Psyllid ID: psy10824

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MKLPTPQYVNHSHHLLLRHVTRDSNPGLWADPDILKSSPSFLSSLKFGLSLTPQSQEPNPDLQLGSEHFGDYQSNTELPEEFDLRKQYPNCTNIGHVQLQSNCGSCWAIATTAALSDRMCIATQGRLDHTLSSDHLLTCCAACTGGDVCEGGNPMRAWYYMLENGVPTGGDYGSCQRFDRGNCNC
ccccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcccccccccccccccHHHHHHHHHcccccccccccccccccccccc
ccccccccccccHHHHHHHHHHcccccEEccccccccccHHHHHHHHHHccccccccccccHccccccEEcccccccccccEEHHHHcccccccccccEccccccHHHHHHHHHHHHHHHHHccccccccEcHHHHHHHHcccccccccccccHHHHHHHHHHcccEEccccccccccccccccc
mklptpqyvnhshHLLLRHvtrdsnpglwadpdilksspsflsslkfglsltpqsqepnpdlqlgsehfgdyqsntelpeefdlrkqypnctnighvqlqsncgsCWAIATTAALSDRMCiatqgrldhtlssdhlltccaactggdvceggnpMRAWYYMLEngvptggdygscqrfdrgncnc
mklptpqyvnhSHHLLLRHVTRDSNPGLWADPDILKSSPSFLSSLKFGLSLTPQSQEPNPDLQLGSEHFGDYQSNTELPEEFDLRKQYPNCTNIGHVQLQSNCGSCWAIATTAALSDRMCIATQGRLDHTLSSDHLLTCCAACTGGDVCEGGNPMRAWYYMLENGVPTGGDYGSCQRFDRGNCNC
MKLPTPQYVNHSHHLLLRHVTRDSNPGLWADPDIlksspsflsslkfglslTPQSQEPNPDLQLGSEHFGDYQSNTELPEEFDLRKQYPNCTNIGHVQLQSNCGSCWAIATTAALSDRMCIATQGRLDHTLSSDHLLTCCAACTGGDVCEGGNPMRAWYYMLENGVPTGGDYGSCQRFDRGNCNC
***********SHHLLLRHVTRD**PGLWAD**************************************************FDLRKQYPNCTNIGHVQLQSNCGSCWAIATTAALSDRMCIATQGRLDHTLSSDHLLTCCAACTGGDVCEGGNPMRAWYYMLENGVPTGGDYGSCQR********
*****PQ***HSHHLLLRHVTRDSNPGLWADPDILKSSPSFLSSLKFGL**************************TELPEEFDLRKQYPNCTNIGHVQLQSNCGSCWAIATTAALSDRMCIATQGRLDHTLSSDHLLTCCAACTGGDVCEGGNPMRAWYYMLENGVPTGGDYGSCQRFDRGNC*C
MKLPTPQYVNHSHHLLLRHVTRDSNPGLWADPDILKSSPSFLSSLKFGLSLTPQSQEPNPDLQLGSEHFGDYQSNTELPEEFDLRKQYPNCTNIGHVQLQSNCGSCWAIATTAALSDRMCIATQGRLDHTLSSDHLLTCCAACTGGDVCEGGNPMRAWYYMLENGVPTGGDYGSCQRFDRGNCNC
MKLPTPQYVNHSHHLLLRHVTRDSNPGLWADPDILKSSPSFLSSLKFGLSLTPQSQ*PNPD*QLGSEHFGDYQSNTELPEEFDLRKQYPNCTNIGHVQLQSNCGSCWAIATTAALSDRMCIATQGRLDHTLSSDHLLTCCAACTGGDVCEGGNPMRAWYYMLENGVPTGGDYGSCQRFDRGNCNC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLPTPQYVNHSHHLLLRHVTRDSNPGLWADPDILKSSPSFLSSLKFGLSLTPQSQEPNPDLQLGSEHFGDYQSNTELPEEFDLRKQYPNCTNIGHVQLQSNCGSCWAIATTAALSDRMCIATQGRLDHTLSSDHLLTCCAACTGGDVCEGGNPMRAWYYMLENGVPTGGDYGSCQRFDRGNCNC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query185 2.2.26 [Sep-21-2011]
P43510 379 Cathepsin B-like cysteine yes N/A 0.572 0.279 0.440 2e-22
P43509 344 Cathepsin B-like cysteine no N/A 0.513 0.276 0.479 7e-22
P25802 341 Cathepsin B-like cysteine N/A N/A 0.562 0.304 0.440 1e-21
P10605 339 Cathepsin B OS=Mus muscul yes N/A 0.551 0.300 0.446 3e-20
P43508 335 Cathepsin B-like cysteine no N/A 0.778 0.429 0.349 6e-20
P43157 342 Cathepsin B-like cysteine N/A N/A 0.508 0.274 0.447 9e-20
P00787 339 Cathepsin B OS=Rattus nor yes N/A 0.551 0.300 0.436 1e-19
P43233 340 Cathepsin B OS=Gallus gal yes N/A 0.551 0.3 0.428 2e-19
A1E295 335 Cathepsin B OS=Sus scrofa yes N/A 0.551 0.304 0.417 4e-19
P25793 342 Cathepsin B-like cysteine N/A N/A 0.513 0.277 0.432 6e-19
>sp|P43510|CPR6_CAEEL Cathepsin B-like cysteine proteinase 6 OS=Caenorhabditis elegans GN=cpr-6 PE=1 SV=1 Back     alignment and function desciption
 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 65  GSEHFGDYQS-NTELPEEFDLRKQYPNCTNIGHVQLQSNCGSCWAIATTAALSDRMCIAT 123
           G +H    +  + ++PE FD R  +P C +I  ++ QS+CGSCWA     A+SDR+CIA+
Sbjct: 91  GKQHLSKTKDLDLDIPESFDSRDNWPKCDSIKVIRDQSSCGSCWAFGAVEAMSDRICIAS 150

Query: 124 QGRLDHTLSSDHLLTCCAACTGGDVCEGGNPMRAWYYMLENGVPTGGDY 172
            G L  TLS+D LL+CC +C  G  C GG+P+ AW Y +++G+ TG +Y
Sbjct: 151 HGELQVTLSADDLLSCCKSCGFG--CNGGDPLAAWRYWVKDGIVTGSNY 197

Caenorhabditis elegans (taxid: 6239)
EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: -
>sp|P43509|CPR5_CAEEL Cathepsin B-like cysteine proteinase 5 OS=Caenorhabditis elegans GN=cpr-5 PE=2 SV=1 Back     alignment and function description
>sp|P25802|CYSP1_OSTOS Cathepsin B-like cysteine proteinase 1 OS=Ostertagia ostertagi GN=CP-1 PE=3 SV=3 Back     alignment and function description
>sp|P10605|CATB_MOUSE Cathepsin B OS=Mus musculus GN=Ctsb PE=1 SV=2 Back     alignment and function description
>sp|P43508|CPR4_CAEEL Cathepsin B-like cysteine proteinase 4 OS=Caenorhabditis elegans GN=cpr-4 PE=2 SV=1 Back     alignment and function description
>sp|P43157|CYSP_SCHJA Cathepsin B-like cysteine proteinase OS=Schistosoma japonicum GN=CATB PE=2 SV=1 Back     alignment and function description
>sp|P00787|CATB_RAT Cathepsin B OS=Rattus norvegicus GN=Ctsb PE=1 SV=2 Back     alignment and function description
>sp|P43233|CATB_CHICK Cathepsin B OS=Gallus gallus GN=CTSB PE=2 SV=1 Back     alignment and function description
>sp|A1E295|CATB_PIG Cathepsin B OS=Sus scrofa GN=CTSB PE=1 SV=1 Back     alignment and function description
>sp|P25793|CYSP2_HAECO Cathepsin B-like cysteine proteinase 2 OS=Haemonchus contortus GN=AC-2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
187103108 346 cathepsin B-1418 precursor [Acyrthosipho 0.540 0.289 0.495 1e-23
157058755218 cathepsin B-84 [Aulacorthum solani] 0.605 0.513 0.44 2e-23
87246247 333 cathepsin B-like cysteine protease [Tria 0.6 0.333 0.465 4e-23
161343865 335 TPA_inf: cathepsin B [Myzus persicae] 0.605 0.334 0.448 7e-23
204022085 335 cathepsin B-S [Astegopteryx spinocephala 0.545 0.301 0.485 1e-22
76576341 344 cathepsin B-like cysteine protease 2 [Pa 0.708 0.380 0.393 1e-22
146165818 338 Papain family cysteine protease containi 0.535 0.292 0.524 1e-22
239788404 335 ACYPI000014 [Acyrthosiphon pisum] 0.535 0.295 0.495 1e-22
209863073 333 cathepsin B-1852 [Acyrthosiphon pisum] 0.556 0.309 0.457 2e-22
157058761220 cathepsin B-84 [Myzus persicae] 0.605 0.509 0.448 2e-22
>gi|187103108|ref|NP_001119614.1| cathepsin B-1418 precursor [Acyrthosiphon pisum] gi|163300438|tpg|DAA06126.1| TPA_inf: cathepsin B transcript 1418 [Acyrthosiphon pisum] gi|239788654|dbj|BAH70998.1| ACYPI000010 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 51/103 (49%), Positives = 74/103 (71%), Gaps = 3/103 (2%)

Query: 73  QSNTELPEEFDLRKQYPNCTNI-GHVQLQSNCGSCWAIATTAALSDRMCIATQGRLDHTL 131
           +SN  LPE FD R+++P C+++ G ++ QSNCGSCWA++  +  SDR+CIAT G +   L
Sbjct: 85  ESNEALPENFDARERWPECSSLLGSIKDQSNCGSCWAVSAASVFSDRLCIATGGAVARNL 144

Query: 132 SSDHLLTCCAACTGGDVCEGGNPMRAWYYMLENGVPTGGDYGS 174
           S++ L TCC  C  G+ C+GG+P  AWY+ + +G+ TGGDYGS
Sbjct: 145 SAEQLNTCCYRC--GNGCDGGSPESAWYFFMRHGIVTGGDYGS 185

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|157058755|gb|ABV03135.1| cathepsin B-84 [Aulacorthum solani] Back     alignment and taxonomy information
>gi|87246247|gb|ABD35300.1| cathepsin B-like cysteine protease [Triatoma infestans] Back     alignment and taxonomy information
>gi|161343865|tpg|DAA06113.1| TPA_inf: cathepsin B [Myzus persicae] Back     alignment and taxonomy information
>gi|204022085|dbj|BAG71140.1| cathepsin B-S [Astegopteryx spinocephala] Back     alignment and taxonomy information
>gi|76576341|gb|ABA53864.1| cathepsin B-like cysteine protease 2 [Parelaphostrongylus tenuis] Back     alignment and taxonomy information
>gi|146165818|ref|XP_001015807.2| Papain family cysteine protease containing protein [Tetrahymena thermophila] gi|146145394|gb|EAR95562.2| Papain family cysteine protease containing protein [Tetrahymena thermophila SB210] Back     alignment and taxonomy information
>gi|239788404|dbj|BAH70886.1| ACYPI000014 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|209863073|ref|NP_001119610.2| cathepsin B-1852 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|157058761|gb|ABV03138.1| cathepsin B-84 [Myzus persicae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
FB|FBgn0030521 340 CtsB1 "Cathepsin B1" [Drosophi 0.621 0.338 0.450 2.9e-25
WB|WBGene00000784 335 cpr-4 [Caenorhabditis elegans 0.637 0.352 0.417 5.3e-24
WB|WBGene00000786 379 cpr-6 [Caenorhabditis elegans 0.572 0.279 0.440 6.8e-24
WB|WBGene00000785 344 cpr-5 [Caenorhabditis elegans 0.572 0.308 0.436 1.8e-23
WB|WBGene00021072 335 W07B8.4 [Caenorhabditis elegan 0.572 0.316 0.418 1.8e-23
ZFIN|ZDB-GENE-070323-1 326 ctsbb "capthepsin B, b" [Danio 0.616 0.349 0.394 1.6e-22
MGI|MGI:88561 339 Ctsb "cathepsin B" [Mus muscul 0.567 0.309 0.450 3.4e-22
WB|WBGene00021070 335 W07B8.1 [Caenorhabditis elegan 0.583 0.322 0.412 7e-22
UNIPROTKB|E2R6Q7 339 CTSB "Uncharacterized protein" 0.545 0.297 0.442 9e-22
RGD|621509 339 Ctsb "cathepsin B" [Rattus nor 0.567 0.309 0.440 9e-22
FB|FBgn0030521 CtsB1 "Cathepsin B1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 287 (106.1 bits), Expect = 2.9e-25, P = 2.9e-25
 Identities = 55/122 (45%), Positives = 74/122 (60%)

Query:    67 EHFGDYQSNT--ELPEEFDLRKQYPNCTNIGHVQLQSNCGSCWAIATTAALSDRMCIATQ 124
             E  GD   N+  ELPEEFD RKQ+PNC  IG ++ Q +CGSCWA     A+SDR+CI + 
Sbjct:    74 EVLGDLYVNSVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSG 133

Query:   125 GRLDHTLSSDHLLTCCAACTGGDVCEGGNPMRAWYYMLENGVPTGGDYGS---CQRFDRG 181
             G+++   S+D L++CC  C  G  C GG P  AW Y    G+ +GG YGS   C+ ++  
Sbjct:   134 GKVNFHFSADDLVSCCHTCGFG--CNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEIS 191

Query:   182 NC 183
              C
Sbjct:   192 PC 193
GO:0004197 "cysteine-type endopeptidase activity" evidence=ISS
GO:0035071 "salivary gland cell autophagic cell death" evidence=IEP
GO:0048102 "autophagic cell death" evidence=IEP
GO:0006508 "proteolysis" evidence=IEA
GO:0050790 "regulation of catalytic activity" evidence=IEA
WB|WBGene00000784 cpr-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00000786 cpr-6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00000785 cpr-5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00021072 W07B8.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070323-1 ctsbb "capthepsin B, b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:88561 Ctsb "cathepsin B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
WB|WBGene00021070 W07B8.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E2R6Q7 CTSB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|621509 Ctsb "cathepsin B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.22LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
cd02620 236 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro 3e-36
pfam00112 213 pfam00112, Peptidase_C1, Papain family cysteine pr 1e-25
smart00645175 smart00645, Pept_C1, Papain family cysteine protea 2e-24
cd02248 210 cd02248, Peptidase_C1A, Peptidase C1A subfamily (M 1e-18
cd02698 239 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th 2e-17
cd02619 223 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS 1e-11
cd02621 243 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al 2e-07
PTZ00200 448 PTZ00200, PTZ00200, cysteine proteinase; Provision 1e-06
PTZ00021 489 PTZ00021, PTZ00021, falcipain-2; Provisional 5e-04
PTZ00203 348 PTZ00203, PTZ00203, cathepsin L protease; Provisio 0.003
PTZ00049 693 PTZ00049, PTZ00049, cathepsin C-like protein; Prov 0.004
>gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information 
 Score =  125 bits (317), Expect = 3e-36
 Identities = 48/107 (44%), Positives = 64/107 (59%), Gaps = 6/107 (5%)

Query: 79  PEEFDLRKQYPNCTNIGHVQLQSNCGSCWAIATTAALSDRMCIATQGRLDHTLSSDHLLT 138
           PE FD R+++PNC +IG ++ Q NCGSCWA +   A SDR+CI + G+ +  LS+  LL+
Sbjct: 1   PESFDAREKWPNCISIGEIRDQGNCGSCWAFSAVEAFSDRLCIQSNGKENVLLSAQDLLS 60

Query: 139 CCAACTGGDVCEGGNPMRAWYYMLENGVPTGGDYGSCQRFDRGNCNC 185
           CC+ C  G  C GG P  AW Y+   GV TGG    CQ +    C  
Sbjct: 61  CCSGCGDG--CNGGYPDAAWKYLTTTGVVTGG----CQPYTIPPCGH 101

Cathepsin B is a lysosomal papain-like cysteine peptidase which is expressed in all tissues and functions primarily as an exopeptidase through its carboxydipeptidyl activity. Together with other cathepsins, it is involved in the degradation of proteins, proenzyme activation, Ag processing, metabolism and apoptosis. Cathepsin B has been implicated in a number of human diseases such as cancer, rheumatoid arthritis, osteoporosis and Alzheimer's disease. The unique carboxydipeptidyl activity of cathepsin B is attributed to the presence of an occluding loop in its active site which favors the binding of the C-termini of substrate proteins. Some members of this group do not possess the occluding loop. TIN-Ag is an extracellular matrix basement protein which was originally identified as a target Ag involved in anti-tubular basement membrane antibody-mediated interstitial nephritis. It plays a role in renal tubulogenesis and is defective in hereditary tubulointerstitial disorders. TIN-Ag is exclusively expressed in kidney tissues. . Length = 236
>gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional Back     alignment and domain information
>gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional Back     alignment and domain information
>gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional Back     alignment and domain information
>gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 185
KOG1542|consensus 372 100.0
PTZ00203 348 cathepsin L protease; Provisional 100.0
PTZ00200 448 cysteine proteinase; Provisional 100.0
KOG1543|consensus 325 100.0
PTZ00021 489 falcipain-2; Provisional 100.0
cd02621 243 Peptidase_C1A_CathepsinC Cathepsin C; also known a 99.97
cd02620 236 Peptidase_C1A_CathepsinB Cathepsin B group; compos 99.96
PTZ00049 693 cathepsin C-like protein; Provisional 99.96
cd02698 239 Peptidase_C1A_CathepsinX Cathepsin X; the only pap 99.95
PTZ00364 548 dipeptidyl-peptidase I precursor; Provisional 99.95
smart00645174 Pept_C1 Papain family cysteine protease. 99.94
cd02248 210 Peptidase_C1A Peptidase C1A subfamily (MEROPS data 99.94
PF00112 219 Peptidase_C1: Papain family cysteine protease This 99.93
KOG1544|consensus 470 99.88
cd02619 223 Peptidase_C1 C1 Peptidase family (MEROPS database 99.88
PTZ00462 1004 Serine-repeat antigen protein; Provisional 99.82
COG4870 372 Cysteine protease [Posttranslational modification, 98.96
cd00585 437 Peptidase_C1B Peptidase C1B subfamily (MEROPS data 97.62
PF03051 438 Peptidase_C1_2: Peptidase C1-like family This fami 97.34
PF0824658 Inhibitor_I29: Cathepsin propeptide inhibitor doma 94.78
smart0084857 Inhibitor_I29 Cathepsin propeptide inhibitor domai 90.57
COG3579 444 PepC Aminopeptidase C [Amino acid transport and me 82.84
>KOG1542|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.5e-39  Score=271.44  Aligned_cols=153  Identities=26%  Similarity=0.438  Sum_probs=130.5

Q ss_pred             HhhhhcCCCCCCCCChhhhhhchhHHHhHhhcccCCCCCCCCCCCccCCCCcccCCCC----------------------
Q psy10824         17 LRHVTRDSNPGLWADPDILKSSPSFLSSLKFGLSLTPQSQEPNPDLQLGSEHFGDYQS----------------------   74 (185)
Q Consensus        17 ~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~----------------------   74 (185)
                      |.....+..+.|=-.+|...|.++|..++....++..   ...-+...|.++|+|++.                      
T Consensus        71 F~~F~~kf~r~Y~s~eE~~~Rl~iF~~N~~~a~~~q~---~d~gsA~yGvtqFSDlT~eEFkk~~l~~~~~~~~~~~~~~  147 (372)
T KOG1542|consen   71 FKLFTIKFGRSYASREEHAHRLSIFKHNLLRAERLQE---NDPGSAEYGVTQFSDLTEEEFKKIYLGVKRRGSKLPGDAA  147 (372)
T ss_pred             HHHHHHhcCcccCcHHHHHHHHHHHHHHHHHHHHhhh---cCccccccCccchhhcCHHHHHHHhhccccccccCccccc
Confidence            4445555666666778888999999999988876433   233367788899988774                      


Q ss_pred             ------CCCCCCceeccccCCCCCCcccccccccccchhhhhhhhhHHHHHHHHhcCCccccCCHHHHHhhcCCCCCCCC
Q psy10824         75 ------NTELPEEFDLRKQYPNCTNIGHVQLQSNCGSCWAIATTAALSDRMCIATQGRLDHTLSSDHLLTCCAACTGGDV  148 (185)
Q Consensus        75 ------~~~lP~s~DwR~~~~~cg~v~~v~dQg~CgsCwAfa~~~~le~~~~i~~~~~~~~~LS~Q~lvdC~~~~~~~~g  148 (185)
                            ...||++||||++    |+||||||||.||||||||+++++|+.++|++++.  +.|||||||||+..   ++|
T Consensus       148 ~~~~~~~~~lP~~fDWR~k----gaVTpVKnQG~CGSCWAFS~tG~vEga~~i~~g~L--vsLSEQeLvDCD~~---d~g  218 (372)
T KOG1542|consen  148 EAPIEPGESLPESFDWRDK----GAVTPVKNQGMCGSCWAFSTTGAVEGAWAIATGKL--VSLSEQELVDCDSC---DNG  218 (372)
T ss_pred             cCcCCCCCCCCcccchhcc----CCccccccCCcCcchhhhhhhhhhhhHHHhhcCcc--cccchhhhhcccCc---CCc
Confidence                  3679999999999    99999999999999999999999999999999654  89999999999864   899


Q ss_pred             CCCCChHHHHHHHHHc-CCCCCCCCCCCCCCCCCCC-CC
Q psy10824        149 CEGGNPMRAWYYMLEN-GVPTGGDYGSCQRFDRGNC-NC  185 (185)
Q Consensus       149 C~GG~~~~a~~yi~~~-Gi~~e~~Y~~C~PY~~~~~-~C  185 (185)
                      |+||.+..||+|+++. ||+.|++|    ||++... +|
T Consensus       219 C~GGl~~nA~~~~~~~gGL~~E~dY----PY~g~~~~~C  253 (372)
T KOG1542|consen  219 CNGGLMDNAFKYIKKAGGLEKEKDY----PYTGKKGNQC  253 (372)
T ss_pred             CCCCChhHHHHHHHHhCCccccccC----CccccCCCcc
Confidence            9999999999996665 99999999    9999988 76

>PTZ00203 cathepsin L protease; Provisional Back     alignment and domain information
>PTZ00200 cysteine proteinase; Provisional Back     alignment and domain information
>KOG1543|consensus Back     alignment and domain information
>PTZ00021 falcipain-2; Provisional Back     alignment and domain information
>cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>PTZ00049 cathepsin C-like protein; Provisional Back     alignment and domain information
>cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>PTZ00364 dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>smart00645 Pept_C1 Papain family cysteine protease Back     alignment and domain information
>cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification Back     alignment and domain information
>KOG1544|consensus Back     alignment and domain information
>cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>PTZ00462 Serine-repeat antigen protein; Provisional Back     alignment and domain information
>COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) Back     alignment and domain information
>PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08246 Inhibitor_I29: Cathepsin propeptide inhibitor domain (I29); InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
1cpj_A 260 Crystal Structures Of Recombinant Rat Cathepsin B A 1e-20
1cte_A 254 Crystal Structures Of Recombinant Rat Cathepsin B A 4e-20
1mir_A 322 Rat Procathepsin B Length = 322 1e-19
1pbh_A 317 Crystal Structure Of Human Recombinant Procathepsin 4e-19
1gmy_A 261 Cathepsin B Complexed With Dipeptidyl Nitrile Inhib 1e-18
3ai8_B 256 Cathepsin B In Complex With The Nitroxoline Length 1e-18
3k9m_A 254 Cathepsin B In Complex With Stefin A Length = 254 1e-18
3qsd_A 254 Structure Of Cathepsin B1 From Schistosoma Mansoni 2e-18
3cbj_A 266 Chagasin-cathepsin B Complex Length = 266 4e-18
3hhi_A 325 Crystal Structure Of Cathepsin B From T. Brucei In 3e-17
3mor_A 317 Crystal Structure Of Cathepsin B From Trypanosoma B 3e-17
4hwy_A 340 Trypanosoma Brucei Procathepsin B Solved From 40 Fs 4e-17
1qdq_A 253 X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 7e-15
1ito_A 256 Crystal Structure Analysis Of Bovine Spleen Catheps 1e-14
1sp4_A48 Crystal Structure Of Ns-134 In Complex With Bovine 9e-10
1deu_A 277 Crystal Structure Of Human Procathepsin X: A Cystei 6e-09
1huc_A47 The Refined 2.15 Angstroms X-Ray Crystal Structure 3e-08
1ef7_A 242 Crystal Structure Of Human Cathepsin X Length = 242 5e-08
3qj3_A 331 Structure Of Digestive Procathepsin L2 Proteinase F 1e-06
1fh0_A 221 Crystal Structure Of Human Cathepsin V Complexed Wi 1e-06
1npz_A 217 Crystal Structures Of Cathepsin S Inhibitor Complex 3e-06
2f1g_A 220 Cathepsin S In Complex With Non-Covalent 2-(Benzoxa 4e-06
3f75_A 224 Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In 4e-06
1ms6_A 222 Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L 6e-06
2fye_A 217 Mutant Human Cathepsin S With Irreversible Inhibito 6e-06
3ovx_A 218 Cathepsin S In Complex With A Covalent Inhibitor Wi 6e-06
2g6d_A 217 Human Cathepsin S Mutant With Vinyl Sulfone Inhibit 6e-06
3n3g_A 217 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri 6e-06
2fq9_A 225 Cathepsin S With Nitrile Inhibitor Length = 225 7e-06
3h6s_A 221 Strucure Of Clitocypin - Cathepsin V Complex Length 2e-05
2c0y_A 315 The Crystal Structure Of A Cys25ala Mutant Of Human 2e-05
8pch_A 220 Crystal Structure Of Porcine Cathepsin H Determined 3e-05
2pns_A 208 1.9 Angstrom Resolution Crystal Structure Of A Plan 3e-05
1pci_A 322 Procaricain Length = 322 4e-05
1glo_A 217 Crystal Structure Of Cys25ser Mutant Of Human Cathe 5e-05
3kwn_A 219 Cathepsin S In Complex With Thioether Acetamide P3 5e-05
3mpe_A 220 Crystal Structure Of Human Cathepsin-S C25s Mutant 5e-05
3iej_A 222 Pyrazole-Based Cathepsin S Inhibitors With Arylalky 5e-05
1ppo_A 216 Determination Of The Structure Of Papaya Protease O 5e-05
1meg_A 216 Crystal Structure Of A Caricain D158e Mutant In Com 6e-05
3hwn_A 258 Cathepsin L With Az13010160 Length = 258 7e-05
3of8_A 221 Structural Basis For Reversible And Irreversible In 1e-04
2bdz_A 214 Mexicain From Jacaratia Mexicana Length = 214 1e-04
1icf_A175 Crystal Structure Of Mhc Class Ii Associated P41 Ii 2e-04
3h89_A 220 A Combined Crystallographic And Molecular Dynamics 3e-04
3hha_A 220 Crystal Structure Of Cathepsin L In Complex With Az 3e-04
1o0e_A 208 1.9 Angstrom Crystal Structure Of A Plant Cysteine 3e-04
1cqd_A 221 The 2.1 Angstrom Structure Of A Cysteine Protease W 4e-04
3d6s_A 223 Crystal Structure Of Mite Allergen Der F 1 Length = 6e-04
2nqd_B 221 Crystal Structure Of Cysteine Protease Inhibitor, C 7e-04
2fo5_A 262 Crystal Structure Of Recombinant Barley Cysteine En 7e-04
>pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 Back     alignment and structure 
Iteration: 1

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 62/103 (60%), Gaps = 1/103 (0%)
Query: 72  YQSNTELPEEFDLRKQYPNCTNIGHVQLQSNCGSCWAIATTAALSDRMCIATQGRLDHTL 131
           +  +  LPE FD R+Q+ NC  I  ++ Q +CGSCWA     A+SDR+CI T GR++  +
Sbjct: 1   FSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEV 60
Query: 132 SSDHLLTCCAACTGGDVCEGGNPMRAWYYMLENGVPTGGDYGS 174
           S++ LLTCC     GD C GG P  AW +    G+ +GG Y S
Sbjct: 61  SAEDLLTCCGI-QCGDGCNGGYPSGAWNFWTRKGLVSGGVYNS 102
>pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 Back     alignment and structure
>pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 Back     alignment and structure
>pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 Back     alignment and structure
>pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 Back     alignment and structure
>pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 Back     alignment and structure
>pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 Back     alignment and structure
>pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 Back     alignment and structure
>pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 Back     alignment and structure
>pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 Back     alignment and structure
>pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 Back     alignment and structure
>pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 Back     alignment and structure
>pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 Back     alignment and structure
>pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 Back     alignment and structure
>pdb|1SP4|A Chain A, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 48 Back     alignment and structure
>pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 Back     alignment and structure
>pdb|1HUC|A Chain A, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 47 Back     alignment and structure
>pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 Back     alignment and structure
>pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 Back     alignment and structure
>pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 Back     alignment and structure
>pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 Back     alignment and structure
>pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 Back     alignment and structure
>pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 Back     alignment and structure
>pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 Back     alignment and structure
>pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 Back     alignment and structure
>pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 Back     alignment and structure
>pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 Back     alignment and structure
>pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 Back     alignment and structure
>pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 Back     alignment and structure
>pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 Back     alignment and structure
>pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 Back     alignment and structure
>pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 Back     alignment and structure
>pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 Back     alignment and structure
>pdb|1PCI|A Chain A, Procaricain Length = 322 Back     alignment and structure
>pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 Back     alignment and structure
>pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 Back     alignment and structure
>pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 Back     alignment and structure
>pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 Back     alignment and structure
>pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 Back     alignment and structure
>pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 Back     alignment and structure
>pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 Back     alignment and structure
>pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 Back     alignment and structure
>pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 Back     alignment and structure
>pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 Back     alignment and structure
>pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 Back     alignment and structure
>pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 Back     alignment and structure
>pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 Back     alignment and structure
>pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 Back     alignment and structure
>pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 Back     alignment and structure
>pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 Back     alignment and structure
>pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
3cbj_A 266 Cathepsin B; cathepsin B, occluding loop, chagas d 2e-41
3pbh_A 317 Procathepsin B; thiol protease, cysteine protease, 1e-40
3qsd_A 254 Cathepsin B-like peptidase (C01 family); cysteine 4e-39
3hhi_A 325 Cathepsin B-like cysteine protease; occluding loop 8e-39
1deu_A 277 Procathepsin X; cysteine protease, proregion, pros 3e-30
3pdf_A 441 Cathepsin C, dipeptidyl peptidase 1; two domains, 4e-26
3ois_A 291 Cysteine protease; alpha and beta, hydrolase; HET: 3e-19
3qt4_A 329 Cathepsin-L-like midgut cysteine proteinase; hydro 4e-13
3qj3_A 331 Cathepsin L-like protein; hydrolase, proteinase, l 9e-13
1by8_A 314 Protein (procathepsin K); hydrolase(sulfhydryl pro 2e-12
1pci_A 322 Procaricain; zymogen, hydrolase, thiol protease; 3 2e-12
2c0y_A 315 Procathepsin S; proenzyme, proteinase, hydrolase, 2e-12
3f5v_A 222 DER P 1 allergen; allergy, asthma, DUST mites, gly 4e-12
1cs8_A 316 Human procathepsin L; prosegment, propeptide, inhi 4e-12
1xkg_A 312 DER P I, major mite fecal allergen DER P 1; major 1e-11
2o6x_A 310 Procathepsin L1, secreted cathepsin L 1; hydrolase 4e-11
2wbf_X 265 Serine-repeat antigen protein; SERA, malaria, vacu 1e-10
3ovx_A 218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 3e-10
1ppo_A 216 Protease omega; hydrolase(thiol protease); 1.80A { 4e-10
1yal_A 218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 4e-10
2bdz_A 214 Mexicain; cysteine protease, peptidase_C1, papain- 6e-10
2cio_A 212 Papain; hydrolase/inhibitor, complex hydrolase/inh 8e-10
3kwz_A 215 Cathepsin K; enzyme inhibitor, covalent reversible 8e-10
8pch_A 220 Cathepsin H; hydrolase, protease, cysteine protein 2e-09
3bwk_A 243 Cysteine protease falcipain-3; malaria, hydrolase; 2e-09
2oul_A 241 Falcipain 2; cysteine protease, inhibitor, macromo 2e-09
3f75_A 224 Toxopain-2, cathepsin L protease; medical structur 3e-09
1cqd_A 221 Protein (protease II); cysteine protease, glycopro 4e-09
3ioq_A 213 CMS1MS2; caricaceae, cysteine protease, papain fam 5e-09
2fo5_A 262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 6e-09
2xu3_A 220 Cathepsin L1; hydrolase, drug design, thiol protea 8e-09
1o0e_A 208 Ervatamin C; plant cysteine protease, two domain, 9e-09
1s4v_A 229 Cysteine endopeptidase; KDEL ER retention signal, 1e-08
1iwd_A 215 Ervatamin B; cysteine protease, alpha-beta protein 1e-08
1m6d_A 214 Cathepsin F, catsf; papain family cysteine proteas 1e-08
2b1m_A 246 SPE31; papain-like, sugar binding protein; HET: NA 2e-08
3p5u_A 220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 1e-07
3i06_A 215 Cruzipain; autocatalytic cleavage, glycoprotein, p 2e-06
3u8e_A 222 Papain-like cysteine protease; papain-like cystein 1e-05
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 Back     alignment and structure
 Score =  139 bits (352), Expect = 2e-41
 Identities = 43/117 (36%), Positives = 63/117 (53%), Gaps = 4/117 (3%)

Query: 72  YQSNTELPEEFDLRKQYPNCTNIGHVQLQSNCGSCWAIATTAALSDRMCIATQGRLDHTL 131
           +  + +LP  FD R+Q+P C  I  ++ Q +CGS WA     A+SDR+CI T   +   +
Sbjct: 1   FTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSAWAFGAVEAISDRICIHTNAHVSVEV 60

Query: 132 SSDHLLTCCAACTGGDVCEGGNPMRAWYYMLENGVPTGGDYGS---CQRFDRGNCNC 185
           S++ LLTCC +   GD C GG P  AW +    G+ +GG Y S   C+ +    C  
Sbjct: 61  SAEDLLTCCGSM-CGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEA 116
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 Back     alignment and structure
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
3tnx_A 363 Papain; hydrolase, cytoplasm for recombinant expre 100.0
3qj3_A 331 Cathepsin L-like protein; hydrolase, proteinase, l 100.0
3qt4_A 329 Cathepsin-L-like midgut cysteine proteinase; hydro 100.0
1cs8_A 316 Human procathepsin L; prosegment, propeptide, inhi 100.0
1pci_A 322 Procaricain; zymogen, hydrolase, thiol protease; 3 100.0
3pbh_A 317 Procathepsin B; thiol protease, cysteine protease, 100.0
2c0y_A 315 Procathepsin S; proenzyme, proteinase, hydrolase, 100.0
1by8_A 314 Protein (procathepsin K); hydrolase(sulfhydryl pro 100.0
2o6x_A 310 Procathepsin L1, secreted cathepsin L 1; hydrolase 100.0
3qsd_A 254 Cathepsin B-like peptidase (C01 family); cysteine 100.0
3hhi_A 325 Cathepsin B-like cysteine protease; occluding loop 100.0
3cbj_A 266 Cathepsin B; cathepsin B, occluding loop, chagas d 100.0
1xkg_A 312 DER P I, major mite fecal allergen DER P 1; major 100.0
3pdf_A 441 Cathepsin C, dipeptidyl peptidase 1; two domains, 100.0
3ioq_A 213 CMS1MS2; caricaceae, cysteine protease, papain fam 99.97
2cio_A 212 Papain; hydrolase/inhibitor, complex hydrolase/inh 99.97
3p5u_A 220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 99.97
1m6d_A 214 Cathepsin F, catsf; papain family cysteine proteas 99.97
1o0e_A 208 Ervatamin C; plant cysteine protease, two domain, 99.97
3u8e_A 222 Papain-like cysteine protease; papain-like cystein 99.97
1ppo_A 216 Protease omega; hydrolase(thiol protease); 1.80A { 99.97
2bdz_A 214 Mexicain; cysteine protease, peptidase_C1, papain- 99.97
3kwz_A 215 Cathepsin K; enzyme inhibitor, covalent reversible 99.97
1iwd_A 215 Ervatamin B; cysteine protease, alpha-beta protein 99.97
1cqd_A 221 Protein (protease II); cysteine protease, glycopro 99.97
1yal_A 218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 99.97
2xu3_A 220 Cathepsin L1; hydrolase, drug design, thiol protea 99.97
1s4v_A 229 Cysteine endopeptidase; KDEL ER retention signal, 99.97
3f5v_A 222 DER P 1 allergen; allergy, asthma, DUST mites, gly 99.97
2b1m_A 246 SPE31; papain-like, sugar binding protein; HET: NA 99.97
2fo5_A 262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 99.97
8pch_A 220 Cathepsin H; hydrolase, protease, cysteine protein 99.97
2oul_A 241 Falcipain 2; cysteine protease, inhibitor, macromo 99.97
3ovx_A 218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 99.97
3bwk_A 243 Cysteine protease falcipain-3; malaria, hydrolase; 99.97
3f75_A 224 Toxopain-2, cathepsin L protease; medical structur 99.97
3i06_A 215 Cruzipain; autocatalytic cleavage, glycoprotein, p 99.97
1deu_A 277 Procathepsin X; cysteine protease, proregion, pros 99.96
2wbf_X 265 Serine-repeat antigen protein; SERA, malaria, vacu 99.93
3ois_A 291 Cysteine protease; alpha and beta, hydrolase; HET: 99.91
2e01_A 457 Cysteine proteinase 1; bleomycin hydrolase, thiol 99.84
3pw3_A 383 Aminopeptidase C; bleomycin, cysteine proteinase f 99.84
2cb5_A 453 Protein (bleomycin hydrolase); aminopeptidase, cys 99.83
2l95_A80 Crammer, LP06209P; cysteine proteinase inhibitor, 96.46
3f75_P106 Toxopain-2, cathepsin L propeptide; medical struct 94.73
>3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} Back     alignment and structure
Probab=100.00  E-value=2e-38  Score=274.02  Aligned_cols=154  Identities=23%  Similarity=0.355  Sum_probs=134.6

Q ss_pred             hhHhhhhcCCCCCCCCChhhhhhchhHHHhHhhcccCCCCCCCCCCCccCCCCcccCCCC--------------------
Q psy10824         15 LLLRHVTRDSNPGLWADPDILKSSPSFLSSLKFGLSLTPQSQEPNPDLQLGSEHFGDYQS--------------------   74 (185)
Q Consensus        15 ~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~--------------------   74 (185)
                      .||.....+.++.|-...|+..|+.+|.++++.+..++.    .+.++++|.|+|+|++.                    
T Consensus        64 ~lf~~f~~~~~K~Y~~~~E~~~R~~iF~~Nl~~I~~~N~----~~~sy~~g~N~FaDlT~eEf~~~~~~~~~~~~~~~~~  139 (363)
T 3tnx_A           64 QLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNK----KNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTEL  139 (363)
T ss_dssp             HHHHHHHHHTTCCCSSHHHHHHHHHHHHHHHHHHHHHTT----SCCSEEECSCTTTTSCHHHHHHHHSCSSCSCCCCSSS
T ss_pred             HHHHHHHHHcCCcCCCHHHHHHHHHHHHHHHHHHHHHHc----CCCCeEEeccccccCCHHHHHHHhccccccccccccc
Confidence            345555566677776677888999999999999999775    35789999999999874                    


Q ss_pred             ---------CCCCCCceeccccCCCCCCcccccccccccchhhhhhhhhHHHHHHHHhcCCccccCCHHHHHhhcCCCCC
Q psy10824         75 ---------NTELPEEFDLRKQYPNCTNIGHVQLQSNCGSCWAIATTAALSDRMCIATQGRLDHTLSSDHLLTCCAACTG  145 (185)
Q Consensus        75 ---------~~~lP~s~DwR~~~~~cg~v~~v~dQg~CgsCwAfa~~~~le~~~~i~~~~~~~~~LS~Q~lvdC~~~~~~  145 (185)
                               ..+||++||||++    |+|+||||||.||||||||++++||++++|++++.  +.||+|+||||+..   
T Consensus       140 ~~~~~~~~~~~~lP~s~DWR~~----g~VtpVkdQG~CGSCWAFsa~~alE~~~~i~tg~~--~~LSeQ~LvdC~~~---  210 (363)
T 3tnx_A          140 SYEEVLNDGDVNIPEYVDWRQK----GAVTPVKNQGSCGSAWAFSAVSTIESIIKIRTGNL--NEYSEQELLDCDRR---  210 (363)
T ss_dssp             SSSCCCCCSCCCCCSCEEGGGG----TCCCCCCBCCSSBCHHHHHHHHHHHHHHHHHHSCC--CCBCHHHHHHHCTT---
T ss_pred             ccccccCcccCCCCcceecccC----CCCCCCccCCcCCchhhhhhcccHHHHHHHHcCCC--CCcCHHHHhcccCC---
Confidence                     2479999999999    99999999999999999999999999999999764  79999999999864   


Q ss_pred             CCCCCCCChHHHHHHHHHcCCCCCCCCCCCCCCCCCCCCC
Q psy10824        146 GDVCEGGNPMRAWYYMLENGVPTGGDYGSCQRFDRGNCNC  185 (185)
Q Consensus       146 ~~gC~GG~~~~a~~yi~~~Gi~~e~~Y~~C~PY~~~~~~C  185 (185)
                      +.||+||++..||+|++++||++|++|    ||++....|
T Consensus       211 ~~GC~GG~~~~a~~yi~~~Gi~~e~~y----PY~~~~~~c  246 (363)
T 3tnx_A          211 SYGCNGGYPWSALQLVAQYGIHYRNTY----PYEGVQRYC  246 (363)
T ss_dssp             SCTTBCCCHHHHHHHHHHTCBCBTTTS----CCCSSCCCC
T ss_pred             CCCCCCCChHHHHhHHHhcCccccccC----CCcCcCCCc
Confidence            789999999999999999999998887    999877665
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Back     alignment and structure
>2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Back     alignment and structure
>2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A Back     alignment and structure
>2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Back     alignment and structure
>3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 185
d1gmya_ 254 d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens 2e-26
d2h7ja1 217 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa 1e-16
d1cqda_ 216 d.3.1.1 (A:) Proline-specific cysteine protease {G 2e-16
d1deua_ 275 d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens 4e-16
g1k3b.1 233 d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase 1e-15
d1fh0a_ 221 d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens 1e-15
d1m6da_ 214 d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta 2e-15
d1aeca_ 218 d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi 8e-15
g8pch.1 228 d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax 9e-15
d1iwda_ 215 d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia 1e-14
d2oula1 241 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip 2e-14
d1s4va_ 224 d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor 2e-14
d1me4a_ 215 d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 1e-13
d2r6na1 215 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa 1e-13
d1o0ea_ 208 d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv 2e-13
d1yala_ 218 d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ 3e-13
d1ppoa_ 216 d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca 7e-13
d1khqa_ 212 d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId 1e-11
d1cs8a_ 316 d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens 2e-07
d1xkga1 302 d.3.1.1 (A:4-305) Major mite fecal allergen der p 2e-05
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: (Pro)cathepsin B
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 99.2 bits (246), Expect = 2e-26
 Identities = 44/111 (39%), Positives = 61/111 (54%), Gaps = 4/111 (3%)

Query: 78  LPEEFDLRKQYPNCTNIGHVQLQSNCGSCWAIATTAALSDRMCIATQGRLDHTLSSDHLL 137
           LP  FD R+Q+P C  I  ++ Q +CGSCWA     A+SDR+CI T   +   +S++ LL
Sbjct: 2   LPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLL 61

Query: 138 TCCAACTGGDVCEGGNPMRAWYYMLENGVPTGGDYGS---CQRFDRGNCNC 185
           TCC +   GD C GG P  AW +    G+ +GG Y S   C+ +    C  
Sbjct: 62  TCCGS-MCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEH 111
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 Back     information, alignment and structure
>d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 Back     information, alignment and structure
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 Back     information, alignment and structure
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
d1xkga1 302 Major mite fecal allergen der p 1 {House-dust mite 100.0
d1cs8a_ 316 (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 100.0
d1gmya_ 254 (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 99.95
d1ppoa_ 216 Caricain (protease omega) {Papaya (Carica papaya) 99.95
d1cqda_ 216 Proline-specific cysteine protease {Ginger rhizome 99.95
d1khqa_ 212 Papain {Papaya (Carica papaya) [TaxId: 3649]} 99.94
d1m6da_ 214 Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1yala_ 218 Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} 99.94
g1k3b.1 233 Cathepsin C (dipeptidyl peptidase I), catalytic do 99.94
d1fh0a_ 221 (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 99.94
d1deua_ 275 (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 99.94
d1o0ea_ 208 Ervatamin C {East indian rosebay (Ervatamia corona 99.93
d2oula1 241 Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} 99.93
d1iwda_ 215 Ervatamin B {Adam's apple (Ervatamia coronaria) [T 99.93
d2h7ja1 217 (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 99.93
d2r6na1 215 (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 99.93
d1aeca_ 218 Actinidin {Chinese gooseberry or kiwifruit (Actini 99.93
d1s4va_ 224 Vignain (bean endopeptidase) {Castor bean (Ricinus 99.93
g8pch.1 228 Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} 99.92
d1me4a_ 215 Cruzain {Trypanosoma cruzi [TaxId: 5693]} 99.91
d3gcba_ 458 Bleomycin hydrolase {Baker's yeast (Saccharomyces 97.8
d2cb5a_ 453 Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 97.52
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: Major mite fecal allergen der p 1
species: House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]

Probab=100.00  E-value=5.2e-35  Score=244.87  Aligned_cols=149  Identities=25%  Similarity=0.371  Sum_probs=122.7

Q ss_pred             hhcCCCCCCCCChhhhhhchhHHHhHhhcccCCCCCCCCCCCccCCCCcccCCC------------------------CC
Q psy10824         20 VTRDSNPGLWADPDILKSSPSFLSSLKFGLSLTPQSQEPNPDLQLGSEHFGDYQ------------------------SN   75 (185)
Q Consensus        20 ~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~------------------------~~   75 (185)
                      .....++.|=...|+..|+.+|.++++.+.+++.   ..+...+|..++|....                        ..
T Consensus         8 f~~~~~K~Y~~~~e~~~r~~if~~N~~~I~~~n~---~~N~fsDlt~eEf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   84 (302)
T d1xkga1           8 YKKAFNKSYATFEDEEAARKNFLESVKYVQSNGG---AINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSIN   84 (302)
T ss_dssp             HHHHTTCCCSSHHHHHHHHHHHHHHHHHHHHHCC---CCCTTTTSCHHHHHHHHSBCHHHHHHHHHHHC-----CBCCCC
T ss_pred             HHHHhCCCCCCHHHHHHHHHHHHHHHHHHHHhcc---CCCcCCCCCHHHHHHHhcCCCcccccccccCCCCccccccccC
Confidence            3344566665667778899999999999888664   23444555555543211                        13


Q ss_pred             CCCCCceeccccCCCCCCcccccccccccchhhhhhhhhHHHHHHHHhcCCccccCCHHHHHhhcCCCCCCCCCCCCChH
Q psy10824         76 TELPEEFDLRKQYPNCTNIGHVQLQSNCGSCWAIATTAALSDRMCIATQGRLDHTLSSDHLLTCCAACTGGDVCEGGNPM  155 (185)
Q Consensus        76 ~~lP~s~DwR~~~~~cg~v~~v~dQg~CgsCwAfa~~~~le~~~~i~~~~~~~~~LS~Q~lvdC~~~~~~~~gC~GG~~~  155 (185)
                      .++|++||||++    |+|+||||||.||||||||++++||++++|+++..  +.||+|+||||+.    +.||.||++.
T Consensus        85 ~~~P~~~DwR~~----g~vtpVkdQG~CGsCwAfa~~~~lE~~~~i~~~~~--~~lS~q~lvdC~~----~~~C~gG~~~  154 (302)
T d1xkga1          85 GNAPAEIDLRQM----RTVTPIRMQGGCGSAWAFSGVAATESAYLAYRDQS--LDLAEQELVDCAS----QHGCHGDTIP  154 (302)
T ss_dssp             SCCCSCEETTTT----TCCCCCCBCCSSBCHHHHHHHHHHHHHHHHHHCCC--CCBCHHHHHHHTC----SSTTBCCCHH
T ss_pred             CCCCcceecccc----CccccceeccccceehhhhhHHhHHHHHHHhcCCc--ccchhHHHHhccc----cCccCCCccc
Confidence            579999999999    99999999999999999999999999999998754  7899999999975    6799999999


Q ss_pred             HHHHHHHHcCCCCCCCCCCCCCCCCCCCCC
Q psy10824        156 RAWYYMLENGVPTGGDYGSCQRFDRGNCNC  185 (185)
Q Consensus       156 ~a~~yi~~~Gi~~e~~Y~~C~PY~~~~~~C  185 (185)
                      .|++|++++||++|++|    ||++...+|
T Consensus       155 ~a~~~~~~~Gi~~e~~y----PY~~~~~~C  180 (302)
T d1xkga1         155 RGIEYIQHNGVVQESYY----RYVAREQSC  180 (302)
T ss_dssp             HHHHHHHHHCEEBGGGS----CCCSSCCCC
T ss_pred             hhhhhhccCcccchhhc----ccccccccc
Confidence            99999999999998888    999988887
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure