Psyllid ID: psy1075

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620----

CRTLSGTSVASPVVAGVVALLASGLKHRPAGHINPASMKQGLMASARRLPGVNMFEQGSGKIDLLRAYQILNSYTPQASLSPSSLFLPLGIRGSGVKVAVFDTGLSSGHTGFNNVAERTDWTNENTLEDKLGHGTFVAGCRTLSGTSVASPVVAGVVALLASGLKHRPAGHINPASMKQGPVSNITRPIGSRVPFCAGELNVNPQSKVFYLDLTECQYMWPYCTQPLYHGAIPIIVNVTILNGMGVVGKILERPKWYPYLPHNGEFLEISMTYSDILWPWSGYLAVHISVSAAAAAWQGTVQGHIEVTVESPPLEGEEGVRRSTVKLAVKANIIPTPPRHKRILWDQYHNLRYPQGYFPRDNLKMKNDPLDWNGDHVHTNFKDLYQHLRNIGYYIEVLGTPFTCFDARHYGVLLLDLYQHLRNIGYYIEVLGTPFTCFDARHYGVLLLVDPEEEYHREEIDKLRRDVEQDGLALIVLADWYNTDVMRKIKFYDENTRQWWLPETGGSNIPALNELLAVHGIRLGDRVYEGSITMNDRTLQYMSGTSIVQFPTSGVLVGAKLNNQGKKGVNPNAPMAGWSLRWLSTSWRFTVFVSGTGYTRYMSGTSIVQFPTSGVLVGAKLNNQ

cccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccEEEEEEccccccccEEccHHHEEHHcccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccEEEEEEEcccEEEcccccccEEEEEEEEccEEEEccEEEEEEEEEccccccEEEEEEEEEEEEEEcccccccccEEEEEEEEEEEEEEEccccccccEEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHccEEEEEcccccEEcccccccccccccccccccccEEEEEcccccccccccccEEEEEEcccccccHHHHHHHHHHHHHccccEEEEEEcccHHHHHHcEEEEccccEEEEcccccccccHHHHHHHHcccccccEEEEEEEEEccEEEEEEccccEEEcccccEEEEEEEccccccccccccccccccccccccccEEEEEEEcccccEEcccccEEEEcccEEEEEcccccc

ccEEccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccHHHcccccccHHHHHHHHHHccccccccccHHHHHccccccccEEEEEEcccccccccccEEEEEEcccccccccccccHHHHHHHHHEEccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccEcccccEcccccEEEEEEEcccccccccccccccccccccEEEEEEEEcccccEEEEcccccEcccccccccEEEEEEEccccEcccccEEEEEEEEccHHcccEEEEEEEEEEEEEcccccccccccEEEEEEEEEEEEEccccHHHEEEEHccccccccccccccccccccccccccccccccccHHHHHHHHHHcccEEEEcccccEEccHHHcccccccHHHHHHHcccEEEEcccccccccHHccEEEEEEccHHHHcHHHHHHHHHHHHHccccEEEEEccccHHHHEEEEEEccccccccccccccccHHHHHHHHHHcccEccccEEccEEEEccccEEEEcccEEEEcccccEEEEEEccccccHHccccccEEEEEEEccccccccEEEEEcccHEEEEEEEEEEEccccEEEEEEEcccc

crtlsgtsvasPVVAGVVALLASglkhrpaghinpasmKQGLMAsarrlpgvnmfeqgsgkIDLLRAYQILNsytpqaslspsslflplgirgsgVKVAVfdtglssghtgfnnvaertdwtnentledklghgtfvagcrtlsgtsvasPVVAGVVALLASglkhrpaghinpasmkqgpvsnitrpigsrvpfcagelnvnpqskvFYLDltecqymwpyctqplyhgaipiIVNVTILNGMGVVgkilerpkwypylphngeflEISMTYsdilwpwsGYLAVHISVSAAAAAWQGTVQghievtvespplegeegvrrSTVKLAVkaniiptpprhkrilwdqyhnlrypqgyfprdnlkmkndpldwngdhvhtnFKDLYQHLRNIGYYIevlgtpftcfdarhYGVLLLDLYQHLRNIGYYIevlgtpftcfdarhygvlllvdpeeeyhREEIDKLRRDVEQDGLALIVLADWYNTDVMRKIKfydentrqwwlpetggsnipALNELLAVHGIRlgdrvyegsitmndrtlqymsgtsivqfptsgvLVGAKlnnqgkkgvnpnapmagwSLRWLSTSWRFTVFvsgtgytrymsgtsivqfptsgvlvGAKLNNQ

crtlsgtsvaspvVAGVVALLASGLKHRPAGHINPASMKQGLMASARRLPGVNMFEQGSGKIDLLRAYQILNSYTPQASLSPSSLFLPLGIRGSGVKVAVFDTglssghtgfnnvAERTDWTNENTLEDKLGHGTFVAGCRTLSGTSVASPVVAGVVALLASGLKHRPAghinpasmkqgpvsNITRPIGSRVPFCAGELNVNPQSKVFYLDLTECQYMWPYCTQPLYHGAIPIIVNVTILNGMGVVGKILERPKWYPYLPHNGEFLEISMTYSDILWPWSGYLAVHISVSAAAAAWQGTVQGHIEVTvespplegeegvrrstvklavkaniiptpprhkrilwdQYHNLRYPQGYFPRDNLKMKNDPLDWNGDHVHTNFKDLYQHLRNIGYYIEVLGTPFTCFDARHYGVLLLDLYQHLRNIGYYIEVLGTPFTCFDARHYGVLLLVDPEEEYHREEIDKLRRDVEQDGLALIvladwyntdvMRKIKFYDENTRQWWLPETGGSNIPALNELLAVHGIRLGDRVYEGSITMNDRTLQYMSGTSIVQFPTSGVLVGAKLNNQGKKGVNPNAPMAGWSLRWLSTSWRFTVFVSGTGYTRYMSGtsivqfptsgvlvgaklnnq

CRTLsgtsvaspvvagvvallasglKHRPAGHINPASMKQGLMASARRLPGVNMFEQGSGKIDLLRAYQILNSYTPQAslspsslflplGIRGSGVKVAVFDTGLSSGHTGFNNVAERTDWTNENTLEDKLGHGTFVAGCRTLsgtsvaspvvagvvallasglKHRPAGHINPASMKQGPVSNITRPIGSRVPFCAGELNVNPQSKVFYLDLTECQYMWPYCTQPLYHGAIPIIVNVTILNGMGVVGKILERPKWYPYLPHNGEFLEISMTYSDILWPWSGYLAVHISVSaaaaaWQGTVQGHIEVTVESPPLEGEEGVRRSTVKLAVKANIIPTPPRHKRILWDQYHNLRYPQGYFPRDNLKMKNDPLDWNGDHVHTNFKDLYQHLRNIGYYIEVLGTPFTCFDARHYGVLLLDLYQHLRNIGYYIEVLGTPFTCFDARHYGVLLLVDPEEEYHREEIDKLRRDVEQDGLALIVLADWYNTDVMRKIKFYDENTRQWWLPETGGSNIPALNELLAVHGIRLGDRVYEGSITMNDRTLQYMSGTSIVQFPTSGVLVGAKLNNQGKKGVNPNAPMAGWSLRWLSTSWRFTVFVSGTGYTRYMSGTSIVQFPTSGVLVGAKLNNQ

***********PVVAGVVALLASGLK************************GVNMFEQGSGKIDLLRAYQILNSYTPQASLSPSSLFLPLGIRGSGVKVAVFDTGLSSGHTGFNNVAERTDWTNENTLEDKLGHGTFVAGCRTLSGTSVASPVVAGVVALLASGLKH******************ITRPIGSRVPFCAGELNVNPQSKVFYLDLTECQYMWPYCTQPLYHGAIPIIVNVTILNGMGVVGKILERPKWYPYLPHNGEFLEISMTYSDILWPWSGYLAVHISVSAAAAAWQGTVQGHIEVTVE************STVKLAVKANIIPTPPRHKRILWDQYHNLRYPQGYFPRDNLKMKNDPLDWNGDHVHTNFKDLYQHLRNIGYYIEVLGTPFTCFDARHYGVLLLDLYQHLRNIGYYIEVLGTPFTCFDARHYGVLLLVDPEEEYHREEIDKLRRDVEQDGLALIVLADWYNTDVMRKIKFYDENTRQWWLPETGGSNIPALNELLAVHGIRLGDRVYEGSITMNDRTLQYMSGTSIVQFPTSGVLVGAKLNNQGKKGVNPNAPMAGWSLRWLSTSWRFTVFVSGTGYTRYMSGTSIVQFPTSGVLVG******

CRTLSGTSVASPVVAGVVALLASGLKHRPAGHINPASMKQGLMASARRLPGVNMFEQGSGKIDLLRAYQILNSYTPQASLSPSSLFLPLGIRGSGVKVAVFDTGLSSGHTGFNNVAERTDWTNENTLEDKLGHGTFVAGCR**********VVAGVVALLASGLKHRPAGHINPASMKQGPVSNITRPIGSRVPFCAGELNVNPQSKVFYLDLTECQYMWPYCTQPLYHGAIPIIVNVTILNGMGVVGKILERPKWYPYLPHNGEFLEISMTYSDILWPWSGYLAVHISVSAAAAAWQGTVQGHIEVTVE**************VKLAVKANIIPTPPRHKRILWDQYHNLRYPQGYFPRDNLKMKNDPLDWNGDHVHTNFKDLYQHLRNIGYYIEVLGTPFTCFDARHYGVLLLDLYQHLRNIGYYIEVLGTPFTCFDARHYGVLLLVDPEEEYHREEIDKLRRDVEQDGLALIVLADWYNTDVMRKIKFYDENTRQWWLPETGGSNIPALNELLAVHGIRLGDRVYEGSITMNDRTLQYMSGTSIVQFPTSGVLVGAKLN******************R***TSWRFTVFVSGTGYTRYMSGTSIVQFPTSGVLVGA*****

*********ASPVVAGVVALLASGLKHRPAGHINPASMKQGLMASARRLPGVNMFEQGSGKIDLLRAYQILNSYTPQASLSPSSLFLPLGIRGSGVKVAVFDTGLSSGHTGFNNVAERTDWTNENTLEDKLGHGTFVAGCRTLSGTSVASPVVAGVVALLASGLKHRPAGHINPASMKQGPVSNITRPIGSRVPFCAGELNVNPQSKVFYLDLTECQYMWPYCTQPLYHGAIPIIVNVTILNGMGVVGKILERPKWYPYLPHNGEFLEISMTYSDILWPWSGYLAVHISVSAAAAAWQGTVQGHIEVTVESPPLEGEEGVRRSTVKLAVKANIIPTPPRHKRILWDQYHNLRYPQGYFPRDNLKMKNDPLDWNGDHVHTNFKDLYQHLRNIGYYIEVLGTPFTCFDARHYGVLLLDLYQHLRNIGYYIEVLGTPFTCFDARHYGVLLLVDPEEEYHREEIDKLRRDVEQDGLALIVLADWYNTDVMRKIKFYDENTRQWWLPETGGSNIPALNELLAVHGIRLGDRVYEGSITMNDRTLQYMSGTSIVQFPTSGVLVGAKLNNQGKKGVNPNAPMAGWSLRWLSTSWRFTVFVSGTGYTRYMSGTSIVQFPTSGVLVGAKLNNQ

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		624	2.2.26 [Sep-21-2011]
Q14703		1052	Membrane-bound transcript	yes	N/A	0.645	0.383	0.532	1e-139
Q9Z2A8		1052	Membrane-bound transcript	yes	N/A	0.645	0.383	0.534	1e-139
Q9WTZ2		1052	Membrane-bound transcript	yes	N/A	0.645	0.383	0.536	1e-139
Q9WTZ3		1052	Membrane-bound transcript	yes	N/A	0.645	0.383	0.534	1e-138
Q9V6K1		1441	Tripeptidyl-peptidase 2 O	no	N/A	0.112	0.048	0.394	4e-05

>sp\|Q14703\|MBTP1_HUMAN Membrane-bound transcription factor site-1 protease OS=Homo sapiens GN=MBTPS1 PE=1 SV=1	Back alignment and function desciption

 Score =  497 bits (1280), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 245/460 (53%), Positives = 314/460 (68%), Gaps = 57/460 (12%)

Query: 139 GCRTLSGTSVASPVVAGVVALLASGLKHRPAGHINPASMKQGPVSNITR-PIGSRVPFCA 197
           GCR LSGTSVASPVVAG V LL S ++ R    +NPASMKQ  +++  R P  +      
Sbjct: 406 GCRALSGTSVASPVVAGAVTLLVSTVQKREL--VNPASMKQALIASARRLPGVNMFEQGH 463

Query: 198 GELNV----------NPQSKVF--YLDLTECQYMWPYCTQPLYHGAIPIIVNVTILNGMG 245
           G+L++           PQ+ +   Y+DLTEC YMWPYC+QP+Y+G +P +VNVTILNGMG
Sbjct: 464 GKLDLLRAYQILNSYKPQASLSPSYIDLTECPYMWPYCSQPIYYGGMPTVVNVTILNGMG 523

Query: 246 VVGKILERPKWYPYLPHNGEFLEISMTYSDILWPWSGYLAVHISVSAAAAAWQGTVQGHI 305
           V G+I+++P W PYLP NG+ +E++ +YS +LWPWSGYLA+ ISV+  AA+W+G  QGH+
Sbjct: 524 VTGRIVDKPDWQPYLPQNGDNIEVAFSYSSVLWPWSGYLAISISVTKKAASWEGIAQGHV 583

Query: 306 EVTVESPP-LEGEEGVRR-STVKLAVKANIIPTPPRHKRILWDQYHNLRYPQGYFPRDNL 363
            +TV SP   E + G  + STVKL +K  IIPTPPR KR+LWDQYHNLRYP GYFPRDNL
Sbjct: 584 MITVASPAETESKNGAEQTSTVKLPIKVKIIPTPPRSKRVLWDQYHNLRYPPGYFPRDNL 643

Query: 364 KMKNDPLDWNGDHVHTNFKDLYQHLRNIGYYIEVLGTPFTCFDARHYGVLLLDLYQHLRN 423
           +MKNDPLDWNGDH+HTNF+D+Y                                 QHLR+
Sbjct: 644 RMKNDPLDWNGDHIHTNFRDMY---------------------------------QHLRS 670

Query: 424 IGYYIEVLGTPFTCFDARHYGVLLLVDPEEEYHREEIDKLRRDVEQDGLALIVLADWYNT 483
           +GY++EVLG PFTCFDA  YG LL+VD EEEY  EEI KLRRDV+ +GL+L++ +DWYNT
Sbjct: 671 MGYFVEVLGAPFTCFDASQYGTLLMVDSEEEYFPEEIAKLRRDVD-NGLSLVIFSDWYNT 729

Query: 484 DVMRKIKFYDENTRQWWLPETGGSNIPALNELLAVHGIRLGDRVYEGSITMNDRTLQYMS 543
            VMRK+KFYDENTRQWW+P+TGG+NIPALNELL+V  +   D +YEG  T+ +  + Y S
Sbjct: 730 SVMRKVKFYDENTRQWWMPDTGGANIPALNELLSVWNMGFSDGLYEGEFTLANHDMYYAS 789

Query: 544 GTSIVQFPTSGVLVGAKLNNQG------KKGVNPNAPMAG 577
           G SI +FP  GV++     +QG      +  V  N P+ G
Sbjct: 790 GCSIAKFPEDGVVITQTFKDQGLEVLKQETAVVENVPILG 829

Catalyzes the first step in the proteolytic activation of the sterol regulatory element-binding proteins (SREBPs). Other known substrates are BDNF and ATF6. Cleaves after hydrophobic or small residues, provided that Arg or Lys is in position P4. Cleaves known substrates after Arg-Ser-Val-Leu (SERBP-2), Arg-His-Leu-Leu (ATF6), Arg-Gly-Leu-Thr (BDNF) and its own propeptide after Arg-Arg-Leu-Leu.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: 1EC: 1EC: 2

>sp\|Q9Z2A8\|MBTP1_CRIGR Membrane-bound transcription factor site-1 protease OS=Cricetulus griseus GN=MBTPS1 PE=1 SV=1	Back alignment and function description

>sp\|Q9WTZ2\|MBTP1_MOUSE Membrane-bound transcription factor site-1 protease OS=Mus musculus GN=Mbtps1 PE=1 SV=1	Back alignment and function description

>sp\|Q9WTZ3\|MBTP1_RAT Membrane-bound transcription factor site-1 protease OS=Rattus norvegicus GN=Mbtps1 PE=1 SV=1	Back alignment and function description

