 0.139 0.424 6e-08
Q15782390 Chitinase-3-like protein no N/A 0.910 0.156 0.419 8e-08
Q9D7Q1 464 Chitotriosidase-1 OS=Mus no N/A 0.925 0.133 0.419 1e-07
Q95M17 472 Acidic mammalian chitinas yes N/A 0.985 0.139 0.409 2e-07
Q29411383 Chitinase-3-like protein no N/A 0.955 0.167 0.415 3e-07
Q8SPQ0383 Chitinase-3-like protein N/A N/A 0.955 0.167 0.415 5e-07
P30922383 Chitinase-3-like protein no N/A 0.910 0.159 0.435 6e-07
>sp|Q13231|CHIT1_HUMAN Chitotriosidase-1 OS=Homo sapiens GN=CHIT1 PE=1 SV=1 Back     alignment and function desciption
 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%)

Query: 2   NAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMP 61
           N+PLY    + G   SLN + +V  +L KG PA+KL+LG+PTYG S+TL +   T  G P
Sbjct: 225 NSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAP 284

Query: 62  ASEKG 66
           A+  G
Sbjct: 285 ATGSG 289




Degrades chitin, chitotriose and chitobiose. May participate in the defense against nematodes and other pathogens. Isoform 3 has no enzymatic activity.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 4
>sp|Q9BZP6|CHIA_HUMAN Acidic mammalian chitinase OS=Homo sapiens GN=CHIA PE=1 SV=1 Back     alignment and function description
>sp|Q6RY07|CHIA_RAT Acidic mammalian chitinase OS=Rattus norvegicus GN=Chia PE=2 SV=1 Back     alignment and function description
>sp|Q91XA9|CHIA_MOUSE Acidic mammalian chitinase OS=Mus musculus GN=Chia PE=1 SV=2 Back     alignment and function description
>sp|Q15782|CH3L2_HUMAN Chitinase-3-like protein 2 OS=Homo sapiens GN=CHI3L2 PE=1 SV=1 Back     alignment and function description
>sp|Q9D7Q1|CHIT1_MOUSE Chitotriosidase-1 OS=Mus musculus GN=Chit1 PE=1 SV=2 Back     alignment and function description
>sp|Q95M17|CHIA_BOVIN Acidic mammalian chitinase OS=Bos taurus GN=CHIA PE=1 SV=1 Back     alignment and function description
>sp|Q29411|CH3L1_PIG Chitinase-3-like protein 1 OS=Sus scrofa GN=CHI3L1 PE=1 SV=2 Back     alignment and function description
>sp|Q8SPQ0|CH3L1_CAPHI Chitinase-3-like protein 1 OS=Capra hircus GN=CHI3L1 PE=1 SV=1 Back     alignment and function description
>sp|P30922|CH3L1_BOVIN Chitinase-3-like protein 1 OS=Bos taurus GN=CHI3L1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query67
347963818 591 AGAP000436-PA [Anopheles gambiae str. PE 0.970 0.109 0.553 4e-11
307199092 392 Acidic mammalian chitinase [Harpegnathos 0.925 0.158 0.5 7e-11
328710774 473 PREDICTED: chitinase-3-like protein 2-li 0.985 0.139 0.469 1e-10
383849453 643 PREDICTED: acidic mammalian chitinase-li 0.910 0.094 0.491 1e-10
307183982 479 Acidic mammalian chitinase [Camponotus f 0.925 0.129 0.483 2e-10
340713565 643 PREDICTED: acidic mammalian chitinase-li 0.985 0.102 0.484 3e-10
350409358 643 PREDICTED: acidic mammalian chitinase-li 0.985 0.102 0.484 3e-10
334322008 522 PREDICTED: chitotriosidase-1-like [Monod 0.970 0.124 0.507 4e-10
328793297 642 PREDICTED: acidic mammalian chitinase [A 0.940 0.098 0.476 4e-10
170066117 192 acidic mammalian chitinase [Culex quinqu 0.970 0.338 0.507 5e-10
>gi|347963818|ref|XP_310662.5| AGAP000436-PA [Anopheles gambiae str. PEST] gi|333467020|gb|EAA06276.5| AGAP000436-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score = 72.4 bits (176), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%)

Query: 2   NAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMP 61
           NAPLY    +Q    +LN N SV+Y+L  G+  +KL+LGLPTYGHS+TLVNP +T  G P
Sbjct: 371 NAPLYRRANEQSLLGTLNINTSVHYWLSAGLDKSKLILGLPTYGHSFTLVNPFNTRIGAP 430

Query: 62  ASEKG 66
           AS  G
Sbjct: 431 ASSYG 435




Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307199092|gb|EFN79802.1| Acidic mammalian chitinase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328710774|ref|XP_001952718.2| PREDICTED: chitinase-3-like protein 2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|383849453|ref|XP_003700359.1| PREDICTED: acidic mammalian chitinase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307183982|gb|EFN70553.1| Acidic mammalian chitinase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340713565|ref|XP_003395312.1| PREDICTED: acidic mammalian chitinase-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350409358|ref|XP_003488707.1| PREDICTED: acidic mammalian chitinase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|334322008|ref|XP_001369920.2| PREDICTED: chitotriosidase-1-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|328793297|ref|XP_395707.4| PREDICTED: acidic mammalian chitinase [Apis mellifera] Back     alignment and taxonomy information
>gi|170066117|ref|XP_001868125.1| acidic mammalian chitinase [Culex quinquefasciatus] gi|167862779|gb|EDS26162.1| acidic mammalian chitinase [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query67
UNIPROTKB|E9PLJ2 287 CHIA "Acidic mammalian chitina 0.985 0.229 0.469 4.6e-12
UNIPROTKB|I3LL32 477 CHIA "Uncharacterized protein" 0.985 0.138 0.469 5.3e-12
UNIPROTKB|F1NM30 481 CHIA "Uncharacterized protein" 0.985 0.137 0.484 6.9e-12
UNIPROTKB|F1NMM2 482 CHIA "Uncharacterized protein" 0.985 0.136 0.484 6.9e-12
UNIPROTKB|Q5VUV5 420 CHIA "Acidic mammalian chitina 0.985 0.157 0.469 1.4e-11
UNIPROTKB|Q9BZP6 476 CHIA "Acidic mammalian chitina 0.985 0.138 0.469 1.8e-11
RGD|1303058 473 Chia "chitinase, acidic" [Ratt 0.985 0.139 0.454 6.3e-11
UNIPROTKB|F1LPK5 473 Chia "Acidic mammalian chitina 0.985 0.139 0.454 6.3e-11
UNIPROTKB|D6REY1361 CHIT1 "Chitotriosidase-1" [Hom 0.970 0.180 0.461 2.1e-10
FB|FBgn0029913 432 Cht11 "Cht11" [Drosophila mela 0.970 0.150 0.446 3e-10
UNIPROTKB|E9PLJ2 CHIA "Acidic mammalian chitinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 165 (63.1 bits), Expect = 4.6e-12, P = 4.6e-12
 Identities = 31/66 (46%), Positives = 41/66 (62%)

Query:     2 NAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMP 61
             N+PLY   TD G    LN ++ +NY+   G PA KL++G PTYGH++ L NP +T  G P
Sbjct:    64 NSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAP 123

Query:    62 ASEKGP 67
              S  GP
Sbjct:   124 TSGAGP 129




GO:0004568 "chitinase activity" evidence=IEA
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0006032 "chitin catabolic process" evidence=IEA
UNIPROTKB|I3LL32 CHIA "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NM30 CHIA "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMM2 CHIA "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VUV5 CHIA "Acidic mammalian chitinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BZP6 CHIA "Acidic mammalian chitinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1303058 Chia "chitinase, acidic" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LPK5 Chia "Acidic mammalian chitinase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D6REY1 CHIT1 "Chitotriosidase-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0029913 Cht11 "Cht11" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query67
cd02872362 cd02872, GH18_chitolectin_chitotriosidase, This co 4e-21
smart00636334 smart00636, Glyco_18, Glyco_18 domain 3e-15
pfam00704325 pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam 3e-10
cd02873 413 cd02873, GH18_IDGF, The IDGF's (imaginal disc grow 1e-07
cd06548322 cd06548, GH18_chitinase, The GH18 (glycosyl hydrol 2e-07
cd02879299 cd02879, GH18_plant_chitinase_class_V, The class V 0.001
>gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information
 Score = 83.4 bits (207), Expect = 4e-21
 Identities = 32/66 (48%), Positives = 43/66 (65%)

Query: 2   NAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMP 61
           N+PLY    D G  K LN ++++ Y+L KG P  KL+LG+PTYG S+TL +P +T  G P
Sbjct: 201 NSPLYAGSADTGDQKYLNVDYAIKYWLSKGAPPEKLVLGIPTYGRSFTLASPSNTGVGAP 260

Query: 62  ASEKGP 67
           AS  G 
Sbjct: 261 ASGPGT 266


The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens. Length = 362

>gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain Back     alignment and domain information
>gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 Back     alignment and domain information
>gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information
>gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 67
cd02872362 GH18_chitolectin_chitotriosidase This conserved do 99.67
smart00636334 Glyco_18 Glycosyl hydrolase family 18. 99.63
cd02878345 GH18_zymocin_alpha Zymocin, alpha subunit. Zymocin 99.57
cd02873 413 GH18_IDGF The IDGF's (imaginal disc growth factors 99.55
KOG2806|consensus 432 99.45
cd06548322 GH18_chitinase The GH18 (glycosyl hydrolases, fami 99.43
cd02879299 GH18_plant_chitinase_class_V The class V plant chi 99.41
cd02875 358 GH18_chitobiase Chitobiase (also known as di-N-ace 99.18
PF00704343 Glyco_hydro_18: Glycosyl hydrolases family 18; Int 99.17
cd02876318 GH18_SI-CLP Stabilin-1 interacting chitinase-like 99.08
COG3325 441 ChiA Chitinase [Carbohydrate transport and metabol 99.08
cd06545253 GH18_3CO4_chitinase The Bacteroides thetaiotaomicr 98.71
cd02874313 GH18_CFLE_spore_hydrolase Cortical fragment-lytic 98.42
cd06549298 GH18_trifunctional GH18 domain of an uncharacteriz 98.19
COG3858423 Predicted glycosyl hydrolase [General function pre 96.67
cd06544253 GH18_narbonin Narbonin is a plant 2S protein from 92.54
PF08869111 XisI: XisI protein; InterPro: IPR014968 The fdxN e 90.89
cd06546256 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 82.9
cd02871312 GH18_chitinase_D-like GH18 domain of Chitinase D ( 82.76
KOG2091|consensus392 81.14
>cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information
Probab=99.67  E-value=9.3e-17  Score=108.82  Aligned_cols=66  Identities=48%  Similarity=0.898  Sum_probs=58.5

Q ss_pred             CCCCCCCCCCCCCcCccccHHHHHHHHHHcCCCCCceEEEeccceeeeeecCCCCCCCCCCcCCCC
Q psy1033           1 PNAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMPASEKG   66 (67)
Q Consensus         1 ~~apL~~~~~~~~~~~~~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~~~~~~g~p~~g~g   66 (67)
                      |+|||+..+.++.....++++.+|++|+++|+|++||+||||||||.|++++..++++|+|+.|+|
T Consensus       200 ~~spl~~~~~~~~~~~~~~v~~~v~~~~~~gvp~~KlvlGlp~YG~~~~~~~~~~~~~g~~~~g~~  265 (362)
T cd02872         200 HNSPLYAGSADTGDQKYLNVDYAIKYWLSKGAPPEKLVLGIPTYGRSFTLASPSNTGVGAPASGPG  265 (362)
T ss_pred             CCCCCCCCCCCccccccccHHHHHHHHHHcCCCHHHeEeccccccceeeecCCccCCCCCccCCCC
Confidence            689999887765434578999999999999999999999999999999999888889999998765



The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the la

>smart00636 Glyco_18 Glycosyl hydrolase family 18 Back     alignment and domain information
>cd02878 GH18_zymocin_alpha Zymocin, alpha subunit Back     alignment and domain information
>cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information
>KOG2806|consensus Back     alignment and domain information
>cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes Back     alignment and domain information
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>PF00704 Glyco_hydro_18: Glycosyl hydrolases family 18; InterPro: IPR001223 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome Back     alignment and domain information
>COG3325 ChiA Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain Back     alignment and domain information
>COG3858 Predicted glycosyl hydrolase [General function prediction only] Back     alignment and domain information
>cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L Back     alignment and domain information
>PF08869 XisI: XisI protein; InterPro: IPR014968 The fdxN element, along with two other DNA elements, is excised from the chromosome during heterocyst differentiation in cyanobacteria Back     alignment and domain information
>cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii Back     alignment and domain information
>cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) Back     alignment and domain information
>KOG2091|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query67
1waw_A 445 Specificity And Affinity Of Natural Product Cyclope 6e-11
1lg1_A365 Crystal Structure Of Human Chitotriosidase In Compl 6e-11
1guv_A366 Structure Of Human Chitotriosidase Length = 366 7e-11
1hki_A365 Crystal Structure Of Human Chitinase In Complex Wit 1e-10
1hkk_A364 High Resoultion Crystal Structure Of Human Chitinas 1e-10
2ybt_A 381 Crystal Structure Of Human Acidic Chitinase In Comp 2e-10
3fxy_A 395 Acidic Mammalian Chinase, Catalytic Domain Length = 2e-10
4ay1_A365 Human Ykl-39 Is A Pseudo-Chitinase With Retained Ch 7e-09
1owq_A361 Crystal Structure Of A 40 Kda Signalling Protein (S 1e-07
2esc_A361 Crystal Structure Of A 40 Kda Protective Signalling 3e-07
1e9l_A 377 The Crystal Structure Of Novel Mammalian Lectin Ym1 4e-07
1ljy_A361 Crystal Structure Of A Novel Regulatory 40 Kda Mamm 5e-07
1zbv_A361 Crystal Structure Of The Goat Signalling Protein (S 6e-07
1xhg_A361 Crystal Structure Of A 40 Kda Signalling Protein Fr 6e-07
1sr0_A361 Crystal Structure Of Signalling Protein From Sheep( 7e-07
1tfv_A361 Crystal Structure Of A Buffalo Signaling Glycoprote 7e-07
2pi6_A361 Crystal Structure Of The Sheep Signalling Glycoprot 8e-07
1syt_A361 Crystal Structure Of Signalling Protein From Goat S 1e-06
1hjv_A362 Crystal Structure Of Hcgp-39 In Complex With Chitin 2e-05
1jnd_A 420 Crystal Structure Of Imaginal Disc Growth Factor-2 5e-05
>pdb|1WAW|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase Length = 445 Back     alignment and structure

Iteration: 1

Score = 62.4 bits (150), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 30/65 (46%), Positives = 41/65 (63%) Query: 2 NAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMP 61 N+PLY + G SLN + +V +L KG PA+KL+LG+PTYG S+TL + T G P Sbjct: 204 NSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAP 263 Query: 62 ASEKG 66 A+ G Sbjct: 264 ATGSG 268
>pdb|1LG1|A Chain A, Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose Length = 365 Back     alignment and structure
>pdb|1GUV|A Chain A, Structure Of Human Chitotriosidase Length = 366 Back     alignment and structure
>pdb|1HKI|A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B Length = 365 Back     alignment and structure
>pdb|1HKK|A Chain A, High Resoultion Crystal Structure Of Human Chitinase In Complex With Allosamidin Length = 364 Back     alignment and structure
>pdb|2YBT|A Chain A, Crystal Structure Of Human Acidic Chitinase In Complex With Bisdionin C Length = 381 Back     alignment and structure
>pdb|3FXY|A Chain A, Acidic Mammalian Chinase, Catalytic Domain Length = 395 Back     alignment and structure
>pdb|4AY1|A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties Length = 365 Back     alignment and structure
>pdb|1OWQ|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein (Spc-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|2ESC|A Chain A, Crystal Structure Of A 40 Kda Protective Signalling Protein From Bovine (Spc-40) At 2.1 A Resolution Length = 361 Back     alignment and structure
>pdb|1E9L|A Chain A, The Crystal Structure Of Novel Mammalian Lectin Ym1 Suggests A Saccharide Binding Site Length = 377 Back     alignment and structure
>pdb|1LJY|A Chain A, Crystal Structure Of A Novel Regulatory 40 Kda Mammary Gland Protein (Mgp-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|1ZBV|A Chain A, Crystal Structure Of The Goat Signalling Protein (Spg-40) Complexed With A Designed Peptide Trp-Pro-Trp At 3.2a Resolution Length = 361 Back     alignment and structure
>pdb|1XHG|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein From Porcine (spp-40) At 2.89a Resolution Length = 361 Back     alignment and structure
>pdb|1SR0|A Chain A, Crystal Structure Of Signalling Protein From Sheep(Sps-40) At 3.0a Resolution Using Crystal Grown In The Presence Of Polysaccharides Length = 361 Back     alignment and structure
>pdb|1TFV|A Chain A, Crystal Structure Of A Buffalo Signaling Glycoprotein (Spb-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|2PI6|A Chain A, Crystal Structure Of The Sheep Signalling Glycoprotein (Sps-40) Complex With 2-Methyl-2-4-Pentanediol At 1.65a Resolution Reveals Specific Binding Characteristics Of Sps-40 Length = 361 Back     alignment and structure
>pdb|1SYT|A Chain A, Crystal Structure Of Signalling Protein From Goat Spg-40 In The Presense Of N,n',n''-triacetyl-chitotriose At 2.6a Resolution Length = 361 Back     alignment and structure
>pdb|1HJV|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin Tetramer Length = 362 Back     alignment and structure
>pdb|1JND|A Chain A, Crystal Structure Of Imaginal Disc Growth Factor-2 Length = 420 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query67
1wb0_A 445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 1e-19
1vf8_A 377 YM1, secretory protein; chitinase, CHI-lectin, str 2e-19
3fy1_A 395 Amcase, TSA1902, acidic mammalian chitinase; struc 3e-19
4ay1_A365 Chitinase-3-like protein 2; chilectin, lectin, chi 9e-19
1jnd_A 420 Imaginal DISC growth factor-2; IDGF, chitinase, in 2e-18
2pi6_A361 Chitinase-3-like protein 1; complex, signaling pro 3e-16
3alf_A353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 3e-16
3aqu_A356 AT4G19810; stress response, TIM barrel, hydrolase, 4e-16
1edq_A540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 1e-14
1itx_A419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 3e-14
1kfw_A435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 3e-14
1ll7_A 392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 6e-14
1w9p_A 433 Chitinase; peptide inhibitors, argifin, argadin, g 9e-14
3g6m_A 406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 1e-13
3qok_A 420 Putative chitinase II; structural genomics, PSI-bi 5e-13
3oa5_A 574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 1e-11
1goi_A 499 Chitinase B; chitin degradation, hydrolase, glycos 3e-11
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 7e-11
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 5e-09
3sim_A275 Protein, family 18 chitinase; family 18 plant chit 8e-08
3cz8_A319 Putative sporulation-specific glycosylase YDHD; st 2e-07
3bxw_B393 Chitinase domain-containing protein 1; TIM barrel, 6e-07
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 Back     alignment and structure
 Score = 79.4 bits (196), Expect = 1e-19
 Identities = 30/66 (45%), Positives = 41/66 (62%)

Query: 2   NAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMP 61
           N+PLY    + G   SLN + +V  +L KG PA+KL+LG+PTYG S+TL +   T  G P
Sbjct: 204 NSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAP 263

Query: 62  ASEKGP 67
           A+  G 
Sbjct: 264 ATGSGT 269


>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 Back     alignment and structure
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 Back     alignment and structure
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 Back     alignment and structure
>3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 Back     alignment and structure
>3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query67
1vf8_A 377 YM1, secretory protein; chitinase, CHI-lectin, str 99.75
1wb0_A 445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 99.75
3fy1_A 395 Amcase, TSA1902, acidic mammalian chitinase; struc 99.75
4ay1_A365 Chitinase-3-like protein 2; chilectin, lectin, chi 99.72
2pi6_A361 Chitinase-3-like protein 1; complex, signaling pro 99.72
3aqu_A356 AT4G19810; stress response, TIM barrel, hydrolase, 99.71
3alf_A353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 99.7
1goi_A 499 Chitinase B; chitin degradation, hydrolase, glycos 99.69
1jnd_A 420 Imaginal DISC growth factor-2; IDGF, chitinase, in 99.67
1itx_A419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 99.65
1kfw_A435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 99.64
1ll7_A 392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 99.63
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 99.62
3g6m_A 406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 99.61
1w9p_A 433 Chitinase; peptide inhibitors, argifin, argadin, g 99.61
3qok_A 420 Putative chitinase II; structural genomics, PSI-bi 99.61
1edq_A540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 99.58
3oa5_A 574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 99.55
3bxw_B393 Chitinase domain-containing protein 1; TIM barrel, 99.16
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 99.03
3cz8_A319 Putative sporulation-specific glycosylase YDHD; st 98.92
1nar_A290 Narbonin; plant SEED protein; 1.80A {Vicia narbone 98.33
2y8v_A290 CHIC, class III chitinase, putative; afchic, hydro 97.98
3sim_A275 Protein, family 18 chitinase; family 18 plant chit 97.36
3ebv_A302 Chinitase A; chitinase A, CHIA, glycosidase, struc 96.87
2hvm_A273 Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He 96.59
4axn_A328 Chitinase C1; hydrolase; 1.68A {Serratia marcescen 95.84
2gsj_A271 Protein PPL-2; mimosoideae, chimerolectin, endochi 95.75
2uy2_A294 Endochitinase; carbohydrate metabolism, polysaccha 95.48
4ac1_X283 Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g 95.13
2xtk_A310 CHIA1, class III chitinase CHIA1; hydrolase, GH18; 95.12
1cnv_A299 Concanavalin B; plant chitinase, chitin binding pr 94.94
2nlv_A112 XISI protein-like; XISI-like protein, structural g 93.48
2nwv_A114 XISI protein-like; YP_323822.1, structural genomic 93.23
1eok_A290 Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b 93.12
2nvm_A126 FDXN element excision controlling factor XISI; YP_ 92.2
3ian_A321 Chitinase; structural genomics, hydrolase, glycosi 91.49
1ta3_A274 XIP-1, xylanase inhibitor protein I; beta alpha ba 89.76
3d7q_A112 XISI protein-like; structural genomics, joint cent 89.69
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 86.71
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Back     alignment and structure
Probab=99.75  E-value=1.1e-18  Score=118.08  Aligned_cols=66  Identities=35%  Similarity=0.704  Sum_probs=59.1

Q ss_pred             CCCCCCCCCCCCCcCccccHHHHHHHHHHcCCCCCceEEEeccceeeeeecCCCCCCCCCCcCCCC
Q psy1033           1 PNAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMPASEKG   66 (67)
Q Consensus         1 ~~apL~~~~~~~~~~~~~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~~~~~~g~p~~g~g   66 (67)
                      ||||||..+.++.....++++.+|++|+++|+|++|||||||||||+|++++.+++++++|+.|+|
T Consensus       203 ~~apl~~~~~~~~~~~~~~v~~~v~~~~~~gvp~~KlvlGip~YGr~~~~~~~~~~~~g~p~~g~~  268 (377)
T 1vf8_A          203 ENSPLYKSPYDIGKSADLNVDSIISYWKDHGAASEKLIVGFPAYGHTFILSDPSKTGIGAPTISTG  268 (377)
T ss_dssp             CSSCSSCCTTCCGGGGGCSHHHHHHHHHHTTCCGGGEEEEEESEEEEEEESCTTCCSTTCBEEEEC
T ss_pred             CCCCCCCCCCCccccccccHHHHHHHHHHcCCCHHHEEEEecccceeeEcccCCCCCCCCcCCCCC
Confidence            799999988776443468999999999999999999999999999999999988899999998764



>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Back     alignment and structure
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Back     alignment and structure
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Back     alignment and structure
>3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Back     alignment and structure
>1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Back     alignment and structure
>2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Back     alignment and structure
>3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Back     alignment and structure
>3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Back     alignment and structure
>2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* Back     alignment and structure
>4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} Back     alignment and structure
>2gsj_A Protein PPL-2; mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, X-RAY; 1.73A {Parkia platycephala} Back     alignment and structure
>2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* Back     alignment and structure
>4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} Back     alignment and structure
>2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* Back     alignment and structure
>1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 Back     alignment and structure
>2nlv_A XISI protein-like; XISI-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.30A {Anabaena variabilis} SCOP: d.326.1.1 Back     alignment and structure
>2nwv_A XISI protein-like; YP_323822.1, structural genomics, PSI-2, structure initiative, joint center for structural genomics; 1.85A {Anabaena variabilis} SCOP: d.326.1.1 Back     alignment and structure
>1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* Back     alignment and structure
>2nvm_A FDXN element excision controlling factor XISI; YP_321976.1, structural genomics, PSI-2, protein structure initiative; 2.19A {Anabaena variabilis atcc 29413} SCOP: d.326.1.1 Back     alignment and structure
>3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Back     alignment and structure
>1ta3_A XIP-1, xylanase inhibitor protein I; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Triticum aestivum} SCOP: c.1.8.5 PDB: 1om0_A* 1te1_A* Back     alignment and structure
>3d7q_A XISI protein-like; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.30A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 67
d1vf8a1302 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin 7e-09
d1jnda1327 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f 1e-08
d1ll7a1330 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( 2e-08
d1edqa2358 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt 3e-08
d1wb0a1297 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma 2e-07
d1w9pa1333 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil 4e-07
d1kfwa1374 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina 8e-07
d2pi6a1292 c.1.8.5 (A:1-239,A:308-361) Signal processing prot 2e-06
d1itxa1347 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu 2e-04
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Chitinase-like lectin ym1, saccharide binding domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 47.5 bits (112), Expect = 7e-09
 Identities = 14/45 (31%), Positives = 23/45 (51%)

Query: 1   PNAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYG 45
            N+PLY +  D G    LN +  ++Y+   G  + KL++G P   
Sbjct: 203 ENSPLYKSPYDIGKSADLNVDSIISYWKDHGAASEKLIVGFPADN 247


>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 Back     information, alignment and structure
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query67
d1ll7a1330 Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 99.46
d1w9pa1333 Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} 99.44
d1edqa2358 Chitinase A, catalytic domain {Serratia marcescens 99.43
d1vf8a1302 Chitinase-like lectin ym1, saccharide binding doma 99.32
d1kfwa1374 Psychrophilic chitinase B {Arthrobacter sp., tad20 99.18
d1wb0a1297 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 98.97
d1jnda1327 Imaginal disc growth factor-2 {Fruit fly (Drosophi 98.96
d2pi6a1292 Signal processing protein (SPC-40, MGP-40) {Sheep 98.95
d1itxa1347 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 98.63
d1wb0a268 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 98.36
d1vf8a270 Chitinase-like lectin ym1 {Mouse (Mus musculus) [T 98.35
d2pi6a268 Signal processing protein (SPC-40, MGP-40) {Sheep 97.96
d1itxa272 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 97.58
d1jnda292 Imaginal disc growth factor-2 {Fruit fly (Drosophi 97.18
d1kfwa261 Psychrophilic chitinase B {Arthrobacter sp., tad20 96.81
d2hvma_273 Hevamine A (chitinase/lysozyme) {Para rubber tree 95.67
d1goia388 Chitinase B {Serratia marcescens [TaxId: 615]} 95.46
d1edqa373 Chitinase A {Serratia marcescens [TaxId: 615]} 94.96
d1ta3a_274 Xylanase inhibitor protein I, XIP-I {Wheat (Tritic 91.36
d2nvma1117 XisI {Anabaena variabilis [TaxId: 1172]} 91.22
d2nwva1112 Hypothetical protein Ava3320 {Anabaena variabilis 90.82
d2nlva1111 Hypothetical protein Ava3825 {Anabaena variabilis 90.72
d1cnva_283 Seed storage protein {Jack bean (Canavalia ensifor 89.37
d1nara_289 Seed storage protein {Vicia narbonensis, Narbonin 85.22
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Chitinase 1
species: Fungus (Coccidioides immitis) [TaxId: 5501]
Probab=99.46  E-value=1.6e-14  Score=94.70  Aligned_cols=50  Identities=24%  Similarity=0.437  Sum_probs=44.5

Q ss_pred             CCCCCCCCCCCCCcCccccHHHHHHHHHHcCCCCCceEEEeccceeeeeec
Q psy1033           1 PNAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLV   51 (67)
Q Consensus         1 ~~apL~~~~~~~~~~~~~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~   51 (67)
                      ||||||..+.++.. ..++++.+|++|+++|+|++|||||||||||.|...
T Consensus       216 ~~s~l~~~~~~~~~-~~~sv~~av~~~~~~Gvp~~KlvlGiP~ygr~~~~~  265 (330)
T d1ll7a1         216 HMSNVFPSTTKPES-TPFSSDKAVKDYIKAGVPANKIVLGMPLDTVKIAGK  265 (330)
T ss_dssp             CSSCSSCCSSCGGG-CSCCHHHHHHHHHHTTCCGGGEEEEEESCCHHHHHH
T ss_pred             cCcccCCCcCCCCC-CCccHHHHHHHHHHCCCCHHHeEEEecCCCchhhhh
Confidence            79999988877653 468999999999999999999999999999999654



>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1goia3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d2nvma1 d.326.1.1 (A:2-118) XisI {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2nwva1 d.326.1.1 (A:2-113) Hypothetical protein Ava3320 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2nlva1 d.326.1.1 (A:1-111) Hypothetical protein Ava3825 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Back     information, alignment and structure