>sp\|Q9V6K1\|TPP2_DROME Tripeptidyl-peptidase 2 OS=Drosophila melanogaster GN=TppII PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		624
242015544		956	membrane-bound transcription factor site	0.645	0.421	0.582	1e-150
270003563		965	hypothetical protein TcasGA2_TC002816 [T	0.631	0.408	0.576	1e-147
189235424		970	PREDICTED: similar to membrane-bound tra	0.631	0.406	0.576	1e-147
427780139		1114	Putative membrane-bound transcription fa	0.649	0.363	0.561	1e-144
327273746		1019	PREDICTED: membrane-bound transcription	0.626	0.383	0.549	1e-140
334313083		1052	PREDICTED: LOW QUALITY PROTEIN: membrane	0.645	0.383	0.536	1e-140
297284568		1695	PREDICTED: membrane-bound transcription	0.657	0.241	0.539	1e-139
321478028		1082	hypothetical protein DAPPUDRAFT_310948 [	0.631	0.364	0.568	1e-139
111307803		1052	membrane-bound transcription factor pept	0.626	0.371	0.556	1e-139
350276155		1061	membrane-bound transcription factor site	0.626	0.368	0.556	1e-139

>gi\|242015544\|ref\|XP_002428413.1\| membrane-bound transcription factor site 1 protease precursor, putative [Pediculus humanus corporis] gi\|212513025\|gb\|EEB15675.1\| membrane-bound transcription factor site 1 protease precursor, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

 Score =  538 bits (1386), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 266/457 (58%), Positives = 327/457 (71%), Gaps = 54/457 (11%)

Query: 129 DKLGHGTFVAG------CRTLSGTSVASPVVAGVVALLASGLKHRPAGHINPASMKQGPV 182
           D + +G+ V G      CRTLSGTSVASPV+AG + LLASG+ HR    INPASMKQ  +
Sbjct: 304 DIVTYGSAVRGSNTKGNCRTLSGTSVASPVIAGAITLLASGVLHR-GNVINPASMKQALM 362

Query: 183 SNITR-PIGSRVPFCAGELNV----------NPQSKVF--YLDLTECQYMWPYCTQPLYH 229
           ++  R P  +      G+L++           PQ  +   Y+DL+ECQYMWPYCTQPLY+
Sbjct: 363 ASARRLPGINMFEQGHGKLDLLKAFQILNSYKPQVSLSPSYIDLSECQYMWPYCTQPLYY 422

Query: 230 GAIPIIVNVTILNGMGVVGKILERPKWYPYLPHNGEFLEISMTYSDILWPWSGYLAVHIS 289
             +P IVNVTILNGMGV GK+L +P W PY+PHNG++LEI+ TYSD+LWPWSG+LAV IS
Sbjct: 423 SGMPTIVNVTILNGMGVSGKVLGKPIWSPYIPHNGQYLEIAFTYSDVLWPWSGWLAVTIS 482

Query: 290 VSAAAAAWQGTVQGHIEVTVESPPLEGEEGVRRSTVKLAVKANIIPTPPRHKRILWDQYH 349
           VS  A +W+G  QGHI +TVESPP + E   R STVKL++KA IIPTPPRHKRILWDQYH
Sbjct: 483 VSKNAESWEGIAQGHITLTVESPPEDNESEPRSSTVKLSLKAKIIPTPPRHKRILWDQYH 542

Query: 350 NLRYPQGYFPRDNLKMKNDPLDWNGDHVHTNFKDLYQHLRNIGYYIEVLGTPFTCFDARH 409
           NLRYP GYFPRDNLKMKNDPLDWNGDH+HTNFKD+YQH+RN GYY+EVLG+P+TCFDA  
Sbjct: 543 NLRYPPGYFPRDNLKMKNDPLDWNGDHIHTNFKDMYQHIRNNGYYVEVLGSPYTCFDATL 602

Query: 410 YGVLLLDLYQHLRNIGYYIEVLGTPFTCFDARHYGVLLLVDPEEEYHREEIDKLRRDVEQ 469
           Y                                 G LLLVD EEEY  EE+ KL++DV+ 
Sbjct: 603 Y---------------------------------GTLLLVDAEEEYFPEEVAKLKKDVD- 628

Query: 470 DGLALIVLADWYNTDVMRKIKFYDENTRQWWLPETGGSNIPALNELLAVHGIRLGDRVYE 529
           +GL+L+V ADWYN  VM+K+KFYDENTRQWW+P+TGGSN+PALN+LL+  GI  GD+VYE
Sbjct: 629 NGLSLVVFADWYNVSVMKKVKFYDENTRQWWMPDTGGSNVPALNDLLSSWGIAFGDKVYE 688

Query: 530 GSITMNDRTLQYMSGTSIVQFPTSGVLVGAKLNNQGK 566
           G+  + D  + Y SGTSIVQFP +G+L   +L +QG+
Sbjct: 689 GNFKLGDHEMYYASGTSIVQFPETGILTKVQLKDQGR 725

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|270003563\|gb\|EFA00011.1\| hypothetical protein TcasGA2_TC002816 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|189235424\|ref\|XP_001812491.1\| PREDICTED: similar to membrane-bound transcription factor protease, site 1 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|427780139\|gb\|JAA55521.1\| Putative membrane-bound transcription factor protease site 1 [Rhipicephalus pulchellus]	Back alignment and taxonomy information

>gi\|327273746\|ref\|XP_003221641.1\| PREDICTED: membrane-bound transcription factor site-1 protease-like [Anolis carolinensis]	Back alignment and taxonomy information

>gi\|334313083\|ref\|XP_003339821.1\| PREDICTED: LOW QUALITY PROTEIN: membrane-bound transcription factor site-1 protease-like [Monodelphis domestica]	Back alignment and taxonomy information

>gi\|297284568\|ref\|XP_001112150.2\| PREDICTED: membrane-bound transcription factor site-1 protease [Macaca mulatta]	Back alignment and taxonomy information

>gi\|321478028\|gb\|EFX88986.1\| hypothetical protein DAPPUDRAFT_310948 [Daphnia pulex]	Back alignment and taxonomy information

>gi\|111307803\|gb\|AAI21291.1\| membrane-bound transcription factor peptidase, site 1 [Xenopus (Silurana) tropicalis]	Back alignment and taxonomy information

>gi\|350276155\|ref\|NP_001072791.2\| membrane-bound transcription factor site-1 protease preproprotein [Xenopus (Silurana) tropicalis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		624
TAIR\|locus:2183224		1038	S1P "AT5G19660" [Arabidopsis t	0.392	0.236	0.492	6.4e-128
UNIPROTKB\|Q0DEB2		680	Os06g0163500 "Os06g0163500 pro	0.402	0.369	0.453	1.7e-109
ZFIN\|ZDB-GENE-030131-4909		1074	mbtps1 "membrane-bound transcr	0.437	0.254	0.540	3.9e-108
UNIPROTKB\|E1C6Y2		1060	MBTPS1 "Uncharacterized protei	0.439	0.258	0.535	5e-108
UNIPROTKB\|F1PER6		1050	MBTPS1 "Uncharacterized protei	0.437	0.26	0.541	2.1e-107
UNIPROTKB\|Q14703		1052	MBTPS1 "Membrane-bound transcr	0.439	0.260	0.535	2.1e-107
MGI\|MGI:1927235		1052	Mbtps1 "membrane-bound transcr	0.440	0.261	0.541	7.2e-107
RGD\|70935		1052	Mbtps1 "membrane-bound transcr	0.440	0.261	0.537	9.2e-107
UNIPROTKB\|Q08E55		1052	MBTPS1 "MBTPS1 protein" [Bos t	0.439	0.260	0.532	1.2e-106
UNIPROTKB\|F1S5S6		1055	MBTPS1 "Uncharacterized protei	0.440	0.260	0.537	1.5e-106

TAIR\|locus:2183224 S1P "AT5G19660" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 689 (247.6 bits), Expect = 6.4e-128, Sum P(3) = 6.4e-128
 Identities = 128/260 (49%), Positives = 170/260 (65%)

Query:   172 INPASMKQGPVSNITRPIGSRV-PFCAGELNV----------NPQSKVF--YLDLTECQY 218
             +NPASMKQ  V    +  G  +    AG +++          +P++ +F   LD  +C Y
Sbjct:   435 LNPASMKQALVEGAAKLSGPNMYEQGAGRVDLLESYEILKSYHPRASIFPSILDYNDCPY 494

Query:   219 MWPYCTQPLYHGAIPIIVNVTILNGMGVVGKILERPKWYPYLPHNGEFLEISMTYSDILW 278
              WP+C QPLY GA+PII N TILNGMGV+G I   P W+P     G  L I   Y D++W
Sbjct:   495 SWPFCRQPLYAGAMPIIFNTTILNGMGVIGYIESPPTWHP-ANEEGNLLSIHFKYPDVIW 553

Query:   279 PWSGYLAVHISVSXXXXXWQGTVQGHIEVTVESPPLEGEEGVRRSTVKLAVKANIIPTPP 338
             PW+GYLA+H+ +      + G ++G++ V V SPP  GE G RRST  L +K  +IPTPP
Sbjct:   554 PWTGYLALHMQIKEEGAQFTGEIEGNVTVKVYSPPASGESGPRRSTCSLQLKLKVIPTPP 613

Query:   339 RHKRILWDQYHNLRYPQGYFPRDNLKMKNDPLDWNGDHVHTNFKDLYQHLRNIGYYIEVL 398
             R KRILWDQ+H+++YP GY PRD+L ++ND LDW+GDH+HTNF  +Y  LR+ GYYIE L
Sbjct:   614 RAKRILWDQFHSIKYPPGYIPRDSLDVRNDILDWHGDHLHTNFHIMYNMLRDAGYYIETL 673

Query:   399 GTPFTCFDARHYGVLLL-DL 417
             G+P TCFDA+ YG LL+ DL
Sbjct:   674 GSPLTCFDAQQYGTLLMVDL 693

GO:0004252 "serine-type endopeptidase activity" evidence=IEA;IDA

GO:0005576 "extracellular region" evidence=ISM

GO:0005783 "endoplasmic reticulum" evidence=IDA

GO:0006508 "proteolysis" evidence=IEA;ISS;IMP;IDA

GO:0006629 "lipid metabolic process" evidence=IBA

GO:0004175 "endopeptidase activity" evidence=IDA

GO:0005794 "Golgi apparatus" evidence=IDA

GO:0006972 "hyperosmotic response" evidence=IMP

GO:0042538 "hyperosmotic salinity response" evidence=IMP

GO:0006486 "protein glycosylation" evidence=RCA

GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=RCA

UNIPROTKB\|Q0DEB2 Os06g0163500 "Os06g0163500 protein" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-4909 mbtps1 "membrane-bound transcription factor protease, site 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C6Y2 MBTPS1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PER6 MBTPS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q14703 MBTPS1 "Membrane-bound transcription factor site-1 protease" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:1927235 Mbtps1 "membrane-bound transcription factor peptidase, site 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|70935 Mbtps1 "membrane-bound transcription factor peptidase, site 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q08E55 MBTPS1 "MBTPS1 protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1S5S6 MBTPS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9WTZ3	MBTP1_RAT	3, ., 4, ., 2, 1, ., 1, 1, 2	0.5347	0.6458	0.3830	yes	N/A
Q9WTZ2	MBTP1_MOUSE	3, ., 4, ., 2, 1, ., 1, 1, 2	0.5369	0.6458	0.3830	yes	N/A
Q14703	MBTP1_HUMAN	3, ., 4, ., 2, 1, ., 1, 1, 2	0.5326	0.6458	0.3830	yes	N/A
Q9Z2A8	MBTP1_CRIGR	3, ., 4, ., 2, 1, ., 1, 1, 2	0.5347	0.6458	0.3830	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.4.21	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		624
cd07479		255	cd07479, Peptidases_S8_SKI-1_like, Peptidase S8 fa	2e-20
cd07479		255	cd07479, Peptidases_S8_SKI-1_like, Peptidase S8 fa	1e-15
cd07479		255	cd07479, Peptidases_S8_SKI-1_like, Peptidase S8 fa	2e-12
cd07480		297	cd07480, Peptidases_S8_12, Peptidase S8 family dom	3e-07
cd07489		312	cd07489, Peptidases_S8_5, Peptidase S8 family doma	5e-06
cd07477		229	cd07477, Peptidases_S8_Subtilisin_subset, Peptidas	7e-06
cd07474		295	cd07474, Peptidases_S8_subtilisin_Vpr-like, Peptid	9e-06
cd04842		293	cd04842, Peptidases_S8_Kp43_protease, Peptidase S8	1e-05
cd07487		264	cd07487, Peptidases_S8_1, Peptidase S8 family doma	2e-05
pfam00082		277	pfam00082, Peptidase_S8, Subtilase family	1e-04
cd07473		259	cd07473, Peptidases_S8_Subtilisin_like, Peptidase	1e-04
cd07484		260	cd07484, Peptidases_S8_Thermitase_like, Peptidase	2e-04
cd07478		455	cd07478, Peptidases_S8_CspA-like, Peptidase S8 fam	3e-04
cd07484		260	cd07484, Peptidases_S8_Thermitase_like, Peptidase	5e-04
cd04077		255	cd04077, Peptidases_S8_PCSK9_ProteinaseK_like, Pep	6e-04
cd00306		241	cd00306, Peptidases_S8_S53, Peptidase domain in th	8e-04
cd04857		412	cd04857, Peptidases_S8_Tripeptidyl_Aminopeptidase_	9e-04
cd00306		241	cd00306, Peptidases_S8_S53, Peptidase domain in th	0.001
COG1404		508	COG1404, AprE, Subtilisin-like serine proteases [P	0.001
cd04848		267	cd04848, Peptidases_S8_Autotransporter_serine_prot	0.001
pfam00082		277	pfam00082, Peptidase_S8, Subtilase family	0.002
cd00306		241	cd00306, Peptidases_S8_S53, Peptidase domain in th	0.002
cd04847		291	cd04847, Peptidases_S8_Subtilisin_like_2, Peptidas	0.002
cd07487		264	cd07487, Peptidases_S8_1, Peptidase S8 family doma	0.003
cd07478		455	cd07478, Peptidases_S8_CspA-like, Peptidase S8 fam	0.003
cd04852		307	cd04852, Peptidases_S8_3, Peptidase S8 family doma	0.003
cd07475		346	cd07475, Peptidases_S8_C5a_Peptidase, Peptidase S8	0.003
cd04077		255	cd04077, Peptidases_S8_PCSK9_ProteinaseK_like, Pep	0.004
cd04852		307	cd04852, Peptidases_S8_3, Peptidase S8 family doma	0.004
cd07490		254	cd07490, Peptidases_S8_6, Peptidase S8 family doma	0.004

>gnl\|CDD\|173805 cd07479, Peptidases_S8_SKI-1_like, Peptidase S8 family domain in SKI-1-like proteins	Back alignment and domain information

 Score = 91.0 bits (226), Expect = 2e-20
 Identities = 37/51 (72%), Positives = 41/51 (80%)

Query: 89  LGIRGSGVKVAVFDTGLSSGHTGFNNVAERTDWTNENTLEDKLGHGTFVAG 139
           LG  G+GVKVAVFDTGL+  H  F NV ERT+WTNE TL+D LGHGTFVAG
Sbjct: 3   LGYTGAGVKVAVFDTGLAKDHPHFRNVKERTNWTNEKTLDDGLGHGTFVAG 53

SKI-1 (type I membrane-bound subtilisin-kexin-isoenzyme) proteins are secretory Ca2+-dependent serine proteinases cleave at nonbasic residues: Thr, Leu, and Lys. SKI-1s play a critical role in the regulation of the synthesis and metabolism of cholesterol and fatty acid metabolism. Members of the peptidases S8 and S35 clan include endopeptidases, exopeptidases and also a tripeptidyl-peptidase. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The S53 family contains a catalytic triad Glu/Asp/Ser. The stability of these enzymes may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values. Length = 255

>gnl\|CDD\|173805 cd07479, Peptidases_S8_SKI-1_like, Peptidase S8 family domain in SKI-1-like proteins	Back alignment and domain information

>gnl\|CDD\|173805 cd07479, Peptidases_S8_SKI-1_like, Peptidase S8 family domain in SKI-1-like proteins	Back alignment and domain information

>gnl\|CDD\|173806 cd07480, Peptidases_S8_12, Peptidase S8 family domain, uncharacterized subfamily 12	Back alignment and domain information

>gnl\|CDD\|173814 cd07489, Peptidases_S8_5, Peptidase S8 family domain, uncharacterized subfamily 5	Back alignment and domain information

>gnl\|CDD\|173803 cd07477, Peptidases_S8_Subtilisin_subset, Peptidase S8 family domain in Subtilisin proteins	Back alignment and domain information

>gnl\|CDD\|173800 cd07474, Peptidases_S8_subtilisin_Vpr-like, Peptidase S8 family domain in Vpr-like proteins	Back alignment and domain information

>gnl\|CDD\|173791 cd04842, Peptidases_S8_Kp43_protease, Peptidase S8 family domain in Kp43 proteases	Back alignment and domain information

>gnl\|CDD\|173812 cd07487, Peptidases_S8_1, Peptidase S8 family domain, uncharacterized subfamily 1	Back alignment and domain information

>gnl\|CDD\|215701 pfam00082, Peptidase_S8, Subtilase family	Back alignment and domain information

>gnl\|CDD\|173799 cd07473, Peptidases_S8_Subtilisin_like, Peptidase S8 family domain in Subtilisin-like proteins	Back alignment and domain information

>gnl\|CDD\|173810 cd07484, Peptidases_S8_Thermitase_like, Peptidase S8 family domain in Thermitase-like proteins	Back alignment and domain information

>gnl\|CDD\|173804 cd07478, Peptidases_S8_CspA-like, Peptidase S8 family domain in CspA-like proteins	Back alignment and domain information

>gnl\|CDD\|173810 cd07484, Peptidases_S8_Thermitase_like, Peptidase S8 family domain in Thermitase-like proteins	Back alignment and domain information

>gnl\|CDD\|173790 cd04077, Peptidases_S8_PCSK9_ProteinaseK_like, Peptidase S8 family domain in ProteinaseK-like proteins	Back alignment and domain information

>gnl\|CDD\|173787 cd00306, Peptidases_S8_S53, Peptidase domain in the S8 and S53 families	Back alignment and domain information

>gnl\|CDD\|173796 cd04857, Peptidases_S8_Tripeptidyl_Aminopeptidase_II, Peptidase S8 family domain in Tripeptidyl aminopeptidases_II	Back alignment and domain information

>gnl\|CDD\|173787 cd00306, Peptidases_S8_S53, Peptidase domain in the S8 and S53 families	Back alignment and domain information

>gnl\|CDD\|224322 COG1404, AprE, Subtilisin-like serine proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|173794 cd04848, Peptidases_S8_Autotransporter_serine_protease_like, Peptidase S8 family domain in Autotransporter serine proteases	Back alignment and domain information

>gnl\|CDD\|215701 pfam00082, Peptidase_S8, Subtilase family	Back alignment and domain information

>gnl\|CDD\|173787 cd00306, Peptidases_S8_S53, Peptidase domain in the S8 and S53 families	Back alignment and domain information

>gnl\|CDD\|173793 cd04847, Peptidases_S8_Subtilisin_like_2, Peptidase S8 family domain in Subtilisin-like proteins	Back alignment and domain information

>gnl\|CDD\|173812 cd07487, Peptidases_S8_1, Peptidase S8 family domain, uncharacterized subfamily 1	Back alignment and domain information

>gnl\|CDD\|173804 cd07478, Peptidases_S8_CspA-like, Peptidase S8 family domain in CspA-like proteins	Back alignment and domain information

>gnl\|CDD\|173795 cd04852, Peptidases_S8_3, Peptidase S8 family domain, uncharacterized subfamily 3	Back alignment and domain information

>gnl\|CDD\|173801 cd07475, Peptidases_S8_C5a_Peptidase, Peptidase S8 family domain in Streptococcal C5a peptidases	Back alignment and domain information

>gnl\|CDD\|173790 cd04077, Peptidases_S8_PCSK9_ProteinaseK_like, Peptidase S8 family domain in ProteinaseK-like proteins	Back alignment and domain information

>gnl\|CDD\|173795 cd04852, Peptidases_S8_3, Peptidase S8 family domain, uncharacterized subfamily 3	Back alignment and domain information

>gnl\|CDD\|173815 cd07490, Peptidases_S8_6, Peptidase S8 family domain, uncharacterized subfamily 6	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		624
KOG4266\|consensus		1033		100.0
cd07479		255	Peptidases_S8_SKI-1_like Peptidase S8 family domai	99.8
cd05562		275	Peptidases_S53_like Peptidase domain in the S53 fa	99.75
PTZ00262		639	subtilisin-like protease; Provisional	99.73
cd07489		312	Peptidases_S8_5 Peptidase S8 family domain, unchar	99.69
cd07476		267	Peptidases_S8_thiazoline_oxidase_subtilisin-like_p	99.66
cd07474		295	Peptidases_S8_subtilisin_Vpr-like Peptidase S8 fam	99.63
cd04077		255	Peptidases_S8_PCSK9_ProteinaseK_like Peptidase S8	99.61
cd04852		307	Peptidases_S8_3 Peptidase S8 family domain, unchar	99.61
cd07480		297	Peptidases_S8_12 Peptidase S8 family domain, uncha	99.6
cd05561		239	Peptidases_S8_4 Peptidase S8 family domain, unchar	99.6
cd07494		298	Peptidases_S8_10 Peptidase S8 family domain, uncha	99.6
cd04059		297	Peptidases_S8_Protein_convertases_Kexins_Furin-lik	99.59
cd07492		222	Peptidases_S8_8 Peptidase S8 family domain, unchar	99.58
cd07497		311	Peptidases_S8_14 Peptidase S8 family domain, uncha	99.55
cd07485		273	Peptidases_S8_Fervidolysin_like Peptidase S8 famil	99.54
cd07483		291	Peptidases_S8_Subtilisin_Novo-like Peptidase S8 fa	99.52
cd07475		346	Peptidases_S8_C5a_Peptidase Peptidase S8 family do	99.51
cd07478		455	Peptidases_S8_CspA-like Peptidase S8 family domain	99.5
cd07484		260	Peptidases_S8_Thermitase_like Peptidase S8 family	99.49
cd07493		261	Peptidases_S8_9 Peptidase S8 family domain, unchar	99.48
cd07481		264	Peptidases_S8_BacillopeptidaseF-like Peptidase S8	99.48
KOG4266\|consensus		1033		99.46
cd04842		293	Peptidases_S8_Kp43_protease Peptidase S8 family do	99.45
cd07490		254	Peptidases_S8_6 Peptidase S8 family domain, unchar	99.43
cd04843		277	Peptidases_S8_11 Peptidase S8 family domain, uncha	99.43
cd07473		259	Peptidases_S8_Subtilisin_like Peptidase S8 family	99.42
cd07487		264	Peptidases_S8_1 Peptidase S8 family domain, unchar	99.39
cd04847		291	Peptidases_S8_Subtilisin_like_2 Peptidase S8 famil	99.36
cd07477		229	Peptidases_S8_Subtilisin_subset Peptidase S8 famil	99.35
cd07498		242	Peptidases_S8_15 Peptidase S8 family domain, uncha	99.35
cd04848		267	Peptidases_S8_Autotransporter_serine_protease_like	99.34
cd07496		285	Peptidases_S8_13 Peptidase S8 family domain, uncha	99.3
PF00082		282	Peptidase_S8: Subtilase family This is family S8 i	99.26
cd07482		294	Peptidases_S8_Lantibiotic_specific_protease Peptid	99.25
KOG1153\|consensus		501		99.25
cd05562		275	Peptidases_S53_like Peptidase domain in the S53 fa	99.22
cd07491		247	Peptidases_S8_7 Peptidase S8 family domain, unchar	99.18
PTZ00262		639	subtilisin-like protease; Provisional	98.96
cd07474		295	Peptidases_S8_subtilisin_Vpr-like Peptidase S8 fam	98.91
cd07489		312	Peptidases_S8_5 Peptidase S8 family domain, unchar	98.84
KOG1114\|consensus		1304		98.84
PF00082		282	Peptidase_S8: Subtilase family This is family S8 i	98.83
cd07475		346	Peptidases_S8_C5a_Peptidase Peptidase S8 family do	98.78
cd07478		455	Peptidases_S8_CspA-like Peptidase S8 family domain	98.77
cd00306		241	Peptidases_S8_S53 Peptidase domain in the S8 and S	98.67
KOG3526\|consensus		629		98.58
cd07476		267	Peptidases_S8_thiazoline_oxidase_subtilisin-like_p	98.53
cd07480		297	Peptidases_S8_12 Peptidase S8 family domain, uncha	98.51
KOG1114\|consensus		1304		98.49
cd04857		412	Peptidases_S8_Tripeptidyl_Aminopeptidase_II Peptid	98.37
COG1404		508	AprE Subtilisin-like serine proteases [Posttransla	98.11
cd07488		247	Peptidases_S8_2 Peptidase S8 family domain, unchar	97.84
PF09822		271	ABC_transp_aux: ABC-type uncharacterized transport	97.3
KOG1153\|consensus		501		96.08
PF14258		70	DUF4350: Domain of unknown function (DUF4350)	96.07
COG1404		508	AprE Subtilisin-like serine proteases [Posttransla	95.37
TIGR03521		552	GldG gliding-associated putative ABC transporter s	95.1
cd04056		361	Peptidases_S53 Peptidase domain in the S53 family.	91.83
KOG3526\|consensus		629		89.21
cd04857		412	Peptidases_S8_Tripeptidyl_Aminopeptidase_II Peptid	88.67
KOG3525\|consensus		431		87.51
cd04056		361	Peptidases_S53 Peptidase domain in the S53 family.	84.29

>KOG4266\|consensus	Back alignment and domain information

Probab=100.00  E-value=2.2e-169  Score=1358.53  Aligned_cols=458  Identities=58%  Similarity=1.062  Sum_probs=445.0

Q ss_pred             ccccccccccCccEEEEeecCCcccccccccccccccccCCCCccCCCCCcceee-------------------------
Q psy1075          84 SLFLPLGIRGSGVKVAVFDTGLSSGHTGFNNVAERTDWTNENTLEDKLGHGTFVA-------------------------  138 (624)
Q Consensus        84 ta~w~~G~tG~GV~VAVIDTGVd~~HPdf~~v~~~~~~t~~~~~~D~~GHGT~VA-------------------------  138 (624)
                      +.+|..|+||++|+|||+|||+.++||||+++.++++|+++.+.+|..||||+||                         
T Consensus       191 d~LWk~GyTGa~VkvAiFDTGl~~~HPHFrnvKERTNWTNE~tLdD~lgHGTFVAGvia~~~ec~gfa~d~e~~~frvft  270 (1033)
T KOG4266|consen  191 DHLWKKGYTGAKVKVAIFDTGLRADHPHFRNVKERTNWTNEDTLDDNLGHGTFVAGVIAGRNECLGFASDTEIYAFRVFT  270 (1033)
T ss_pred             hhHHhccccCCceEEEEeecccccCCccccchhhhcCCcCccccccCcccceeEeeeeccchhhcccCCccceeEEEeec
Confidence            5689999999999999999999999999999999999999999999999999999                         


Q ss_pred             --------------------------------------------------------------------------------
Q psy1075         139 --------------------------------------------------------------------------------  138 (624)
Q Consensus       139 --------------------------------------------------------------------------------  138 (624)
                                                                                                      
T Consensus       271 ~~qVSYTSWFLDAFNYAI~~kidvLNLSIGGPDfmD~PFVeKVwEltAnNvIMvSAiGNDGPLYGTLNNPaDQsDViGVG  350 (1033)
T KOG4266|consen  271 DAQVSYTSWFLDAFNYAIATKIDVLNLSIGGPDFMDLPFVEKVWELTANNVIMVSAIGNDGPLYGTLNNPADQSDVIGVG  350 (1033)
T ss_pred             cceeehhhHHHHHHHHHHhhhcceEeeccCCcccccchHHHHHHhhccCcEEEEEecCCCCcceeecCCcccccceeeec
Confidence                                                                                            


Q ss_pred             ----------------------------------------------ceeccCcccccchhHHHHHHHHHhcCCCCCCCCC
Q psy1075         139 ----------------------------------------------GCRTLSGTSVASPVVAGVVALLASGLKHRPAGHI  172 (624)
Q Consensus       139 ----------------------------------------------g~~~lSGTSmAAP~VAGaaALLlS~~P~~~~~~l  172 (624)
                                                                    ||+.+||||+|+|+|||+++||.|..- +..+.+
T Consensus       351 GIdfdD~IA~FSSRGMtTWELP~GYGRmkpDiVtYG~~v~GS~v~~GCr~LSGTSVaSPVVAGav~LLvS~~~-qk~dl~  429 (1033)
T KOG4266|consen  351 GIDFDDHIASFSSRGMTTWELPHGYGRMKPDIVTYGRDVMGSKVSTGCRSLSGTSVASPVVAGAVCLLVSVEA-QKKDLL  429 (1033)
T ss_pred             cccccchhhhhccCCcceeecCCcccccCCceEeeccccccCcccccchhccCCcccchhhhceeeeEeeehe-ehhhcc
Confidence                                                          799999999999999999999999633 224689


Q ss_pred             ChHhhhhhhhcccccCCCCC-Ccccceeeecccccee------------eeccccCccccCCCCCccCccCCcCeEeeee
Q psy1075         173 NPASMKQGPVSNITRPIGSR-VPFCAGELNVNPQSKV------------FYLDLTECQYMWPYCTQPLYHGAIPIIVNVT  239 (624)
Q Consensus       173 spaqVkq~L~~tA~~l~~~~-~~~G~G~lnl~~a~~~------------~~~dl~~cp~~wP~~~qpL~~~a~pv~~nlt  239 (624)
                      ||++|||+|+++|.++++.+ ++||+|++|+.++.++            ..+|+++||||||||+||||+++||+++|+|
T Consensus       430 NPASmKQaLiegA~kLpg~NMfEQGaGkldLL~syqiL~SYkP~asl~PsylD~t~cpYmWPycsQPlYyG~mp~i~NvT  509 (1033)
T KOG4266|consen  430 NPASMKQALIEGAAKLPGPNMFEQGAGKLDLLESYQILKSYKPRASLFPSYLDYTDCPYMWPYCSQPLYYGAMPIIFNVT  509 (1033)
T ss_pred             CHHHHHHHHHhHHhhCCCCchhhccCcchhHHHHHHHHHhcCCCceecchhcccccCcccCccccCccccCCcceEEEEE
Confidence            99999999999999999865 7999999999887643            3799999999999999999999999999999


Q ss_pred             eccCcccceeeeeCCceeecCCCCCceeEEEEeccceeeeeceEEEEEEEEccCccCceeEEEEEEEEEEECCCCCCCCc
Q psy1075         240 ILNGMGVVGKILERPKWYPYLPHNGEFLEISMTYSDILWPWSGYLAVHISVSAAAAAWQGTVQGHIEVTVESPPLEGEEG  319 (624)
Q Consensus       240 ~~ng~~~~G~i~~~p~w~~~~~~~G~~l~v~~s~s~~~wP~~G~lav~~tv~~~~~~~~G~~~G~v~ltv~s~~~~~~~~  319 (624)
                      |+|||+++|+|+.+|+|+|+..++|++|+|+|+||+++|||+|||+|+++|++++++|+|+++|+|+++|+||++.+++.
T Consensus       510 ILNGmgVtg~Iv~~P~W~P~~e~qG~~l~v~f~ys~viWPWtGyla~~i~vkkega~feG~~~G~vtv~v~Sp~~t~~~~  589 (1033)
T KOG4266|consen  510 ILNGMGVTGYIVSPPTWHPANEEQGNLLSVHFKYSDVIWPWTGYLALHIQVKKEGAQFEGEIEGNVTVKVYSPPATGESG  589 (1033)
T ss_pred             EecccceeeEecCCCCCccCccccCceEEEEEecCCcccccccceEEEEEeeeccccceeEeeeeEEEEEecCcccCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeeEEEEEEEEeeecCCCccccceeeccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcHHHHHHHHHhcceEEEEcC
Q psy1075         320 VRRSTVKLAVKANIIPTPPRHKRILWDQYHNLRYPQGYFPRDNLKMKNDPLDWNGDHVHTNFKDLYQHLRNIGYYIEVLG  399 (624)
Q Consensus       320 ~~~~~v~~p~~~~iip~Ppr~~Rilwdq~h~~~yP~gy~prD~l~~~~d~~dw~gDh~htNf~~~~~~lr~~g~~vevl~  399 (624)
                      ++++||.||+|+||||||||+|||||||||||||||||||||+|++|+|||||||||+|||||+||+|||++||||||| 
T Consensus       590 ~~~stv~lplk~KviPtPPR~KRiLWDQyHslrYPPgYiPRD~L~vknDpLDW~gDHiHTNFrdMY~hLR~~GYyievL-  668 (1033)
T KOG4266|consen  590 PRRSTVSLPLKLKVIPTPPRAKRILWDQYHSLRYPPGYIPRDSLDVKNDPLDWHGDHIHTNFRDMYNHLRDAGYYIEVL-  668 (1033)
T ss_pred             CceeEEeeeeEEEeccCCCcccchhhhhhccccCCCCCCCcccccccCCccccccccccccHHHHHHHHHhcceehhhh-
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999999999 


Q ss_pred             CCccccccccccchhhhhhhhhcccceeecccCceeeeecCCCeeEEEEecCCCCCCHHHHHHHHHHHHhcCccEEEEee
Q psy1075         400 TPFTCFDARHYGVLLLDLYQHLRNIGYYIEVLGTPFTCFDARHYGVLLLVDPEEEYHREEIDKLRRDVEQDGLALIVLAD  479 (624)
Q Consensus       400 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~tc~~~~~yg~llivD~E~e~~~~e~~~l~~~v~~~gl~~iv~~d  479 (624)
                                                      |+|||||||++||||||||+||+||||||+||++||...||+|+||+|
T Consensus       669 --------------------------------g~PfTCFdAsqYGtLLmVD~E~~yfpEEI~kLr~dV~n~GL~lVvF~d  716 (1033)
T KOG4266|consen  669 --------------------------------GSPFTCFDASQYGTLLMVDLEDDYFPEEIEKLRDDVINTGLGLVVFAD  716 (1033)
T ss_pred             --------------------------------cCCceeccHhHCceEEEEccccccCHHHHHHHHHHHHhcCceEEEEec
Confidence                                            999999999999999999999999999999999999888999999999


Q ss_pred             ecchhhhhhceecccccccceeccCCCCCcchhhhhhhhhcccccCeEEeeeEEeCCeeEEeecCCceeecCCCCeEEEE
Q psy1075         480 WYNTDVMRKIKFYDENTRQWWLPETGGSNIPALNELLAVHGIRLGDRVYEGSITMNDRTLQYMSGTSIVQFPTSGVLVGA  559 (624)
Q Consensus       480 Wy~~~~~~~~~f~d~nt~~~w~p~tgg~nvPalN~lL~~~~i~~g~~v~~g~~~~~~~~~~~~sg~~i~~fp~~~~~~~~  559 (624)
                      |||++||+|||||||||||||+|+||||||||||+||++|||||||+++||+|+|++|+|||+|||+|++||+||+|+..
T Consensus       717 WYNt~vM~K~kFfDeNTRqWWtPdTGGANIPALN~LL~~fgiaFgD~i~eG~F~l~~h~myYASG~~IvkFP~~G~~~t~  796 (1033)
T KOG4266|consen  717 WYNTDVMVKMKFFDENTRQWWTPDTGGANIPALNNLLASFGIAFGDKILEGDFSLDGHQMYYASGTNIVKFPAGGFLHTF  796 (1033)
T ss_pred             cccceeeeeeeeeccCcceeccCCCCCcCcHhHHHHHhhhccccccceecceeeecCceeeeecCCeEEEccCCCEEEee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EcccccccccCCCCCC
Q psy1075         560 KLNNQGKKGVNPNAPM  575 (624)
Q Consensus       560 ~l~~~~~~~~~~~~~~  575 (624)
                      +|+|||.++++||++.
T Consensus       797 ~l~Dqgls~~~q~t~~  812 (1033)
T KOG4266|consen  797 PLLDQGLSGATQNTLL  812 (1033)
T ss_pred             eecccchhhhcccchh
Confidence            9999999999999854

>cd07479 Peptidases_S8_SKI-1_like Peptidase S8 family domain in SKI-1-like proteins	Back alignment and domain information

>cd05562 Peptidases_S53_like Peptidase domain in the S53 family	Back alignment and domain information

>PTZ00262 subtilisin-like protease; Provisional	Back alignment and domain information

>cd07489 Peptidases_S8_5 Peptidase S8 family domain, uncharacterized subfamily 5	Back alignment and domain information

>cd07476 Peptidases_S8_thiazoline_oxidase_subtilisin-like_protease Peptidase S8 family domain in Thiazoline oxidase/subtilisin-like proteases	Back alignment and domain information

>cd07474 Peptidases_S8_subtilisin_Vpr-like Peptidase S8 family domain in Vpr-like proteins	Back alignment and domain information

>cd04077 Peptidases_S8_PCSK9_ProteinaseK_like Peptidase S8 family domain in ProteinaseK-like proteins	Back alignment and domain information

>cd04852 Peptidases_S8_3 Peptidase S8 family domain, uncharacterized subfamily 3	Back alignment and domain information

>cd07480 Peptidases_S8_12 Peptidase S8 family domain, uncharacterized subfamily 12	Back alignment and domain information

>cd05561 Peptidases_S8_4 Peptidase S8 family domain, uncharacterized subfamily 4	Back alignment and domain information

>cd07494 Peptidases_S8_10 Peptidase S8 family domain, uncharacterized subfamily 10	Back alignment and domain information

>cd04059 Peptidases_S8_Protein_convertases_Kexins_Furin-like Peptidase S8 family domain in Protein convertases	Back alignment and domain information

>cd07492 Peptidases_S8_8 Peptidase S8 family domain, uncharacterized subfamily 8	Back alignment and domain information

>cd07497 Peptidases_S8_14 Peptidase S8 family domain, uncharacterized subfamily 14	Back alignment and domain information

>cd07485 Peptidases_S8_Fervidolysin_like Peptidase S8 family domain in Fervidolysin	Back alignment and domain information

>cd07483 Peptidases_S8_Subtilisin_Novo-like Peptidase S8 family domain in Subtilisin_Novo-like proteins	Back alignment and domain information

>cd07475 Peptidases_S8_C5a_Peptidase Peptidase S8 family domain in Streptococcal C5a peptidases	Back alignment and domain information

>cd07478 Peptidases_S8_CspA-like Peptidase S8 family domain in CspA-like proteins	Back alignment and domain information

>cd07484 Peptidases_S8_Thermitase_like Peptidase S8 family domain in Thermitase-like proteins	Back alignment and domain information

>cd07493 Peptidases_S8_9 Peptidase S8 family domain, uncharacterized subfamily 9	Back alignment and domain information

>cd07481 Peptidases_S8_BacillopeptidaseF-like Peptidase S8 family domain in BacillopeptidaseF-like proteins	Back alignment and domain information

>KOG4266\|consensus	Back alignment and domain information

>cd04842 Peptidases_S8_Kp43_protease Peptidase S8 family domain in Kp43 proteases	Back alignment and domain information

>cd07490 Peptidases_S8_6 Peptidase S8 family domain, uncharacterized subfamily 6	Back alignment and domain information

>cd04843 Peptidases_S8_11 Peptidase S8 family domain, uncharacterized subfamily 11	Back alignment and domain information

>cd07473 Peptidases_S8_Subtilisin_like Peptidase S8 family domain in Subtilisin-like proteins	Back alignment and domain information

>cd07487 Peptidases_S8_1 Peptidase S8 family domain, uncharacterized subfamily 1	Back alignment and domain information

>cd04847 Peptidases_S8_Subtilisin_like_2 Peptidase S8 family domain in Subtilisin-like proteins	Back alignment and domain information

>cd07477 Peptidases_S8_Subtilisin_subset Peptidase S8 family domain in Subtilisin proteins	Back alignment and domain information

>cd07498 Peptidases_S8_15 Peptidase S8 family domain, uncharacterized subfamily 15	Back alignment and domain information

>cd04848 Peptidases_S8_Autotransporter_serine_protease_like Peptidase S8 family domain in Autotransporter serine proteases	Back alignment and domain information

>cd07496 Peptidases_S8_13 Peptidase S8 family domain, uncharacterized subfamily 13	Back alignment and domain information

>PF00082 Peptidase_S8: Subtilase family This is family S8 in the peptidase classification	Back alignment and domain information

>cd07482 Peptidases_S8_Lantibiotic_specific_protease Peptidase S8 family domain in Lantiobiotic (lanthionine-containing antibiotics) specific proteases	Back alignment and domain information

>KOG1153\|consensus	Back alignment and domain information

>cd05562 Peptidases_S53_like Peptidase domain in the S53 family	Back alignment and domain information

>cd07491 Peptidases_S8_7 Peptidase S8 family domain, uncharacterized subfamily 7	Back alignment and domain information

>PTZ00262 subtilisin-like protease; Provisional	Back alignment and domain information

>cd07474 Peptidases_S8_subtilisin_Vpr-like Peptidase S8 family domain in Vpr-like proteins	Back alignment and domain information

>cd07489 Peptidases_S8_5 Peptidase S8 family domain, uncharacterized subfamily 5	Back alignment and domain information

>KOG1114\|consensus	Back alignment and domain information

>PF00082 Peptidase_S8: Subtilase family This is family S8 in the peptidase classification	Back alignment and domain information

>cd07475 Peptidases_S8_C5a_Peptidase Peptidase S8 family domain in Streptococcal C5a peptidases	Back alignment and domain information

>cd07478 Peptidases_S8_CspA-like Peptidase S8 family domain in CspA-like proteins	Back alignment and domain information

>cd00306 Peptidases_S8_S53 Peptidase domain in the S8 and S53 families	Back alignment and domain information

>KOG3526\|consensus	Back alignment and domain information

>cd07476 Peptidases_S8_thiazoline_oxidase_subtilisin-like_protease Peptidase S8 family domain in Thiazoline oxidase/subtilisin-like proteases	Back alignment and domain information

>cd07480 Peptidases_S8_12 Peptidase S8 family domain, uncharacterized subfamily 12	Back alignment and domain information

>KOG1114\|consensus	Back alignment and domain information

>cd04857 Peptidases_S8_Tripeptidyl_Aminopeptidase_II Peptidase S8 family domain in Tripeptidyl aminopeptidases_II	Back alignment and domain information

>COG1404 AprE Subtilisin-like serine proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd07488 Peptidases_S8_2 Peptidase S8 family domain, uncharacterized subfamily 2	Back alignment and domain information

>PF09822 ABC_transp_aux: ABC-type uncharacterized transport system; InterPro: IPR019196 This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins	Back alignment and domain information

>KOG1153\|consensus	Back alignment and domain information

>PF14258 DUF4350: Domain of unknown function (DUF4350)	Back alignment and domain information

>COG1404 AprE Subtilisin-like serine proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03521 GldG gliding-associated putative ABC transporter substrate-binding component GldG	Back alignment and domain information

>cd04056 Peptidases_S53 Peptidase domain in the S53 family	Back alignment and domain information

>KOG3526\|consensus	Back alignment and domain information

>cd04857 Peptidases_S8_Tripeptidyl_Aminopeptidase_II Peptidase S8 family domain in Tripeptidyl aminopeptidases_II	Back alignment and domain information

>KOG3525\|consensus	Back alignment and domain information

>cd04056 Peptidases_S53 Peptidase domain in the S53 family	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		624
3lxu_X		1354	Tripeptidyl-peptidase 2; spindle complex, aminopep	6e-28
3lxu_X		1354	Tripeptidyl-peptidase 2; spindle complex, aminopep	2e-19
1wmd_A		434	Protease; alpha-beta hydrolase fold, jelly-roll be	7e-13
1wmd_A		434	Protease; alpha-beta hydrolase fold, jelly-roll be	3e-09
1wmd_A		434	Protease; alpha-beta hydrolase fold, jelly-roll be	6e-06
3t41_A		471	Epidermin leader peptide processing serine protea;	1e-10
3t41_A		471	Epidermin leader peptide processing serine protea;	2e-04
3t41_A		471	Epidermin leader peptide processing serine protea;	5e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-10
1thm_A		279	Thermitase; hydrolase(serine protease); 1.37A {The	4e-10
1thm_A		279	Thermitase; hydrolase(serine protease); 1.37A {The	3e-06
1thm_A		279	Thermitase; hydrolase(serine protease); 1.37A {The	1e-04
2iy9_A		347	SUBA; toxin, shiga, plasmid; 1.8A {Escherichia col	9e-10
2iy9_A		347	SUBA; toxin, shiga, plasmid; 1.8A {Escherichia col	2e-04
2iy9_A		347	SUBA; toxin, shiga, plasmid; 1.8A {Escherichia col	4e-04
1dbi_A		280	AK.1 serine protease; hydrolase; 1.80A {Bacillus S	1e-09
1dbi_A		280	AK.1 serine protease; hydrolase; 1.80A {Bacillus S	7e-05
1dbi_A		280	AK.1 serine protease; hydrolase; 1.80A {Bacillus S	4e-04
2x8j_A		327	Intracellular subtilisin protease; hydrolase, seri	1e-09
2x8j_A		327	Intracellular subtilisin protease; hydrolase, seri	1e-05
2x8j_A		327	Intracellular subtilisin protease; hydrolase, seri	1e-05
3afg_A		539	Subtilisin-like serine protease; propeptide, therm	2e-09
3afg_A		539	Subtilisin-like serine protease; propeptide, therm	3e-08
3afg_A		539	Subtilisin-like serine protease; propeptide, therm	6e-04
1to2_E		281	Subtilisin BPN'; serine protease, hydrolase; HET:	3e-09
1to2_E		281	Subtilisin BPN'; serine protease, hydrolase; HET:	2e-06
1to2_E		281	Subtilisin BPN'; serine protease, hydrolase; HET:	4e-04
1gci_A		269	Subtilisin; hydrolase, serine protease; 0.78A {Bac	4e-09
1gci_A		269	Subtilisin; hydrolase, serine protease; 0.78A {Bac	2e-06
1gci_A		269	Subtilisin; hydrolase, serine protease; 0.78A {Bac	2e-04
1r0r_E		274	Subtilisin carlsberg; high resolution, serine prot	7e-09
1r0r_E		274	Subtilisin carlsberg; high resolution, serine prot	4e-07
1r0r_E		274	Subtilisin carlsberg; high resolution, serine prot	4e-04
4aks_A		360	PATG, thiazoline oxidase/subtilisin-like protease;	9e-09
4aks_A		360	PATG, thiazoline oxidase/subtilisin-like protease;	3e-04
3lpc_A		340	APRB2; protease, subtilase, virulence factor, hydr	1e-08
1y9z_A		441	Alkaline serine protease; subtilisin-like alpha/be	2e-08
1y9z_A		441	Alkaline serine protease; subtilisin-like alpha/be	9e-06
1y9z_A		441	Alkaline serine protease; subtilisin-like alpha/be	3e-05
1r6v_A		671	Subtilisin-like serine protease; sandwich domain,	2e-08
1r6v_A		671	Subtilisin-like serine protease; sandwich domain,	3e-05
2ixt_A		310	36KDA protease; serine protease, sphericase, subti	3e-08
2ixt_A		310	36KDA protease; serine protease, sphericase, subti	1e-06
2ixt_A		310	36KDA protease; serine protease, sphericase, subti	3e-04
2z30_A		320	TK-subtilisin; thermococcus kodakaraensis, hydrola	5e-07
2z30_A		320	TK-subtilisin; thermococcus kodakaraensis, hydrola	4e-05
2z2z_A		395	TK-subtilisin precursor; thermococcus kodakaraensi	7e-07
2z2z_A		395	TK-subtilisin precursor; thermococcus kodakaraensi	4e-05
1xf1_A		926	C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St	8e-07
2b6n_A		278	Proteinase K; S binding, substrate specificity, pr	2e-05
2b6n_A		278	Proteinase K; S binding, substrate specificity, pr	3e-05
2b6n_A		278	Proteinase K; S binding, substrate specificity, pr	5e-04
2pwa_A		279	Proteinase K; structure, alanine boronic acid, hyd	2e-05
2pwa_A		279	Proteinase K; structure, alanine boronic acid, hyd	7e-05
2pwa_A		279	Proteinase K; structure, alanine boronic acid, hyd	2e-04
1sh7_A		284	Extracellular subtilisin-like serine proteinase; c	2e-05
1sh7_A		284	Extracellular subtilisin-like serine proteinase; c	5e-05
1sh7_A		284	Extracellular subtilisin-like serine proteinase; c	6e-04
2qtw_B		546	Proprotein convertase subtilisin/kexin type 9; cor	4e-05
2qtw_B		546	Proprotein convertase subtilisin/kexin type 9; cor	6e-05
2qtw_B		546	Proprotein convertase subtilisin/kexin type 9; cor	6e-04
3f7m_A		279	Alkaline serine protease VER112; verticillium psal	4e-05
3f7m_A		279	Alkaline serine protease VER112; verticillium psal	1e-04
3f7m_A		279	Alkaline serine protease VER112; verticillium psal	9e-04
4dzt_A		276	Aqualysin-1, aqualysin-I; serine protease, calcium	5e-05
4dzt_A		276	Aqualysin-1, aqualysin-I; serine protease, calcium	5e-05
4dzt_A		276	Aqualysin-1, aqualysin-I; serine protease, calcium	6e-04
2p4e_P		692	Proprotein convertase subtilisin/kexin type 9; pro	5e-05
2p4e_P		692	Proprotein convertase subtilisin/kexin type 9; pro	7e-05
2p4e_P		692	Proprotein convertase subtilisin/kexin type 9; pro	7e-04
3vta_A		621	Cucumisin; subtilisin-like fold, serine protease,	7e-04

>3lxu_X Tripeptidyl-peptidase 2; spindle complex, aminopeptidase, hydrolase, phosphoprotein, protease; 3.14A {Drosophila melanogaster} Length = 1354	Back alignment and structure

 Score =  119 bits (298), Expect = 6e-28
 Identities = 48/294 (16%), Positives = 86/294 (29%), Gaps = 28/294 (9%)

Query: 139 GCRTLSGTSVASPVVAGVVALLASGLKHRPAGHINPASMKQGPVSNITRPIGSRVPFC-- 196
             + ++GTS+A+P VAG VALL SGLK +     +P S+K+  +S     +G   PF   
Sbjct: 454 KSQLMNGTSMAAPHVAGAVALLISGLKQQ-NIEYSPYSIKRA-ISVTATKLGYVDPFAQG 511

Query: 197 AGELNVN-------------PQSKVFYLDLTECQYMWPYCTQPLYHGAIPIIVNVTI--L 241
            G LNV                   F + +        +  Q +   +I   V +     
Sbjct: 512 HGLLNVEKAFEHLTEHRQSKDNMLRFSVRVGNNADKGIHLRQGVQRNSIDYNVYIEPIFY 571

Query: 242 NGMGVVGKILERPKWYPYLPHNGEFLEISMTYSDILWPWSGYLAVHISVSAAAAAWQGTV 301
           N      K          L  +  ++         L    G  ++ + V        G  
Sbjct: 572 NDKEADPKDKFNFNVRLNLIASQPWV----QCGAFLDLSYGTRSIAVRVDPTGLQ-PGVH 626

Query: 302 QGHIEVTVESPPLEGEEGVRRSTVKLAVKANIIPTPPRHKRILWDQYHNLRYPQGYFPRD 361
              I         +G       TV            P  +       +++ +      RD
Sbjct: 627 SAVIRAYDTDCVQKGSLFEIPVTVVQPHVLESDQNTPVFEPASSKGDNSVEFQPNTIQRD 686

Query: 362 NLKMKNDPLDWNGDHVHTNFKDLYQHLRNIGYYIEVLGT-PFTCFDARHYGVLL 414
            + +   P       +     D  +      +++      P           ++
Sbjct: 687 FILV---PERATWAELRMRITDPNRGEDIGKFFVHTNQLLPKQSCRKLETMKIV 737

PyMOL of 3lxu

>3lxu_X Tripeptidyl-peptidase 2; spindle complex, aminopeptidase, hydrolase, phosphoprotein, protease; 3.14A {Drosophila melanogaster} Length = 1354	Back alignment and structure

>1wmd_A Protease; alpha-beta hydrolase fold, jelly-roll beta-barrel, hydrolase; 1.30A {Bacillus SP} SCOP: b.18.1.20 c.41.1.1 PDB: 1wme_A 1wmf_A Length = 434	Back alignment and structure

>1wmd_A Protease; alpha-beta hydrolase fold, jelly-roll beta-barrel, hydrolase; 1.30A {Bacillus SP} SCOP: b.18.1.20 c.41.1.1 PDB: 1wme_A 1wmf_A Length = 434	Back alignment and structure

>1wmd_A Protease; alpha-beta hydrolase fold, jelly-roll beta-barrel, hydrolase; 1.30A {Bacillus SP} SCOP: b.18.1.20 c.41.1.1 PDB: 1wme_A 1wmf_A Length = 434	Back alignment and structure

>3t41_A Epidermin leader peptide processing serine protea; structural genomics, center for structural genomics of infec diseases, csgid; 1.95A {Staphylococcus aureus} PDB: 3qfh_A Length = 471	Back alignment and structure

>3t41_A Epidermin leader peptide processing serine protea; structural genomics, center for structural genomics of infec diseases, csgid; 1.95A {Staphylococcus aureus} PDB: 3qfh_A Length = 471	Back alignment and structure

>3t41_A Epidermin leader peptide processing serine protea; structural genomics, center for structural genomics of infec diseases, csgid; 1.95A {Staphylococcus aureus} PDB: 3qfh_A Length = 471	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1thm_A Thermitase; hydrolase(serine protease); 1.37A {Thermoactinomyces vulgaris} SCOP: c.41.1.1 PDB: 2tec_E 1tec_E 3tec_E Length = 279	Back alignment and structure

>1thm_A Thermitase; hydrolase(serine protease); 1.37A {Thermoactinomyces vulgaris} SCOP: c.41.1.1 PDB: 2tec_E 1tec_E 3tec_E Length = 279	Back alignment and structure

>1thm_A Thermitase; hydrolase(serine protease); 1.37A {Thermoactinomyces vulgaris} SCOP: c.41.1.1 PDB: 2tec_E 1tec_E 3tec_E Length = 279	Back alignment and structure

>2iy9_A SUBA; toxin, shiga, plasmid; 1.8A {Escherichia coli} Length = 347	Back alignment and structure

>2iy9_A SUBA; toxin, shiga, plasmid; 1.8A {Escherichia coli} Length = 347	Back alignment and structure

>2iy9_A SUBA; toxin, shiga, plasmid; 1.8A {Escherichia coli} Length = 347	Back alignment and structure

>1dbi_A AK.1 serine protease; hydrolase; 1.80A {Bacillus SP} SCOP: c.41.1.1 Length = 280	Back alignment and structure

>1dbi_A AK.1 serine protease; hydrolase; 1.80A {Bacillus SP} SCOP: c.41.1.1 Length = 280	Back alignment and structure

>1dbi_A AK.1 serine protease; hydrolase; 1.80A {Bacillus SP} SCOP: c.41.1.1 Length = 280	Back alignment and structure

>2x8j_A Intracellular subtilisin protease; hydrolase, serine protease, intracellular proteinase regulat; HET: CSX 1PE; 1.56A {Bacillus clausii} PDB: 2wv7_A 2wwt_A 2xrm_A* Length = 327	Back alignment and structure

>2x8j_A Intracellular subtilisin protease; hydrolase, serine protease, intracellular proteinase regulat; HET: CSX 1PE; 1.56A {Bacillus clausii} PDB: 2wv7_A 2wwt_A 2xrm_A* Length = 327	Back alignment and structure

>2x8j_A Intracellular subtilisin protease; hydrolase, serine protease, intracellular proteinase regulat; HET: CSX 1PE; 1.56A {Bacillus clausii} PDB: 2wv7_A 2wwt_A 2xrm_A* Length = 327	Back alignment and structure

>3afg_A Subtilisin-like serine protease; propeptide, thermococcus kodakaraensis, hydrolas protease; 2.00A {Thermococcus kodakarensis} Length = 539	Back alignment and structure

>3afg_A Subtilisin-like serine protease; propeptide, thermococcus kodakaraensis, hydrolas protease; 2.00A {Thermococcus kodakarensis} Length = 539	Back alignment and structure

>3afg_A Subtilisin-like serine protease; propeptide, thermococcus kodakaraensis, hydrolas protease; 2.00A {Thermococcus kodakarensis} Length = 539	Back alignment and structure

>1to2_E Subtilisin BPN'; serine protease, hydrolase; HET: CIT 15P; 1.30A {Bacillus amyloliquefaciens} SCOP: c.41.1.1 PDB: 1tm1_E* 1tm3_E* 1tm4_E* 1lw6_E* 1tm7_E* 1tmg_E* 1to1_E* 1tm5_E* 1y1k_E* 1y33_E* 1y34_E* 1y3b_E* 1y3c_E* 1y3d_E* 1y3f_E* 1y48_E* 1y4a_E* 1y4d_E 1sup_A* 1sib_E ... Length = 281	Back alignment and structure

>1to2_E Subtilisin BPN'; serine protease, hydrolase; HET: CIT 15P; 1.30A {Bacillus amyloliquefaciens} SCOP: c.41.1.1 PDB: 1tm1_E* 1tm3_E* 1tm4_E* 1lw6_E* 1tm7_E* 1tmg_E* 1to1_E* 1tm5_E* 1y1k_E* 1y33_E* 1y34_E* 1y3b_E* 1y3c_E* 1y3d_E* 1y3f_E* 1y48_E* 1y4a_E* 1y4d_E 1sup_A* 1sib_E ... Length = 281	Back alignment and structure

>1to2_E Subtilisin BPN'; serine protease, hydrolase; HET: CIT 15P; 1.30A {Bacillus amyloliquefaciens} SCOP: c.41.1.1 PDB: 1tm1_E* 1tm3_E* 1tm4_E* 1lw6_E* 1tm7_E* 1tmg_E* 1to1_E* 1tm5_E* 1y1k_E* 1y33_E* 1y34_E* 1y3b_E* 1y3c_E* 1y3d_E* 1y3f_E* 1y48_E* 1y4a_E* 1y4d_E 1sup_A* 1sib_E ... Length = 281	Back alignment and structure

>1gci_A Subtilisin; hydrolase, serine protease; 0.78A {Bacillus lentus} SCOP: c.41.1.1 PDB: 1jea_A 1ndq_A 1svn_A 1tk2_A* 3bx1_A 1ah2_A 1iav_A* 1c9m_A* 1wsd_A 1mpt_A 1ndu_A 1c9j_A 1q5p_A* 1st3_A 1c9n_A* Length = 269	Back alignment and structure

>1gci_A Subtilisin; hydrolase, serine protease; 0.78A {Bacillus lentus} SCOP: c.41.1.1 PDB: 1jea_A 1ndq_A 1svn_A 1tk2_A* 3bx1_A 1ah2_A 1iav_A* 1c9m_A* 1wsd_A 1mpt_A 1ndu_A 1c9j_A 1q5p_A* 1st3_A 1c9n_A* Length = 269	Back alignment and structure

>1gci_A Subtilisin; hydrolase, serine protease; 0.78A {Bacillus lentus} SCOP: c.41.1.1 PDB: 1jea_A 1ndq_A 1svn_A 1tk2_A* 3bx1_A 1ah2_A 1iav_A* 1c9m_A* 1wsd_A 1mpt_A 1ndu_A 1c9j_A 1q5p_A* 1st3_A 1c9n_A* Length = 269	Back alignment and structure

>1r0r_E Subtilisin carlsberg; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Bacillus licheniformis} SCOP: c.41.1.1 PDB: 1af4_A* 1be8_A* 1bfk_A 1bfu_A 1be6_A 1oyv_A 1cse_E 1sbc_A 1sca_A 1scb_A 1scd_A 2sec_E 2wuv_A 2wuw_E 1yu6_A 1scn_E* 1c3l_A 1avt_A* 1av7_A* 1sel_A ... Length = 274	Back alignment and structure

>1r0r_E Subtilisin carlsberg; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Bacillus licheniformis} SCOP: c.41.1.1 PDB: 1af4_A* 1be8_A* 1bfk_A 1bfu_A 1be6_A 1oyv_A 1cse_E 1sbc_A 1sca_A 1scb_A 1scd_A 2sec_E 2wuv_A 2wuw_E 1yu6_A 1scn_E* 1c3l_A 1avt_A* 1av7_A* 1sel_A ... Length = 274	Back alignment and structure

>1r0r_E Subtilisin carlsberg; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Bacillus licheniformis} SCOP: c.41.1.1 PDB: 1af4_A* 1be8_A* 1bfk_A 1bfu_A 1be6_A 1oyv_A 1cse_E 1sbc_A 1sca_A 1scb_A 1scd_A 2sec_E 2wuv_A 2wuw_E 1yu6_A 1scn_E* 1c3l_A 1avt_A* 1av7_A* 1sel_A ... Length = 274	Back alignment and structure

>4aks_A PATG, thiazoline oxidase/subtilisin-like protease; hydrolase, patellamide; 2.19A {Prochloron didemni} PDB: 4akt_A Length = 360	Back alignment and structure

>4aks_A PATG, thiazoline oxidase/subtilisin-like protease; hydrolase, patellamide; 2.19A {Prochloron didemni} PDB: 4akt_A Length = 360	Back alignment and structure

>3lpc_A APRB2; protease, subtilase, virulence factor, hydrolase; 1.70A {Dichelobacter nodosus} PDB: 3lpa_A 3lpd_A 3ti9_A 3ti7_A Length = 340	Back alignment and structure

>1y9z_A Alkaline serine protease; subtilisin-like alpha/beta domain, insert beta barrel domain hydrolase; HET: PMS; 1.40A {Pseudoalteromonas SP} PDB: 1v6c_A* 1wvm_A* Length = 441	Back alignment and structure

>1y9z_A Alkaline serine protease; subtilisin-like alpha/beta domain, insert beta barrel domain hydrolase; HET: PMS; 1.40A {Pseudoalteromonas SP} PDB: 1v6c_A* 1wvm_A* Length = 441	Back alignment and structure

>1y9z_A Alkaline serine protease; subtilisin-like alpha/beta domain, insert beta barrel domain hydrolase; HET: PMS; 1.40A {Pseudoalteromonas SP} PDB: 1v6c_A* 1wvm_A* Length = 441	Back alignment and structure

>1r6v_A Subtilisin-like serine protease; sandwich domain, propeptide, hydrolase; 1.70A {Fervidobacterium pennivorans} SCOP: c.41.1.1 Length = 671	Back alignment and structure

>1r6v_A Subtilisin-like serine protease; sandwich domain, propeptide, hydrolase; 1.70A {Fervidobacterium pennivorans} SCOP: c.41.1.1 Length = 671	Back alignment and structure

>2ixt_A 36KDA protease; serine protease, sphericase, subtilisin like protease, hydrolase; 0.8A {Bacillus sphaericus} SCOP: c.41.1.1 PDB: 3d43_A 1ea7_A* 2gko_A* Length = 310	Back alignment and structure

>2ixt_A 36KDA protease; serine protease, sphericase, subtilisin like protease, hydrolase; 0.8A {Bacillus sphaericus} SCOP: c.41.1.1 PDB: 3d43_A 1ea7_A* 2gko_A* Length = 310	Back alignment and structure

>2ixt_A 36KDA protease; serine protease, sphericase, subtilisin like protease, hydrolase; 0.8A {Bacillus sphaericus} SCOP: c.41.1.1 PDB: 3d43_A 1ea7_A* 2gko_A* Length = 310	Back alignment and structure

>2z30_A TK-subtilisin; thermococcus kodakaraensis, hydrolase; 1.65A {Thermococcus kodakarensis} PDB: 3a3o_A 3a3n_A 2zrq_A 2z57_A 2z56_A 2z58_A 3a3p_A 2z2x_A* 2z2y_A Length = 320	Back alignment and structure

>2z30_A TK-subtilisin; thermococcus kodakaraensis, hydrolase; 1.65A {Thermococcus kodakarensis} PDB: 3a3o_A 3a3n_A 2zrq_A 2z57_A 2z56_A 2z58_A 3a3p_A 2z2x_A* 2z2y_A Length = 320	Back alignment and structure

>2z2z_A TK-subtilisin precursor; thermococcus kodakaraensis, hydrolase; 1.87A {Thermococcus kodakarensis} PDB: 2e1p_A 2zwp_A 2zwo_A Length = 395	Back alignment and structure

>2z2z_A TK-subtilisin precursor; thermococcus kodakaraensis, hydrolase; 1.87A {Thermococcus kodakarensis} PDB: 2e1p_A 2zwp_A 2zwo_A Length = 395	Back alignment and structure

>1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* Length = 926	Back alignment and structure

>2b6n_A Proteinase K; S binding, substrate specificity, proteinase K, subtilase, psychrotrophic, psychrophilic, hydrolase; 1.80A {Serratia SP} Length = 278	Back alignment and structure

>2b6n_A Proteinase K; S binding, substrate specificity, proteinase K, subtilase, psychrotrophic, psychrophilic, hydrolase; 1.80A {Serratia SP} Length = 278	Back alignment and structure

>2b6n_A Proteinase K; S binding, substrate specificity, proteinase K, subtilase, psychrotrophic, psychrophilic, hydrolase; 1.80A {Serratia SP} Length = 278	Back alignment and structure

>2pwa_A Proteinase K; structure, alanine boronic acid, hydrolase; 0.83A {Engyodontium album} SCOP: c.41.1.1 PDB: 1p7v_A 1p7w_A 2dqk_A 2duj_A 2g4v_A 2hd4_A 2hpz_A 2id8_A 2pq2_A 1ic6_A 2pwb_A* 2pyz_A* 2v8b_A 3aj8_A 3aj9_A 3dyb_A* 3gt3_A* 3gt4_A* 3l1k_A 3osz_A ... Length = 279	Back alignment and structure

>2pwa_A Proteinase K; structure, alanine boronic acid, hydrolase; 0.83A {Engyodontium album} SCOP: c.41.1.1 PDB: 1p7v_A 1p7w_A 2dqk_A 2duj_A 2g4v_A 2hd4_A 2hpz_A 2id8_A 2pq2_A 1ic6_A 2pwb_A* 2pyz_A* 2v8b_A 3aj8_A 3aj9_A 3dyb_A* 3gt3_A* 3gt4_A* 3l1k_A 3osz_A ... Length = 279	Back alignment and structure

>2pwa_A Proteinase K; structure, alanine boronic acid, hydrolase; 0.83A {Engyodontium album} SCOP: c.41.1.1 PDB: 1p7v_A 1p7w_A 2dqk_A 2duj_A 2g4v_A 2hd4_A 2hpz_A 2id8_A 2pq2_A 1ic6_A 2pwb_A* 2pyz_A* 2v8b_A 3aj8_A 3aj9_A 3dyb_A* 3gt3_A* 3gt4_A* 3l1k_A 3osz_A ... Length = 279	Back alignment and structure

>1sh7_A Extracellular subtilisin-like serine proteinase; cold adaptation, psychrotrophic, subtilisin-like proteinase, depentent, hydrolase; HET: PMS; 1.84A {Vibrio SP} PDB: 1s2n_A* Length = 284	Back alignment and structure

>1sh7_A Extracellular subtilisin-like serine proteinase; cold adaptation, psychrotrophic, subtilisin-like proteinase, depentent, hydrolase; HET: PMS; 1.84A {Vibrio SP} PDB: 1s2n_A* Length = 284	Back alignment and structure

>1sh7_A Extracellular subtilisin-like serine proteinase; cold adaptation, psychrotrophic, subtilisin-like proteinase, depentent, hydrolase; HET: PMS; 1.84A {Vibrio SP} PDB: 1s2n_A* Length = 284	Back alignment and structure

>2qtw_B Proprotein convertase subtilisin/kexin type 9; coronary heart disease, hypercholest low density lipoprotein receptor, autocatalytic cleavage; HET: NAG; 1.90A {Homo sapiens} PDB: 3m0c_B 3bps_A 3gcw_A 3gcx_A 3p5b_A 3p5c_A 2pmw_B 3h42_B 2w2n_A 2w2m_A 2w2p_A 2w2q_A 2xtj_A 2w2o_A Length = 546	Back alignment and structure

>2qtw_B Proprotein convertase subtilisin/kexin type 9; coronary heart disease, hypercholest low density lipoprotein receptor, autocatalytic cleavage; HET: NAG; 1.90A {Homo sapiens} PDB: 3m0c_B 3bps_A 3gcw_A 3gcx_A 3p5b_A 3p5c_A 2pmw_B 3h42_B 2w2n_A 2w2m_A 2w2p_A 2w2q_A 2xtj_A 2w2o_A Length = 546	Back alignment and structure

>2qtw_B Proprotein convertase subtilisin/kexin type 9; coronary heart disease, hypercholest low density lipoprotein receptor, autocatalytic cleavage; HET: NAG; 1.90A {Homo sapiens} PDB: 3m0c_B 3bps_A 3gcw_A 3gcx_A 3p5b_A 3p5c_A 2pmw_B 3h42_B 2w2n_A 2w2m_A 2w2p_A 2w2q_A 2xtj_A 2w2o_A Length = 546	Back alignment and structure

>3f7m_A Alkaline serine protease VER112; verticillium psalliotae, cuticle- degrading protease, nematodes, hydrolase, secreted, zymogen; 1.60A {Lecanicillium psalliotae} PDB: 3f7o_A Length = 279	Back alignment and structure

>3f7m_A Alkaline serine protease VER112; verticillium psalliotae, cuticle- degrading protease, nematodes, hydrolase, secreted, zymogen; 1.60A {Lecanicillium psalliotae} PDB: 3f7o_A Length = 279	Back alignment and structure

>3f7m_A Alkaline serine protease VER112; verticillium psalliotae, cuticle- degrading protease, nematodes, hydrolase, secreted, zymogen; 1.60A {Lecanicillium psalliotae} PDB: 3f7o_A Length = 279	Back alignment and structure

>4dzt_A Aqualysin-1, aqualysin-I; serine protease, calcium binding, inhibitor, hydrolase-hydro inhibitor complex; HET: PMS; 1.95A {Thermus aquaticus} Length = 276	Back alignment and structure

>4dzt_A Aqualysin-1, aqualysin-I; serine protease, calcium binding, inhibitor, hydrolase-hydro inhibitor complex; HET: PMS; 1.95A {Thermus aquaticus} Length = 276	Back alignment and structure

>4dzt_A Aqualysin-1, aqualysin-I; serine protease, calcium binding, inhibitor, hydrolase-hydro inhibitor complex; HET: PMS; 1.95A {Thermus aquaticus} Length = 276	Back alignment and structure

>2p4e_P Proprotein convertase subtilisin/kexin type 9; protease, LDL receptor, LDL, endocytosis, hydrol; 1.98A {Homo sapiens} Length = 692	Back alignment and structure

>2p4e_P Proprotein convertase subtilisin/kexin type 9; protease, LDL receptor, LDL, endocytosis, hydrol; 1.98A {Homo sapiens} Length = 692	Back alignment and structure

>2p4e_P Proprotein convertase subtilisin/kexin type 9; protease, LDL receptor, LDL, endocytosis, hydrol; 1.98A {Homo sapiens} Length = 692	Back alignment and structure

>3vta_A Cucumisin; subtilisin-like fold, serine protease, hydrolase; HET: DFP NAG FUC BMA MAN; 2.75A {Cucumis melo} Length = 621	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		624
1r0r_E		274	Subtilisin carlsberg; high resolution, serine prot	99.82
1gci_A		269	Subtilisin; hydrolase, serine protease; 0.78A {Bac	99.8
1to2_E		281	Subtilisin BPN'; serine protease, hydrolase; HET:	99.8
3hjr_A		600	Extracellular serine protease; kexin, hydrolase; 1	99.79
4h6w_A		306	N-terminal cyanobactin protease; hydrolase; 2.45A	99.79
1dbi_A		280	AK.1 serine protease; hydrolase; 1.80A {Bacillus S	99.78
3zxy_A		282	Subtilisin-like protein; hydrolase; 1.58A {Prochlo	99.77
2id4_A		503	Kexin; KEX2, kexin, furin, proprotein, prohormone,	99.77
2x8j_A		327	Intracellular subtilisin protease; hydrolase, seri	99.77
1thm_A		279	Thermitase; hydrolase(serine protease); 1.37A {The	99.76
1p8j_A		471	Furin precursor; prohormone convertase, SPC1, PACE	99.76
3lpc_A		340	APRB2; protease, subtilase, virulence factor, hydr	99.75
3vta_A		621	Cucumisin; subtilisin-like fold, serine protease,	99.75
4h6x_A		357	Thiazoline oxidase/subtilisin-like protease; hydro	99.75
3afg_A		539	Subtilisin-like serine protease; propeptide, therm	99.74
2ixt_A		310	36KDA protease; serine protease, sphericase, subti	99.72
2z30_A		320	TK-subtilisin; thermococcus kodakaraensis, hydrola	99.72
3i6s_A		649	Subtilisin-like protease; PA-domain, FN3-domain, h	99.72
4dzt_A		276	Aqualysin-1, aqualysin-I; serine protease, calcium	99.71
2z2z_A		395	TK-subtilisin precursor; thermococcus kodakaraensi	99.7
1sh7_A		284	Extracellular subtilisin-like serine proteinase; c	99.68
2b6n_A		278	Proteinase K; S binding, substrate specificity, pr	99.67
1y9z_A		441	Alkaline serine protease; subtilisin-like alpha/be	99.67
1wmd_A		434	Protease; alpha-beta hydrolase fold, jelly-roll be	99.67
2oxa_A		600	Extracellular serine protease; kexin, hydrolase; 1	99.67
1r6v_A		671	Subtilisin-like serine protease; sandwich domain,	99.64
1xf1_A		926	C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St	99.64
2pwa_A		279	Proteinase K; structure, alanine boronic acid, hyd	99.64
3t41_A		471	Epidermin leader peptide processing serine protea;	99.64
3f7m_A		279	Alkaline serine protease VER112; verticillium psal	99.63
2iy9_A		347	SUBA; toxin, shiga, plasmid; 1.8A {Escherichia col	99.63
2qtw_B		546	Proprotein convertase subtilisin/kexin type 9; cor	99.55
2p4e_P		692	Proprotein convertase subtilisin/kexin type 9; pro	99.51
3lxu_X		1354	Tripeptidyl-peptidase 2; spindle complex, aminopep	99.38
4h6w_A		306	N-terminal cyanobactin protease; hydrolase; 2.45A	99.32
1y9z_A		441	Alkaline serine protease; subtilisin-like alpha/be	99.26
4h6x_A		357	Thiazoline oxidase/subtilisin-like protease; hydro	99.23
3vta_A		621	Cucumisin; subtilisin-like fold, serine protease,	99.23
3zxy_A		282	Subtilisin-like protein; hydrolase; 1.58A {Prochlo	99.23
3lpc_A		340	APRB2; protease, subtilase, virulence factor, hydr	99.21
2iy9_A		347	SUBA; toxin, shiga, plasmid; 1.8A {Escherichia col	99.16
3i6s_A		649	Subtilisin-like protease; PA-domain, FN3-domain, h	99.16
1gci_A		269	Subtilisin; hydrolase, serine protease; 0.78A {Bac	99.14
1to2_E		281	Subtilisin BPN'; serine protease, hydrolase; HET:	99.14
3t41_A		471	Epidermin leader peptide processing serine protea;	99.14
1p8j_A		471	Furin precursor; prohormone convertase, SPC1, PACE	99.13
1r0r_E		274	Subtilisin carlsberg; high resolution, serine prot	99.13
2x8j_A		327	Intracellular subtilisin protease; hydrolase, seri	99.13
3hjr_A		600	Extracellular serine protease; kexin, hydrolase; 1	99.12
2oxa_A		600	Extracellular serine protease; kexin, hydrolase; 1	99.1
2id4_A		503	Kexin; KEX2, kexin, furin, proprotein, prohormone,	99.09
3afg_A		539	Subtilisin-like serine protease; propeptide, therm	99.09
1dbi_A		280	AK.1 serine protease; hydrolase; 1.80A {Bacillus S	99.08
1thm_A		279	Thermitase; hydrolase(serine protease); 1.37A {The	99.07
1xf1_A		926	C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St	99.06
3lxu_X		1354	Tripeptidyl-peptidase 2; spindle complex, aminopep	99.04
2z30_A		320	TK-subtilisin; thermococcus kodakaraensis, hydrola	99.02
2z2z_A		395	TK-subtilisin precursor; thermococcus kodakaraensi	99.02
1r6v_A		671	Subtilisin-like serine protease; sandwich domain,	98.94
1wmd_A		434	Protease; alpha-beta hydrolase fold, jelly-roll be	98.94
2ixt_A		310	36KDA protease; serine protease, sphericase, subti	98.9
4dzt_A		276	Aqualysin-1, aqualysin-I; serine protease, calcium	98.55
2pwa_A		279	Proteinase K; structure, alanine boronic acid, hyd	98.52
1sh7_A		284	Extracellular subtilisin-like serine proteinase; c	98.5
2b6n_A		278	Proteinase K; S binding, substrate specificity, pr	98.47
3f7m_A		279	Alkaline serine protease VER112; verticillium psal	98.31
2qtw_B		546	Proprotein convertase subtilisin/kexin type 9; cor	98.28
2p4e_P		692	Proprotein convertase subtilisin/kexin type 9; pro	98.14
1ga6_A		372	Serine-carboxyl proteinase; serine-carboxyl protei	97.31
1t1e_A		552	Kumamolisin; proenzyme, prosubtilase, activation m	96.84
1ga6_A		372	Serine-carboxyl proteinase; serine-carboxyl protei	95.03
1t1e_A		552	Kumamolisin; proenzyme, prosubtilase, activation m	94.82
3rht_A		259	(gatase1)-like protein; structural genomics, PSI-b	81.85

>1r0r_E Subtilisin carlsberg; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Bacillus licheniformis} SCOP: c.41.1.1 PDB: 1af4_A* 1be8_A* 1bfk_A 1bfu_A 1be6_A 1oyv_A 1cse_E 1sbc_A 1sca_A 1scb_A 1scd_A 2sec_E 2wuv_A 2wuw_E 1yu6_A 1scn_E* 1c3l_A 1avt_A* 1av7_A* 1sel_A ...	Back alignment and structure

Probab=99.82  E-value=2.1e-21  Score=197.06  Aligned_cols=62  Identities=32%  Similarity=0.381  Sum_probs=56.1

Q ss_pred             eeccCcccccchhHHHHHHHHHhcCCCCCCCCCChHhhhhhhhcccccCCCCCCcccceeeeccccce
Q psy1075         140 CRTLSGTSVASPVVAGVVALLASGLKHRPAGHINPASMKQGPVSNITRPIGSRVPFCAGELNVNPQSK  207 (624)
Q Consensus       140 ~~~lSGTSmAAP~VAGaaALLlS~~P~~~~~~lspaqVkq~L~~tA~~l~~~~~~~G~G~lnl~~a~~  207 (624)
                      |..++|||||||+|||++||++|++|     .+++++||++|+++|++++ ....+|+|++|+.+|++
T Consensus       213 ~~~~sGTS~AaP~vaG~aAll~~~~p-----~lt~~~v~~~L~~tA~~~g-~~~~~G~G~~~~~~A~~  274 (274)
T 1r0r_E          213 YATLNGTSMASPHVAGAAALILSKHP-----NLSASQVRNRLSSTATYLG-SSFYYGKGLINVEAAAQ  274 (274)
T ss_dssp             EEEECSHHHHHHHHHHHHHHHHHHST-----TCCHHHHHHHHHHTCBCCS-CHHHHTTCBCCHHHHTC
T ss_pred             EEEeccHHHHHHHHHHHHHHHHHHCC-----CCCHHHHHHHHHHhCcccC-CCCCcccCccCHHHHhC
Confidence            66789999999999999999999999     7899999999999999985 45678999999998863

PyMOL of 1r0r

>1gci_A Subtilisin; hydrolase, serine protease; 0.78A {Bacillus lentus} SCOP: c.41.1.1 PDB: 1jea_A 1ndq_A 1svn_A 1tk2_A* 3bx1_A 1ah2_A 1iav_A* 1c9m_A* 1wsd_A 1mpt_A 1ndu_A 1c9j_A 1q5p_A* 1st3_A 1c9n_A*	Back alignment and structure

>1to2_E Subtilisin BPN'; serine protease, hydrolase; HET: CIT 15P; 1.30A {Bacillus amyloliquefaciens} SCOP: c.41.1.1 PDB: 1tm1_E* 1tm3_E* 1tm4_E* 1lw6_E* 1tm7_E* 1tmg_E* 1to1_E* 1tm5_E* 1y1k_E* 1y33_E* 1y34_E* 1y3b_E* 1y3c_E* 1y3d_E* 1y3f_E* 1y48_E* 1y4a_E* 1y4d_E 1sup_A* 1sib_E ...	Back alignment and structure

>3hjr_A Extracellular serine protease; kexin, hydrolase; 1.65A {Aeromonas sobria}	Back alignment and structure

>4h6w_A N-terminal cyanobactin protease; hydrolase; 2.45A {Planktothrix agardhii nies-596}	Back alignment and structure

>1dbi_A AK.1 serine protease; hydrolase; 1.80A {Bacillus SP} SCOP: c.41.1.1	Back alignment and structure

>3zxy_A Subtilisin-like protein; hydrolase; 1.58A {Prochloron didemni} PDB: 3zxx_A	Back alignment and structure

>2id4_A Kexin; KEX2, kexin, furin, proprotein, prohormone, convertase, SUBT like protease, serine protease; HET: NDG; 1.90A {Saccharomyces cerevisiae} SCOP: b.18.1.20 c.41.1.1 PDB: 1r64_A* 1ot5_A*	Back alignment and structure

>2x8j_A Intracellular subtilisin protease; hydrolase, serine protease, intracellular proteinase regulat; HET: CSX 1PE; 1.56A {Bacillus clausii} PDB: 2wv7_A 2wwt_A 2xrm_A*	Back alignment and structure

>1thm_A Thermitase; hydrolase(serine protease); 1.37A {Thermoactinomyces vulgaris} SCOP: c.41.1.1 PDB: 2tec_E 1tec_E 3tec_E	Back alignment and structure

>1p8j_A Furin precursor; prohormone convertase, SPC1, PACE, P-domain; HET: DKA AR7 NAG FUL BMA MAN GAL FUC; 2.60A {Mus musculus} SCOP: b.18.1.20 c.41.1.1	Back alignment and structure

>3lpc_A APRB2; protease, subtilase, virulence factor, hydrolase; 1.70A {Dichelobacter nodosus} PDB: 3lpa_A 3lpd_A 3ti9_A 3ti7_A	Back alignment and structure

>3vta_A Cucumisin; subtilisin-like fold, serine protease, hydrolase; HET: DFP NAG FUC BMA MAN; 2.75A {Cucumis melo}	Back alignment and structure

>4h6x_A Thiazoline oxidase/subtilisin-like protease; hydrolase; 2.00A {Prochloron didemni} PDB: 4aks_A 4akt_A	Back alignment and structure

>3afg_A Subtilisin-like serine protease; propeptide, thermococcus kodakaraensis, hydrolas protease; 2.00A {Thermococcus kodakarensis}	Back alignment and structure

>2ixt_A 36KDA protease; serine protease, sphericase, subtilisin like protease, hydrolase; 0.8A {Bacillus sphaericus} SCOP: c.41.1.1 PDB: 3d43_A 1ea7_A* 2gko_A*	Back alignment and structure

>2z30_A TK-subtilisin; thermococcus kodakaraensis, hydrolase; 1.65A {Thermococcus kodakarensis} PDB: 3a3o_A 3a3n_A 2zrq_A 2z57_A 2z56_A 2z58_A 3a3p_A 2z2x_A* 2z2y_A	Back alignment and structure

>3i6s_A Subtilisin-like protease; PA-domain, FN3-domain, hydrolase; HET: NAG FUC; 2.50A {Solanum lycopersicum} PDB: 3i74_A*	Back alignment and structure

>4dzt_A Aqualysin-1, aqualysin-I; serine protease, calcium binding, inhibitor, hydrolase-hydro inhibitor complex; HET: PMS; 1.95A {Thermus aquaticus}	Back alignment and structure

>2z2z_A TK-subtilisin precursor; thermococcus kodakaraensis, hydrolase; 1.87A {Thermococcus kodakarensis} PDB: 2e1p_A 2zwp_A 2zwo_A	Back alignment and structure

>1sh7_A Extracellular subtilisin-like serine proteinase; cold adaptation, psychrotrophic, subtilisin-like proteinase, depentent, hydrolase; HET: PMS; 1.84A {Vibrio SP} PDB: 1s2n_A*	Back alignment and structure

>2b6n_A Proteinase K; S binding, substrate specificity, proteinase K, subtilase, psychrotrophic, psychrophilic, hydrolase; 1.80A {Serratia SP}	Back alignment and structure

>1y9z_A Alkaline serine protease; subtilisin-like alpha/beta domain, insert beta barrel domain hydrolase; HET: PMS; 1.40A {Pseudoalteromonas SP} PDB: 1v6c_A* 1wvm_A*	Back alignment and structure

>1wmd_A Protease; alpha-beta hydrolase fold, jelly-roll beta-barrel, hydrolase; 1.30A {Bacillus SP} SCOP: b.18.1.20 c.41.1.1 PDB: 1wme_A 1wmf_A	Back alignment and structure

>1r6v_A Subtilisin-like serine protease; sandwich domain, propeptide, hydrolase; 1.70A {Fervidobacterium pennivorans} SCOP: c.41.1.1	Back alignment and structure

>1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A*	Back alignment and structure

>2pwa_A Proteinase K; structure, alanine boronic acid, hydrolase; 0.83A {Engyodontium album} SCOP: c.41.1.1 PDB: 1p7v_A 1p7w_A 2dqk_A 2duj_A 2g4v_A 2hd4_A 2hpz_A 2id8_A 2pq2_A 1ic6_A 2pwb_A* 2pyz_A* 2v8b_A 3aj8_A 3aj9_A 3dyb_A* 3gt3_A* 3gt4_A* 3l1k_A 3osz_A ...	Back alignment and structure

>3t41_A Epidermin leader peptide processing serine protea; structural genomics, center for structural genomics of infec diseases, csgid; 1.95A {Staphylococcus aureus} PDB: 3qfh_A	Back alignment and structure

>3f7m_A Alkaline serine protease VER112; verticillium psalliotae, cuticle- degrading protease, nematodes, hydrolase, secreted, zymogen; 1.60A {Lecanicillium psalliotae} SCOP: c.41.1.1 PDB: 3f7o_A	Back alignment and structure

>2iy9_A SUBA; toxin, shiga, plasmid; 1.8A {Escherichia coli}	Back alignment and structure

>2qtw_B Proprotein convertase subtilisin/kexin type 9; coronary heart disease, hypercholest low density lipoprotein receptor, autocatalytic cleavage; HET: NAG; 1.90A {Homo sapiens} PDB: 3m0c_B 3bps_A 3gcw_A 3gcx_A 3p5b_A 3p5c_A 2pmw_B 3h42_B 2w2n_A 2w2m_A 2w2p_A 2w2q_A 2xtj_A 2w2o_A	Back alignment and structure

>2p4e_P Proprotein convertase subtilisin/kexin type 9; protease, LDL receptor, LDL, endocytosis, hydrol; 1.98A {Homo sapiens}	Back alignment and structure

>3lxu_X Tripeptidyl-peptidase 2; spindle complex, aminopeptidase, hydrolase, phosphoprotein, protease; 3.14A {Drosophila melanogaster}	Back alignment and structure

>4h6w_A N-terminal cyanobactin protease; hydrolase; 2.45A {Planktothrix agardhii nies-596}	Back alignment and structure

>1y9z_A Alkaline serine protease; subtilisin-like alpha/beta domain, insert beta barrel domain hydrolase; HET: PMS; 1.40A {Pseudoalteromonas SP} PDB: 1v6c_A* 1wvm_A*	Back alignment and structure

>4h6x_A Thiazoline oxidase/subtilisin-like protease; hydrolase; 2.00A {Prochloron didemni} PDB: 4aks_A 4akt_A	Back alignment and structure

>3vta_A Cucumisin; subtilisin-like fold, serine protease, hydrolase; HET: DFP NAG FUC BMA MAN; 2.75A {Cucumis melo}	Back alignment and structure

>3zxy_A Subtilisin-like protein; hydrolase; 1.58A {Prochloron didemni} PDB: 3zxx_A	Back alignment and structure

>3lpc_A APRB2; protease, subtilase, virulence factor, hydrolase; 1.70A {Dichelobacter nodosus} PDB: 3lpa_A 3lpd_A 3ti9_A 3ti7_A	Back alignment and structure

>2iy9_A SUBA; toxin, shiga, plasmid; 1.8A {Escherichia coli}	Back alignment and structure

>3i6s_A Subtilisin-like protease; PA-domain, FN3-domain, hydrolase; HET: NAG FUC; 2.50A {Solanum lycopersicum} PDB: 3i74_A*	Back alignment and structure

>1gci_A Subtilisin; hydrolase, serine protease; 0.78A {Bacillus lentus} SCOP: c.41.1.1 PDB: 1jea_A 1ndq_A 1svn_A 1tk2_A* 3bx1_A 1ah2_A 1iav_A* 1c9m_A* 1wsd_A 1mpt_A 1ndu_A 1c9j_A 1q5p_A* 1st3_A 1c9n_A*	Back alignment and structure

>1to2_E Subtilisin BPN'; serine protease, hydrolase; HET: CIT 15P; 1.30A {Bacillus amyloliquefaciens} SCOP: c.41.1.1 PDB: 1tm1_E* 1tm3_E* 1tm4_E* 1lw6_E* 1tm7_E* 1tmg_E* 1to1_E* 1tm5_E* 1y1k_E* 1y33_E* 1y34_E* 1y3b_E* 1y3c_E* 1y3d_E* 1y3f_E* 1y48_E* 1y4a_E* 1y4d_E 1sup_A* 1sib_E ...	Back alignment and structure

>3t41_A Epidermin leader peptide processing serine protea; structural genomics, center for structural genomics of infec diseases, csgid; 1.95A {Staphylococcus aureus} PDB: 3qfh_A	Back alignment and structure

>1p8j_A Furin precursor; prohormone convertase, SPC1, PACE, P-domain; HET: DKA AR7 NAG FUL BMA MAN GAL FUC; 2.60A {Mus musculus} SCOP: b.18.1.20 c.41.1.1	Back alignment and structure

>1r0r_E Subtilisin carlsberg; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Bacillus licheniformis} SCOP: c.41.1.1 PDB: 1af4_A* 1be8_A* 1bfk_A 1bfu_A 1be6_A 1oyv_A 1cse_E 1sbc_A 1sca_A 1scb_A 1scd_A 2sec_E 2wuv_A 2wuw_E 1yu6_A 1scn_E* 1c3l_A 1avt_A* 1av7_A* 1sel_A ...	Back alignment and structure

>2x8j_A Intracellular subtilisin protease; hydrolase, serine protease, intracellular proteinase regulat; HET: CSX 1PE; 1.56A {Bacillus clausii} PDB: 2wv7_A 2wwt_A 2xrm_A*	Back alignment and structure

>3hjr_A Extracellular serine protease; kexin, hydrolase; 1.65A {Aeromonas sobria}	Back alignment and structure

>2id4_A Kexin; KEX2, kexin, furin, proprotein, prohormone, convertase, SUBT like protease, serine protease; HET: NDG; 1.90A {Saccharomyces cerevisiae} SCOP: b.18.1.20 c.41.1.1 PDB: 1r64_A* 1ot5_A*	Back alignment and structure

>3afg_A Subtilisin-like serine protease; propeptide, thermococcus kodakaraensis, hydrolas protease; 2.00A {Thermococcus kodakarensis}	Back alignment and structure

>1dbi_A AK.1 serine protease; hydrolase; 1.80A {Bacillus SP} SCOP: c.41.1.1	Back alignment and structure

>1thm_A Thermitase; hydrolase(serine protease); 1.37A {Thermoactinomyces vulgaris} SCOP: c.41.1.1 PDB: 2tec_E 1tec_E 3tec_E	Back alignment and structure

>1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A*	Back alignment and structure

>3lxu_X Tripeptidyl-peptidase 2; spindle complex, aminopeptidase, hydrolase, phosphoprotein, protease; 3.14A {Drosophila melanogaster}	Back alignment and structure

>2z30_A TK-subtilisin; thermococcus kodakaraensis, hydrolase; 1.65A {Thermococcus kodakarensis} PDB: 3a3o_A 3a3n_A 2zrq_A 2z57_A 2z56_A 2z58_A 3a3p_A 2z2x_A* 2z2y_A	Back alignment and structure

>2z2z_A TK-subtilisin precursor; thermococcus kodakaraensis, hydrolase; 1.87A {Thermococcus kodakarensis} PDB: 2e1p_A 2zwp_A 2zwo_A	Back alignment and structure

>1r6v_A Subtilisin-like serine protease; sandwich domain, propeptide, hydrolase; 1.70A {Fervidobacterium pennivorans} SCOP: c.41.1.1	Back alignment and structure

>1wmd_A Protease; alpha-beta hydrolase fold, jelly-roll beta-barrel, hydrolase; 1.30A {Bacillus SP} SCOP: b.18.1.20 c.41.1.1 PDB: 1wme_A 1wmf_A	Back alignment and structure

>2ixt_A 36KDA protease; serine protease, sphericase, subtilisin like protease, hydrolase; 0.8A {Bacillus sphaericus} SCOP: c.41.1.1 PDB: 3d43_A 1ea7_A* 2gko_A*	Back alignment and structure

>4dzt_A Aqualysin-1, aqualysin-I; serine protease, calcium binding, inhibitor, hydrolase-hydro inhibitor complex; HET: PMS; 1.95A {Thermus aquaticus}	Back alignment and structure

>2pwa_A Proteinase K; structure, alanine boronic acid, hydrolase; 0.83A {Engyodontium album} SCOP: c.41.1.1 PDB: 1p7v_A 1p7w_A 2dqk_A 2duj_A 2g4v_A 2hd4_A 2hpz_A 2id8_A 2pq2_A 1ic6_A 2pwb_A* 2pyz_A* 2v8b_A 3aj8_A 3aj9_A 3dyb_A* 3gt3_A* 3gt4_A* 3l1k_A 3osz_A ...	Back alignment and structure

>1sh7_A Extracellular subtilisin-like serine proteinase; cold adaptation, psychrotrophic, subtilisin-like proteinase, depentent, hydrolase; HET: PMS; 1.84A {Vibrio SP} PDB: 1s2n_A*	Back alignment and structure

>2b6n_A Proteinase K; S binding, substrate specificity, proteinase K, subtilase, psychrotrophic, psychrophilic, hydrolase; 1.80A {Serratia SP}	Back alignment and structure

>3f7m_A Alkaline serine protease VER112; verticillium psalliotae, cuticle- degrading protease, nematodes, hydrolase, secreted, zymogen; 1.60A {Lecanicillium psalliotae} SCOP: c.41.1.1 PDB: 3f7o_A	Back alignment and structure

>2qtw_B Proprotein convertase subtilisin/kexin type 9; coronary heart disease, hypercholest low density lipoprotein receptor, autocatalytic cleavage; HET: NAG; 1.90A {Homo sapiens} PDB: 3m0c_B 3bps_A 3gcw_A 3gcx_A 3p5b_A 3p5c_A 2pmw_B 3h42_B 2w2n_A 2w2m_A 2w2p_A 2w2q_A 2xtj_A 2w2o_A	Back alignment and structure

>2p4e_P Proprotein convertase subtilisin/kexin type 9; protease, LDL receptor, LDL, endocytosis, hydrol; 1.98A {Homo sapiens}	Back alignment and structure

>1ga6_A Serine-carboxyl proteinase; serine-carboxyl proteinase, hydrolase-hydrolase inhibitor CO; 1.00A {Pseudomonas SP} SCOP: c.41.1.2 PDB: 1ga4_A* 1ga1_A 1kdv_A* 1kdy_A* 1kdz_A* 1ke1_A* 1ke2_A* 1nlu_A*	Back alignment and structure

>1t1e_A Kumamolisin; proenzyme, prosubtilase, activation mechanism, sedolisin, serine-carboxyl proteinase, hydrolase; 1.18A {Bacillus SP} SCOP: c.41.1.2 d.58.3.2 PDB: 1t1g_A 1t1i_A 1gt9_1 1gtg_1 1gtj_1* 1gtl_1* 1sio_A* 1sn7_A 1zvj_A 1siu_A 1zvk_A	Back alignment and structure

>1ga6_A Serine-carboxyl proteinase; serine-carboxyl proteinase, hydrolase-hydrolase inhibitor CO; 1.00A {Pseudomonas SP} SCOP: c.41.1.2 PDB: 1ga4_A* 1ga1_A 1kdv_A* 1kdy_A* 1kdz_A* 1ke1_A* 1ke2_A* 1nlu_A*	Back alignment and structure

>1t1e_A Kumamolisin; proenzyme, prosubtilase, activation mechanism, sedolisin, serine-carboxyl proteinase, hydrolase; 1.18A {Bacillus SP} SCOP: c.41.1.2 d.58.3.2 PDB: 1t1g_A 1t1i_A 1gt9_1 1gtg_1 1gtj_1* 1gtl_1* 1sio_A* 1sn7_A 1zvj_A 1siu_A 1zvk_A	Back alignment and structure

>3rht_A (gatase1)-like protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.83A {Planctomyces limnophilus}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		624
d1v6ca_		435	c.41.1.1 (A:) Alkaline serine protease Apa1 {Pseud	6e-10
d1v6ca_		435	c.41.1.1 (A:) Alkaline serine protease Apa1 {Pseud	5e-06
d1v6ca_		435	c.41.1.1 (A:) Alkaline serine protease Apa1 {Pseud	0.004
d1wmda2		318	c.41.1.1 (A:1-318) Alkaline serine protease kp-43,	1e-09
d1wmda2		318	c.41.1.1 (A:1-318) Alkaline serine protease kp-43,	3e-07
d1wmda2		318	c.41.1.1 (A:1-318) Alkaline serine protease kp-43,	0.003
d1thma_		279	c.41.1.1 (A:) Thermitase {Thermoactinomyces vulgar	4e-07
d1r6va_		671	c.41.1.1 (A:) Fervidolysin {Fervidobacterium penni	6e-07
d1r6va_		671	c.41.1.1 (A:) Fervidolysin {Fervidobacterium penni	0.003
d1gcia_		269	c.41.1.1 (A:) Subtilisin {Bacillus lentus [TaxId:	7e-07
d1gcia_		269	c.41.1.1 (A:) Subtilisin {Bacillus lentus [TaxId:	8e-04
d1dbia_		280	c.41.1.1 (A:) Thermostable serine protease {Bacill	1e-06
d1dbia_		280	c.41.1.1 (A:) Thermostable serine protease {Bacill	0.004
d1r0re_		274	c.41.1.1 (E:) Subtilisin {Bacillus subtilis, carls	2e-06
d1r0re_		274	c.41.1.1 (E:) Subtilisin {Bacillus subtilis, carls	6e-05
d1to2e_		281	c.41.1.1 (E:) Subtilisin {Bacillus amyloliquefacie	2e-06
d1to2e_		281	c.41.1.1 (E:) Subtilisin {Bacillus amyloliquefacie	3e-05
d1t1ga_		357	c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Bac	4e-05
d2pwaa1		279	c.41.1.1 (A:1-279) Proteinase K {Fungus (Tritirach	8e-04
d2pwaa1		279	c.41.1.1 (A:1-279) Proteinase K {Fungus (Tritirach	0.003
d1p8ja2		334	c.41.1.1 (A:109-442) Furin, N-terminal domain {Mou	0.001
d2ixta1		309	c.41.1.1 (A:1-309) Sphericase {Bacillus sphaericus	0.004

>d1v6ca_ c.41.1.1 (A:) Alkaline serine protease Apa1 {Pseudoalteromonas sp. AS-11 [TaxId: 247492]} Length = 435	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Subtilisin-like
superfamily: Subtilisin-like
family: Subtilases
domain: Alkaline serine protease Apa1
species: Pseudoalteromonas sp. AS-11 [TaxId: 247492]

 Score = 59.3 bits (142), Expect = 6e-10
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 3   TLSGTSVASPVVAGVVALLASGLKHRPAGHINPASMKQGLMASARRLPGVNM-FEQGSGK 61
             +GTS+A+P V+GV  L+ S   + P    + + ++  L A+A  L       + G G 
Sbjct: 364 YYNGTSMATPHVSGVATLVWS---YHP--ECSASQVRAALNATADDLSVAGRDNQTGYGM 418

Query: 62  IDLLRAYQILNS 73
           I+ + A   L+ 
Sbjct: 419 INAVAAKAYLDE 430

PyMOL of d1v6ca_

>d1v6ca_ c.41.1.1 (A:) Alkaline serine protease Apa1 {Pseudoalteromonas sp. AS-11 [TaxId: 247492]} Length = 435	Back information, alignment and structure

>d1v6ca_ c.41.1.1 (A:) Alkaline serine protease Apa1 {Pseudoalteromonas sp. AS-11 [TaxId: 247492]} Length = 435	Back information, alignment and structure

>d1wmda2 c.41.1.1 (A:1-318) Alkaline serine protease kp-43, N-terminal domain {Bacillus sp. KSM-KP43 [TaxId: 109322]} Length = 318	Back information, alignment and structure

>d1wmda2 c.41.1.1 (A:1-318) Alkaline serine protease kp-43, N-terminal domain {Bacillus sp. KSM-KP43 [TaxId: 109322]} Length = 318	Back information, alignment and structure

>d1wmda2 c.41.1.1 (A:1-318) Alkaline serine protease kp-43, N-terminal domain {Bacillus sp. KSM-KP43 [TaxId: 109322]} Length = 318	Back information, alignment and structure

>d1thma_ c.41.1.1 (A:) Thermitase {Thermoactinomyces vulgaris [TaxId: 2026]} Length = 279	Back information, alignment and structure

>d1r6va_ c.41.1.1 (A:) Fervidolysin {Fervidobacterium pennivorans [TaxId: 93466]} Length = 671	Back information, alignment and structure

>d1r6va_ c.41.1.1 (A:) Fervidolysin {Fervidobacterium pennivorans [TaxId: 93466]} Length = 671	Back information, alignment and structure

>d1gcia_ c.41.1.1 (A:) Subtilisin {Bacillus lentus [TaxId: 1467]} Length = 269	Back information, alignment and structure

>d1gcia_ c.41.1.1 (A:) Subtilisin {Bacillus lentus [TaxId: 1467]} Length = 269	Back information, alignment and structure

>d1dbia_ c.41.1.1 (A:) Thermostable serine protease {Bacillus sp., AK.1 [TaxId: 1409]} Length = 280	Back information, alignment and structure

>d1dbia_ c.41.1.1 (A:) Thermostable serine protease {Bacillus sp., AK.1 [TaxId: 1409]} Length = 280	Back information, alignment and structure

>d1r0re_ c.41.1.1 (E:) Subtilisin {Bacillus subtilis, carlsberg [TaxId: 1423]} Length = 274	Back information, alignment and structure

>d1r0re_ c.41.1.1 (E:) Subtilisin {Bacillus subtilis, carlsberg [TaxId: 1423]} Length = 274	Back information, alignment and structure

>d1to2e_ c.41.1.1 (E:) Subtilisin {Bacillus amyloliquefaciens, Novo/BPN' [TaxId: 1390]} Length = 281	Back information, alignment and structure

>d1to2e_ c.41.1.1 (E:) Subtilisin {Bacillus amyloliquefaciens, Novo/BPN' [TaxId: 1390]} Length = 281	Back information, alignment and structure

>d1t1ga_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Bacillus novosp. MN-32, kumamolisin [TaxId: 198803]} Length = 357	Back information, alignment and structure

>d2pwaa1 c.41.1.1 (A:1-279) Proteinase K {Fungus (Tritirachium album), strain limber [TaxId: 37998]} Length = 279	Back information, alignment and structure

>d2pwaa1 c.41.1.1 (A:1-279) Proteinase K {Fungus (Tritirachium album), strain limber [TaxId: 37998]} Length = 279	Back information, alignment and structure

>d1p8ja2 c.41.1.1 (A:109-442) Furin, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 334	Back information, alignment and structure

>d2ixta1 c.41.1.1 (A:1-309) Sphericase {Bacillus sphaericus [TaxId: 1421]} Length = 309	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		624
d1r0re_		274	Subtilisin {Bacillus subtilis, carlsberg [TaxId: 1	99.85
d1gcia_		269	Subtilisin {Bacillus lentus [TaxId: 1467]}	99.82
d1thma_		279	Thermitase {Thermoactinomyces vulgaris [TaxId: 202	99.81
d1wmda2		318	Alkaline serine protease kp-43, N-terminal domain	99.8
d1to2e_		281	Subtilisin {Bacillus amyloliquefaciens, Novo/BPN'	99.8
d1p8ja2		334	Furin, N-terminal domain {Mouse (Mus musculus) [Ta	99.8
d2ixta1		309	Sphericase {Bacillus sphaericus [TaxId: 1421]}	99.8
d1dbia_		280	Thermostable serine protease {Bacillus sp., AK.1 [	99.79
d2id4a2		339	Kexin, N-terminal domain {Baker's yeast (Saccharom	99.77
d1v6ca_		435	Alkaline serine protease Apa1 {Pseudoalteromonas s	99.76
d1r6va_		671	Fervidolysin {Fervidobacterium pennivorans [TaxId:	99.75
d2pwaa1		279	Proteinase K {Fungus (Tritirachium album), strain	99.68
d1t1ga_		357	Serine-carboxyl proteinase, SCP {Bacillus novosp.	99.42
d1v6ca_		435	Alkaline serine protease Apa1 {Pseudoalteromonas s	99.39
d1p8ja2		334	Furin, N-terminal domain {Mouse (Mus musculus) [Ta	99.24
d2id4a2		339	Kexin, N-terminal domain {Baker's yeast (Saccharom	99.19
d1wmda2		318	Alkaline serine protease kp-43, N-terminal domain	99.17
d1r0re_		274	Subtilisin {Bacillus subtilis, carlsberg [TaxId: 1	99.14
d1to2e_		281	Subtilisin {Bacillus amyloliquefaciens, Novo/BPN'	99.12
d1gcia_		269	Subtilisin {Bacillus lentus [TaxId: 1467]}	99.12
d1r6va_		671	Fervidolysin {Fervidobacterium pennivorans [TaxId:	99.09
d1thma_		279	Thermitase {Thermoactinomyces vulgaris [TaxId: 202	99.06
d1dbia_		280	Thermostable serine protease {Bacillus sp., AK.1 [	98.97
d2ixta1		309	Sphericase {Bacillus sphaericus [TaxId: 1421]}	98.96
d1ga6a_		369	Serine-carboxyl proteinase, SCP {Pseudomonas sp.,	98.73
d2pwaa1		279	Proteinase K {Fungus (Tritirachium album), strain	98.5
d1t1ga_		357	Serine-carboxyl proteinase, SCP {Bacillus novosp.	98.43
d1ga6a_		369	Serine-carboxyl proteinase, SCP {Pseudomonas sp.,	98.34
d2gk3a1		246	Putative cytoplasmic protein STM3548 {Salmonella t	81.72

>d1r0re_ c.41.1.1 (E:) Subtilisin {Bacillus subtilis, carlsberg [TaxId: 1423]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Subtilisin-like
superfamily: Subtilisin-like
family: Subtilases
domain: Subtilisin
species: Bacillus subtilis, carlsberg [TaxId: 1423]

Probab=99.85  E-value=5.7e-23  Score=203.53  Aligned_cols=116  Identities=35%  Similarity=0.447  Sum_probs=101.9

Q ss_pred             ccccccccCccEEEEeecCCcccccccccccccccccCCCCccCCCCCcceee---------------------------
Q psy1075          86 FLPLGIRGSGVKVAVFDTGLSSGHTGFNNVAERTDWTNENTLEDKLGHGTFVA---------------------------  138 (624)
Q Consensus        86 ~w~~G~tG~GV~VAVIDTGVd~~HPdf~~v~~~~~~t~~~~~~D~~GHGT~VA---------------------------  138 (624)
                      +|++|++|+||+|+||||||+.+||+|+.....+....+....|..+||||||                           
T Consensus        16 ~~~~g~tG~gv~VaViDtGv~~~Hp~l~~~~~~~~~~~~~~~~d~~gHGT~vAgii~~~~~~~~~~gvap~a~i~~~~~~   95 (274)
T d1r0re_          16 VQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVL   95 (274)
T ss_dssp             HHHHTCSCTTCEEEEEESCCCTTCTTCCEEEEEECSTTCCTTCCSSSHHHHHHHHHHCCSSSSBCCCSSTTSEEEEEECS
T ss_pred             HHHcCCCCCCeEEEEECCCCCCCChhhcccCCccccCCCCCCCCccccccccccccccccccccccccCCCcEEEEEEEe
Confidence            57889999999999999999999999986555555555666778999999999                           


Q ss_pred             --------------------------------------------------------------------------------
Q psy1075         139 --------------------------------------------------------------------------------  138 (624)
Q Consensus       139 --------------------------------------------------------------------------------  138 (624)
                                                                                                      
T Consensus        96 ~~~~~~~~~~i~~ai~~a~~~~~~i~n~S~~~~~~~~~~~~~~~~a~~~~~l~V~aaGN~g~~~~~~~~~~pa~~~~vi~  175 (274)
T d1r0re_          96 NSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGNSGSTNTIGYPAKYDSVIA  175 (274)
T ss_dssp             CTTSEECHHHHHHHHHHHHHTTCSEEEECEEBSSCCHHHHHHHHHHHHTTCEEEEECCSCCCCTTCCCCCBTTTSTTSEE
T ss_pred             CCCCCcCHHHHHHHHHHHHhcCCceeccccccccchhhhhHHHHHHhhCceEEEeeccCCCCCCCcccccccccCCCEEE
Confidence                                                                                            


Q ss_pred             ------------------------------------ceeccCcccccchhHHHHHHHHHhcCCCCCCCCCChHhhhhhhh
Q psy1075         139 ------------------------------------GCRTLSGTSVASPVVAGVVALLASGLKHRPAGHINPASMKQGPV  182 (624)
Q Consensus       139 ------------------------------------g~~~lSGTSmAAP~VAGaaALLlS~~P~~~~~~lspaqVkq~L~  182 (624)
                                                          ++..++|||||||+|||++||++|++|     .+++++||++|+
T Consensus       176 Vga~~~~~~~~~~s~~g~~~di~APG~~i~~~~~~~~~~~~sGTS~AaP~VaG~~All~~~~p-----~lt~~~i~~~L~  250 (274)
T d1r0re_         176 VGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHP-----NLSASQVRNRLS  250 (274)
T ss_dssp             EEEECTTSCBCTTCCCSTTEEEEEECSSEEEEETTTEEEEECSHHHHHHHHHHHHHHHHHHST-----TCCHHHHHHHHH
T ss_pred             EEeECCCCCcccccCCCCCEEEEecCCCcccccCCCCeEeecCCchhHHHHHHHHHHHHHHCC-----CCCHHHHHHHHH
Confidence                                                467889999999999999999999999     689999999999


Q ss_pred             cccccCCCCCCcccceeeeccccce
Q psy1075         183 SNITRPIGSRVPFCAGELNVNPQSK  207 (624)
Q Consensus       183 ~tA~~l~~~~~~~G~G~lnl~~a~~  207 (624)
                      ++|++++ +...+|+|++|+.+|++
T Consensus       251 ~tA~~~~-~~~~~G~G~ln~~~A~~  274 (274)
T d1r0re_         251 STATYLG-SSFYYGKGLINVEAAAQ  274 (274)
T ss_dssp             HTCBCCS-CHHHHTTCBCCHHHHTC
T ss_pred             hhCccCC-CCCceEcCeecHHHhcC
Confidence            9999874 34578999999999864

PyMOL of d1r0re_

>d1gcia_ c.41.1.1 (A:) Subtilisin {Bacillus lentus [TaxId: 1467]}	Back information, alignment and structure

>d1thma_ c.41.1.1 (A:) Thermitase {Thermoactinomyces vulgaris [TaxId: 2026]}	Back information, alignment and structure

>d1wmda2 c.41.1.1 (A:1-318) Alkaline serine protease kp-43, N-terminal domain {Bacillus sp. KSM-KP43 [TaxId: 109322]}	Back information, alignment and structure

>d1to2e_ c.41.1.1 (E:) Subtilisin {Bacillus amyloliquefaciens, Novo/BPN' [TaxId: 1390]}	Back information, alignment and structure

>d1p8ja2 c.41.1.1 (A:109-442) Furin, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ixta1 c.41.1.1 (A:1-309) Sphericase {Bacillus sphaericus [TaxId: 1421]}	Back information, alignment and structure

>d1dbia_ c.41.1.1 (A:) Thermostable serine protease {Bacillus sp., AK.1 [TaxId: 1409]}	Back information, alignment and structure

>d2id4a2 c.41.1.1 (A:122-460) Kexin, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1v6ca_ c.41.1.1 (A:) Alkaline serine protease Apa1 {Pseudoalteromonas sp. AS-11 [TaxId: 247492]}	Back information, alignment and structure

>d1r6va_ c.41.1.1 (A:) Fervidolysin {Fervidobacterium pennivorans [TaxId: 93466]}	Back information, alignment and structure

>d2pwaa1 c.41.1.1 (A:1-279) Proteinase K {Fungus (Tritirachium album), strain limber [TaxId: 37998]}	Back information, alignment and structure

>d1t1ga_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Bacillus novosp. MN-32, kumamolisin [TaxId: 198803]}	Back information, alignment and structure

>d1v6ca_ c.41.1.1 (A:) Alkaline serine protease Apa1 {Pseudoalteromonas sp. AS-11 [TaxId: 247492]}	Back information, alignment and structure

>d1p8ja2 c.41.1.1 (A:109-442) Furin, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2id4a2 c.41.1.1 (A:122-460) Kexin, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1wmda2 c.41.1.1 (A:1-318) Alkaline serine protease kp-43, N-terminal domain {Bacillus sp. KSM-KP43 [TaxId: 109322]}	Back information, alignment and structure

>d1r0re_ c.41.1.1 (E:) Subtilisin {Bacillus subtilis, carlsberg [TaxId: 1423]}	Back information, alignment and structure

>d1to2e_ c.41.1.1 (E:) Subtilisin {Bacillus amyloliquefaciens, Novo/BPN' [TaxId: 1390]}	Back information, alignment and structure

>d1gcia_ c.41.1.1 (A:) Subtilisin {Bacillus lentus [TaxId: 1467]}	Back information, alignment and structure

>d1r6va_ c.41.1.1 (A:) Fervidolysin {Fervidobacterium pennivorans [TaxId: 93466]}	Back information, alignment and structure

>d1thma_ c.41.1.1 (A:) Thermitase {Thermoactinomyces vulgaris [TaxId: 2026]}	Back information, alignment and structure

>d1dbia_ c.41.1.1 (A:) Thermostable serine protease {Bacillus sp., AK.1 [TaxId: 1409]}	Back information, alignment and structure

>d2ixta1 c.41.1.1 (A:1-309) Sphericase {Bacillus sphaericus [TaxId: 1421]}	Back information, alignment and structure

>d1ga6a_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Pseudomonas sp., sedolisin [TaxId: 306]}	Back information, alignment and structure

>d2pwaa1 c.41.1.1 (A:1-279) Proteinase K {Fungus (Tritirachium album), strain limber [TaxId: 37998]}	Back information, alignment and structure

>d1t1ga_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Bacillus novosp. MN-32, kumamolisin [TaxId: 198803]}	Back information, alignment and structure

>d1ga6a_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Pseudomonas sp., sedolisin [TaxId: 306]}	Back information, alignment and structure

>d2gk3a1 c.23.16.9 (A:8-253) Putative cytoplasmic protein STM3548 {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure